Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F09603g35434918500.0
Scas_686.2241633616570.0
Kwal_14.178936333216410.0
AAR167C35934716340.0
Sklu_2171.436235616300.0
CAGL0K06831g35835216080.0
YBR221C (PDB1)36634916060.0
YGR186W (TFG1)735180663.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F09603g
         (349 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F09603g complement(882778..883842) highly similar to sp|P32...   717   0.0  
Scas_686.22                                                           642   0.0  
Kwal_14.1789                                                          636   0.0  
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...   634   0.0  
Sklu_2171.4 YBR221C, Contig c2171 8787-9875                           632   0.0  
CAGL0K06831g complement(665672..666748) highly similar to sp|P32...   624   0.0  
YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...   623   0.0  
YGR186W (TFG1) [2137] chr7 (867777..869984) RNA polymerase II tr...    30   3.3  

>KLLA0F09603g complement(882778..883842) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c PDB1 pyruvate
           dehydrogenase (lipoamide) beta chain precursor
           singleton, start by similarity
          Length = 354

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/349 (100%), Positives = 349/349 (100%)

Query: 1   MMMLSNTFKRAVPSVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGA 60
           MMMLSNTFKRAVPSVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGA
Sbjct: 1   MMMLSNTFKRAVPSVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGA 60

Query: 61  YKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINS 120
           YKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINS
Sbjct: 61  YKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINS 120

Query: 121 AAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGL 180
           AAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGL
Sbjct: 121 AAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGL 180

Query: 181 LKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQ 240
           LKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQ
Sbjct: 181 LKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQ 240

Query: 241 FSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEII 300
           FSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEII
Sbjct: 241 FSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEII 300

Query: 301 AQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAKS 349
           AQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAKS
Sbjct: 301 AQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAKS 349

>Scas_686.22
          Length = 416

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/336 (90%), Positives = 327/336 (97%)

Query: 13  PSVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFG 72
           P   Q++R+AS+KTMTVREALN+AMAEE+DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFG
Sbjct: 75  PLRFQALRYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFG 134

Query: 73  ERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINSAAKTYYMSGGTQ 132
           ERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQA+DQV+NSAAKT+YMSGGTQ
Sbjct: 135 ERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTHYMSGGTQ 194

Query: 133 KCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGLLKAAIRDPNPVV 192
           KCQIVFRGPNGSAVGVAAQHSQDYSAWYGS+PG+KVLVPYSAEDARGLLKAAIRDPNPVV
Sbjct: 195 KCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVV 254

Query: 193 FLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQFSLEAAEILSKQ 252
           FLENELLYG+SFE+S+E+LS DFTLPYKAKVEREG+DISII+YTRNVQFSLEAA IL KQ
Sbjct: 255 FLENELLYGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRNVQFSLEAAAILEKQ 314

Query: 253 YGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIAQIMESEAFDYL 312
           YGVS EVINLR+IRPLDV+AI+ TVKKTNHLITVESTFP+FGVGAEIIA++MESEAFDYL
Sbjct: 315 YGVSVEVINLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAEIIARVMESEAFDYL 374

Query: 313 DAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348
           DAPIQRVTGA+VPTPYAKELEDFAFPDPDTIVRA K
Sbjct: 375 DAPIQRVTGADVPTPYAKELEDFAFPDPDTIVRAVK 410

>Kwal_14.1789
          Length = 363

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/332 (90%), Positives = 320/332 (96%)

Query: 18  SMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVV 77
           S R ASTKTMTVR+ALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVV
Sbjct: 27  SRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVV 86

Query: 78  DTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINSAAKTYYMSGGTQKCQIV 137
           DTPITEMGFTGL+VGAALKGLKPIVEFMSFNFSMQA+DQV+NSAAKTYYMSGGTQKCQIV
Sbjct: 87  DTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIV 146

Query: 138 FRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENE 197
           FRGPNG+AVGV AQHSQD+SAWYGS+PGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENE
Sbjct: 147 FRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENE 206

Query: 198 LLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQFSLEAAEILSKQYGVSA 257
           LLYG+SFEVSEE LSTDFTLPY AKVEREG+DISII+YTRNVQFSL+AAEIL KQYGVSA
Sbjct: 207 LLYGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSA 266

Query: 258 EVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIAQIMESEAFDYLDAPIQ 317
           EVINLR+IRP+DV AII TVKKTNHLITVESTFP FGVG+EI+AQIMESEAFDYLDAP++
Sbjct: 267 EVINLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVK 326

