Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F07557g48748025350.0
Sklu_1601.148447516820.0
Kwal_26.714348447515860.0
ACR284C48347715260.0
CAGL0F00825g48347113400.0
YOL049W (GSH2)49147213310.0
Scas_643.22*49548912231e-165
YHR204W (MNL1)79671692.5
KLLA0E22968g11049625.2
KLLA0F25850g13346627.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F07557g
         (480 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F07557g complement(711607..713070) similar to sp|Q08220 Sac...   981   0.0  
Sklu_1601.1 YOL049W, Contig c1601 1154-2608                           652   0.0  
Kwal_26.7143                                                          615   0.0  
ACR284C [1331] [Homologous to ScYOL049W (GSH2) - SH] (871142..87...   592   0.0  
CAGL0F00825g 91832..93283 similar to sp|Q08220 Saccharomyces cer...   520   0.0  
YOL049W (GSH2) [4770] chr15 (238617..240092) Glutathione synthet...   517   0.0  
Scas_643.22*                                                          475   e-165
YHR204W (MNL1) [2489] chr8 (506317..508707) Protein involved in ...    31   2.5  
KLLA0E22968g join(2038281..2038292,2038423..2038743) similar to ...    28   5.2  
KLLA0F25850g 2403616..2404017 some similarities with ca|CA1235|I...    28   7.1  

>KLLA0F07557g complement(711607..713070) similar to sp|Q08220
           Saccharomyces cerevisiae YOL049w GSH2 Glutathione
           synthetase singleton, start by similarity
          Length = 487

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/480 (100%), Positives = 480/480 (100%)

Query: 1   MSSTESYPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLP 60
           MSSTESYPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLP
Sbjct: 1   MSSTESYPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLP 60

Query: 61  NEAFQKAIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIV 120
           NEAFQKAIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIV
Sbjct: 61  NEAFQKAIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIV 120

Query: 121 QDLALGVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVF 180
           QDLALGVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVF
Sbjct: 121 QDLALGVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVF 180

Query: 181 YDQDIPISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSK 240
           YDQDIPISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSK
Sbjct: 181 YDQDIPISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSK 240

Query: 241 YDTKSVRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLT 300
           YDTKSVRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLT
Sbjct: 241 YDTKSVRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLT 300

Query: 301 LEISYAIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVL 360
           LEISYAIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVL
Sbjct: 301 LEISYAIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVL 360

Query: 361 GEIGKKLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTE 420
           GEIGKKLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTE
Sbjct: 361 GEIGKKLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTE 420

Query: 421 ENFVIRGQELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480
           ENFVIRGQELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC
Sbjct: 421 ENFVIRGQELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480

>Sklu_1601.1 YOL049W, Contig c1601 1154-2608
          Length = 484

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 380/475 (80%), Gaps = 3/475 (0%)

Query: 7   YPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLPNEAFQK 66
           YPKFP IS +K++  L  E+  W+L NGLAMYPP+FKPE  T AP TLFPTPLP  +F++
Sbjct: 5   YPKFPNISHEKIKSDLLPELLEWSLANGLAMYPPDFKPEETTTAPTTLFPTPLPKNSFRE 64

Query: 67  AIDVQTIYNALYASISQNKND-WLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIVQDLAL 125
           AI+VQ  YN LYA ISQ+ N+ WL+KETEKLAK DPEFTGRLW L+  A++ GI Q LAL
Sbjct: 65  AIEVQRFYNELYAKISQDGNERWLSKETEKLAKFDPEFTGRLWNLHLEAQKAGISQKLAL 124

Query: 126 GVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVFYDQDI 185
           GVFRSDYLI+S+ NQIKQVEFNTVSVSFGGLSTKVGELH + N+SG YSD+G  FY  +I
Sbjct: 125 GVFRSDYLIDSNANQIKQVEFNTVSVSFGGLSTKVGELHKFFNESGKYSDDGSTFYTDEI 184