Query: 318 RVTGAEVPTPYAKELEDFAFPDPDTIVRAAKS 349
           RVTGA+VPTPYAKELEDFAFPDPD IV A KS
Sbjct: 327 RVTGADVPTPYAKELEDFAFPDPDVIVSAVKS 358

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/347 (86%), Positives = 328/347 (94%), Gaps = 2/347 (0%)

Query: 4   LSNTFKRAVPSV--VQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGAY 61
           L +   R++ SV  +Q MRFAS+K+MTVR+ALNSAMAEEMDRDDDVFIIGEEVAQYNGAY
Sbjct: 7   LVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAY 66

Query: 62  KVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINSA 121
           KVTKGLLDRFGERRVVDTPITEMGF GLAVGAALKGLKPIVEFMSFNFSMQA+D V+NSA
Sbjct: 67  KVTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSA 126

Query: 122 AKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGLL 181
           AKTYYMSGG Q CQIVFRGPNG+AVGVAAQHSQDY+AWYGS+PG+KVL PYSAEDARGLL
Sbjct: 127 AKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCPYSAEDARGLL 186

Query: 182 KAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQF 241
           KAAIRDPNPVVFLENELLYG+SFEVSEE LS DFTLPY +KVEREG+DISII+Y+RNVQF
Sbjct: 187 KAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDISIITYSRNVQF 246

Query: 242 SLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIA 301
           SL AAEIL KQYGVSAEVIN+R+IRPLD++AII TVKKTNHLITVE+TFPAFGVG+EIIA
Sbjct: 247 SLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFPAFGVGSEIIA 306

Query: 302 QIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348
           QIMESEAFD+LDAP+QRVTGA+VPTPYAKELEDFAFPDPDTIVRAAK
Sbjct: 307 QIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAAK 353

>Sklu_2171.4 YBR221C, Contig c2171 8787-9875
          Length = 362

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/356 (85%), Positives = 329/356 (92%), Gaps = 11/356 (3%)

Query: 4   LSNTFKRAV---------PSVVQSMRFASTKT--MTVREALNSAMAEEMDRDDDVFIIGE 52
           +S+TF  AV         P  + + R ASTKT  MTVREALNSAMAEE+DRDDDVFIIGE
Sbjct: 1   MSSTFSAAVARTAKLAAAPFRLNATRMASTKTTKMTVREALNSAMAEELDRDDDVFIIGE 60

Query: 53  EVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQ 112
           EVAQYNGAYKVTKGLLDR+GERRVVDTPITEMGFTGLAVGAALKGLKP+VEFMSFNFSMQ
Sbjct: 61  EVAQYNGAYKVTKGLLDRYGERRVVDTPITEMGFTGLAVGAALKGLKPVVEFMSFNFSMQ 120

Query: 113 AMDQVINSAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPY 172
           A+D V+NSAAKTYYMSGGTQKCQIVFRGPNG+AVGV AQHSQDY+AWYGS+PG+KVL PY
Sbjct: 121 AIDHVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDYTAWYGSIPGLKVLSPY 180

Query: 173 SAEDARGLLKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISI 232
           SAEDARGLLKAAIRDPNPVVFLENELLYG+SF+VSEE LSTDFTLPY AKVEREGSDISI
Sbjct: 181 SAEDARGLLKAAIRDPNPVVFLENELLYGESFDVSEEVLSTDFTLPYTAKVEREGSDISI 240

Query: 233 ISYTRNVQFSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPA 292
           ++YTRNVQFSL+AAEIL KQ+GVS EV+NLR+IRPLDV+AII TVKKTNHLITVESTFPA
Sbjct: 241 VTYTRNVQFSLQAAEILEKQHGVSVEVVNLRSIRPLDVDAIIKTVKKTNHLITVESTFPA 300

Query: 293 FGVGAEIIAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348
           FGVG+EIIAQIMESEAFDYLDAP+QRVTGA+VPTPYAKELEDFAFPDPDTIVRA K
Sbjct: 301 FGVGSEIIAQIMESEAFDYLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAVK 356

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/352 (84%), Positives = 324/352 (92%), Gaps = 4/352 (1%)

Query: 1   MMMLSNTFKRAVP----SVVQSMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQ 56
           M+       R  P    +   ++R ASTKTMTVREALNSA+AEE+DRDDDVFIIGEEVAQ
Sbjct: 1   MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQ 60

Query: 57  YNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQ 116
           YNGAYKVTKGLLDRFGERRVVDTPITE GF GLAVGAALKGLKPIVEFMSFNFSMQA+D 
Sbjct: 61  YNGAYKVTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDH 120

Query: 117 VINSAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAED 176
           V+NSAAKT+YMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGS+PG+KVLVPYSAED
Sbjct: 121 VVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAED 180

Query: 177 ARGLLKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYT 236
           ARGLLKAAIRDPNPVVFLENELLYG+ FEVSEE+LS DFTLPY AKVE+EG DISII+YT
Sbjct: 181 ARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYT 240

Query: 237 RNVQFSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVG 296
           RN +FSL AA+IL ++YGVSAEVINLR+IRPLD++AI+ TVKKTNHLITVESTFP+FGVG
Sbjct: 241 RNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVG 300

Query: 297 AEIIAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348
           AEIIAQ+MESEAFDYLDAPIQRVTGA+VPTPYAKELEDFAFPDP+TIVRAAK
Sbjct: 301 AEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDPETIVRAAK 352

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/349 (84%), Positives = 327/349 (93%), Gaps = 6/349 (1%)

Query: 6   NTFKRAVPSVVQ------SMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNG 59
           N  +RA  S V+      ++RF+STKTMTVREALNSAMAEE+DRDDDVF+IGEEVAQYNG
Sbjct: 12  NVARRAPTSFVRPSAAAAALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNG 71

Query: 60  AYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVIN 119
           AYKV+KGLLDRFGERRVVDTPITE GFTGLAVGAALKGLKPIVEFMSFNFSMQA+D V+N
Sbjct: 72  AYKVSKGLLDRFGERRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVN 131

Query: 120 SAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARG 179
           SAAKT+YMSGGTQKCQ+VFRGPNG+AVGV AQHSQD+S WYGS+PG+KVLVPYSAEDARG
Sbjct: 132 SAAKTHYMSGGTQKCQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARG 191

Query: 180 LLKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNV 239
           LLKAAIRDPNPVVFLENELLYG+SFE+SEE+LS +FTLPYKAK+EREG+DISI++YTRNV
Sbjct: 192 LLKAAIRDPNPVVFLENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNV 251

Query: 240 QFSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEI 299
           QFSLEAAEIL K+YGVSAEVINLR+IRPLD EAII TVKKTNHLITVESTFP+FGVGAEI
Sbjct: 252 QFSLEAAEILQKKYGVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEI 311

Query: 300 IAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELEDFAFPDPDTIVRAAK 348
           +AQ+MESEAFDYLDAPIQRVTGA+VPTPYAKELEDFAFPD  TIV+A K
Sbjct: 312 VAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVK 360

>YGR186W (TFG1) [2137] chr7 (867777..869984) RNA polymerase II
           transcription initiation factor TFIIF (factor g), 105
           kDa subunit, component of RNA polymerase holoenzyme
           complex [2208 bp, 735 aa]
          Length = 735

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 72/180 (40%), Gaps = 44/180 (24%)

Query: 166 MKVLVPYSAEDARGLLKAAIRDPN----------PVVFLENELLYGQSFEVSEE-SLSTD 214
           M + +   A+  R  +K    DPN          P   LEN   +   F+  ++ +  TD
Sbjct: 73  MLLQIGVEADAGRSNVKVKDEDPNEYNEFPLRAIPKEDLENMRTHLLKFQSKKKINPVTD 132

Query: 215 FTLPYKAKVEREGSDISIISYTRNVQFSLEAAEILSKQ-----YGVSAE----VINLRAI 265
           F LP   ++ R+         TRN+QF L  AEI+ +Q     Y   AE      N   +
Sbjct: 133 FHLP--VRLHRKD--------TRNLQFQLTRAEIVQRQKEISEYKKKAEQERSTPNSGGM 182

Query: 266 RPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIAQIMESEAFDYLDAPIQRVTGAEVP 325
                 ++ NTVK  +   TV+S              + +    + +++ I  VTG+ VP
Sbjct: 183 NKSGTVSLNNTVKDGSQTPTVDS--------------VTKDNTANGVNSSIPTVTGSSVP 228

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,214,274
Number of extensions: 403369
Number of successful extensions: 1085
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1101
Number of HSP's successfully gapped: 12
Length of query: 349
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 246
Effective length of database: 13,030,455
Effective search space: 3205491930
Effective search space used: 3205491930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)