Query: 186 PISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSKYDTKS 245
           P+S SAELLA GL  A+ KY     N   +VAFIVQ GERNVFDQ  L  NL   Y  KS
Sbjct: 185 PVSESAELLAKGLWKAVEKYD--TDNNHTVVAFIVQQGERNVFDQRALEYNLFKNYGVKS 242

Query: 246 VRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLTLEISY 305
           VR+TIHEIH+ TR+D  +KRL+  +TG+EI LVYFR+GY+PSDF++EQDWENRL LE SY
Sbjct: 243 VRITIHEIHKKTRIDQNSKRLFLTSTGEEISLVYFRAGYSPSDFITEQDWENRLVLETSY 302

Query: 306 AIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVLGEIGK 365
           AIKAPNLLTQLSGTKKIQQLLTD  +L +F+        LLPTFVKIYPLD + LG+  K
Sbjct: 303 AIKAPNLLTQLSGTKKIQQLLTDESLLSKFVPQRSIRQKLLPTFVKIYPLDDTPLGQEAK 362

Query: 366 KLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTEENFVI 425
           KLA+  PEN+VLKPQREGGGNNIYKEDIP FL+++ E++WSAYILMELI P  T EN +I
Sbjct: 363 KLAMESPENFVLKPQREGGGNNIYKEDIPPFLKTLKEEDWSAYILMELINPIPTSENIII 422

Query: 426 RGQELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480
           RGQ+++N P+LSELGIFG +LFD +N+Y NEYAGWLLRSKFSSSNEGGVAAGFGC
Sbjct: 423 RGQDIYNEPMLSELGIFGYVLFDDSNVYDNEYAGWLLRSKFSSSNEGGVAAGFGC 477

>Kwal_26.7143
          Length = 484

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/475 (62%), Positives = 365/475 (76%), Gaps = 3/475 (0%)

Query: 7   YPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLPNEAFQK 66
           YP FP ++  ++QD L  EI  WALTNGL MYPPNFK   + +AP TLFPTP P + F++
Sbjct: 5   YPAFPKLTESEIQDELLPEISHWALTNGLVMYPPNFKVASSFLAPTTLFPTPFPAKCFEQ 64

Query: 67  AIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIVQDLALG 126
           A+ VQT YN LYA ISQN ++WL K+ + LA  DPEFTG+LW LY++A + GI Q LALG
Sbjct: 65  AVTVQTSYNDLYAKISQNHDNWLTKQVKLLADFDPEFTGKLWKLYEQALKIGISQKLALG 124

Query: 127 VFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYS-DNGEVFYDQDI 185
           VFRSDYL+++++ ++KQVEFNTVSVSFGGLSTKVG+LH++LN SG Y+ D G  FY+QDI
Sbjct: 125 VFRSDYLLDAESLEVKQVEFNTVSVSFGGLSTKVGQLHNFLNDSGKYALDKGSKFYEQDI 184

Query: 186 PISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSKYDTKS 245
           P+S SA LLA  LA A  KY    + K+ IVAFIVQ GERNVFDQ IL  NLL K+  KS
Sbjct: 185 PVSESALLLAKSLAEAATKY--PSEGKQTIVAFIVQQGERNVFDQRILEYNLLDKFGIKS 242

Query: 246 VRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLTLEISY 305
           VR+TIHEIH  T +DPE+KRL +K TG+EI +VYFR+GY+P DF++EQDW NRLTLE S+
Sbjct: 243 VRITIHEIHTKTSVDPESKRLTYKPTGEEISVVYFRAGYSPDDFLNEQDWNNRLTLETSF 302

Query: 306 AIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVLGEIGK 365
           AIKAPNLLTQL+G KKIQQLLT+  +LK+F+ D + +  L+ +FVKI+P+D S  G   K
Sbjct: 303 AIKAPNLLTQLAGAKKIQQLLTEESVLKQFIDDEDVIRKLMASFVKIHPMDDSEAGARAK 362

Query: 366 KLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTEENFVI 425
           K+A   PE +VLKPQREGGGNNIYK DIP FL+++ E +WS YILMELI P  T +N V+
Sbjct: 363 KMAFETPERFVLKPQREGGGNNIYKADIPSFLKTIPEQDWSGYILMELIKPNPTTDNIVV 422

Query: 426 RGQELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480
           R       PILSELGIFG +LFD + +Y NEYAGWLLRSK SSS+EGGVAAGFGC
Sbjct: 423 RADRFSQEPILSELGIFGYVLFDDSQVYLNEYAGWLLRSKSSSSDEGGVAAGFGC 477

>ACR284C [1331] [Homologous to ScYOL049W (GSH2) - SH]
           (871142..872593) [1452 bp, 483 aa]
          Length = 483

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/477 (60%), Positives = 356/477 (74%), Gaps = 2/477 (0%)

Query: 4   TESYPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLPNEA 63
           T + P  P  S ++++  L  E+ +W+L NG  +YPP F    A    +TLFPTPLP +A
Sbjct: 2   TNTIPTLPEWSAEEVEQRLLPELLQWSLANGGTIYPPGFNINQAEALTMTLFPTPLPRKA 61

Query: 64  FQKAIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIVQDL 123
            +KA+ VQT YN LYA I+Q+KN WL++ TE+LA  D  FTGRLW LY  A+  GI Q +
Sbjct: 62  LEKAVRVQTTYNELYARIAQDKNGWLSEVTEQLANFDANFTGRLWKLYLEAQAIGISQKI 121

Query: 124 ALGVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVFYDQ 183
            LGVFRSDYL+++D+  +KQVEFNTVSVSF GLSTKVG +H++LN+SG YS NG  FY+ 
Sbjct: 122 GLGVFRSDYLLDADSGDLKQVEFNTVSVSFAGLSTKVGAVHNFLNESGKYSRNGGRFYES 181

Query: 184 DIPISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSKYDT 243
           ++PIS SA LL   LA+A +KY     ++  IVAFIVQ GERNV DQ IL  NL  +   
Sbjct: 182 EVPISESAFLLPRALASAADKYNSLTGSRDTIVAFIVQRGERNVVDQRILEYNLFERQGV 241

Query: 244 KSVRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLTLEI 303
           KSVRL +HE+HE TRLDP TKRLY  +TGQEI +VYFR+ Y+P DF SEQDW+NRL+LE+
Sbjct: 242 KSVRLMLHEVHERTRLDPITKRLYLTSTGQEIAVVYFRTCYSPQDFASEQDWKNRLSLEL 301

Query: 304 SYAIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVLGEI 363
           SYAIKAPNLLTQLSGTKK+QQLL++  +L +FL      D +  TFV +YPLD S LG+ 
Sbjct: 302 SYAIKAPNLLTQLSGTKKVQQLLSEEAVLAKFLPADRRSD-IGATFVNLYPLDDSPLGKE 360

Query: 364 GKKLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTEENF 423
           GK+LAL  PE YVLKPQREGGGNNIYKEDIP FL ++ E+EW+ Y+LMELI PK   EN 
Sbjct: 361 GKRLALEMPERYVLKPQREGGGNNIYKEDIPAFLGTIPEEEWNGYVLMELINPK-LNENV 419

Query: 424 VIRGQELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480
           ++RGQELF  P++SELGI+GTILF    IYSN+YAGWLLRSK  SSNEGGVAAGFGC
Sbjct: 420 LVRGQELFQEPLISELGIYGTILFSDEEIYSNDYAGWLLRSKLPSSNEGGVAAGFGC 476

>CAGL0F00825g 91832..93283 similar to sp|Q08220 Saccharomyces
           cerevisiae YOL049w GSH2 Glutathione synthetase,
           hypothetical start
          Length = 483

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/471 (54%), Positives = 334/471 (70%), Gaps = 5/471 (1%)

Query: 12  AISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLPNEAFQKAIDVQ 71
           A++ ++L+  +  E ++WAL+NGL MYPP+F+   A +AP TL+PTP+  + F++AI+VQ
Sbjct: 9   ALTNEELEKQILPETYQWALSNGLLMYPPDFQLTQAQIAPFTLYPTPIARKNFEEAIEVQ 68

Query: 72  TIYNALYASISQNKND-WLAKETEKLAKSDPEFTGRLWTLYKRAKEYGIVQDLALGVFRS 130
             +N LYA IS+++ + WL++ETEKLA SD  FTG+LW LYK  +  GI Q L LG+FRS
Sbjct: 69  QSFNELYAEISRDQGEHWLSQETEKLAHSDEGFTGKLWDLYKSVRNEGIAQKLRLGIFRS 128

Query: 131 DYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVFYDQDIPISPS 190
           DYLI+ + +QIKQVEFNTVSVSF G ST+VGE+H YLN SG Y  +   + D+DIP+  S
Sbjct: 129 DYLIDKNIDQIKQVEFNTVSVSFVGFSTRVGEVHKYLNDSGAYGKSS--YADKDIPVPTS 186

Query: 191 AELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSILALNLLSKYDTKSVRLTI 250
            + +    A A  KY   +  K+ I+  +VQ GERNVFDQ I+  +L   Y  + +R+T 
Sbjct: 187 VQEMTKSFADAFQKYDALNDEKK-IILMVVQRGERNVFDQRIIEYSLQKDYGIRVIRMTF 245

Query: 251 HEI-HEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLTLEISYAIKA 309
            +I    T  + +  RL+ K TG EI +VY+R+GY  +D+ +EQDWE R  LE SYAIKA
Sbjct: 246 DDIISRLTSDNADKNRLFFKETGDEIAIVYYRTGYTTTDYQNEQDWEARKFLEKSYAIKA 305

Query: 310 PNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVLGEIGKKLAL 369
           P+LLTQLSG KKIQQLLTD  IL +F+    S   L  TFVKIYPLD S LG IGKKLA 
Sbjct: 306 PDLLTQLSGAKKIQQLLTDDNILSQFVKSENSRRALQKTFVKIYPLDDSELGNIGKKLAF 365

Query: 370 TEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTEENFVIRGQE 429
            EP  +VLKPQREGGGNN+YKEDIP FL ++ E +W AYILME+I P   E N +IRG E
Sbjct: 366 DEPHRFVLKPQREGGGNNVYKEDIPSFLSTIGESKWDAYILMEIIDPLPYENNVIIRGNE 425

Query: 430 LFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480
           +F   I+SELGI+G+ILFD   I+ N  +GWLLRSKF++SNEGGVAAGFGC
Sbjct: 426 IFKESIISELGIYGSILFDDEKIHFNRNSGWLLRSKFTTSNEGGVAAGFGC 476

>YOL049W (GSH2) [4770] chr15 (238617..240092) Glutathione
           synthetase, carries out synthesis of glutathione from
           gamma-glutamylcysteine and glycine [1476 bp, 491 aa]
          Length = 491

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/472 (54%), Positives = 343/472 (72%), Gaps = 14/472 (2%)

Query: 22  LQSEIFRWALTNGLAMYPPNFK--PELATVAPITLFPTPLPNEAFQKAIDVQTIYNALYA 79
           L  E+ +WA+TNGL+MYPP F+  P  A+V+P+T++PTP+P + F +A+ +Q ++N LYA
Sbjct: 14  LIQEVNQWAITNGLSMYPPKFEENPSNASVSPVTIYPTPIPRKCFDEAVQIQPVFNELYA 73

Query: 80  SISQNK---NDWLAKETEKLAKSDPEFTGRLWTLYK---RAKEYGIVQDLALGVFRSDYL 133
            I+Q+    + +L K TE LA SD EFTG+LW+LY    ++ +Y   Q+  LG+FRSDYL
Sbjct: 74  RITQDMAQPDSYLHKTTEALALSDSEFTGKLWSLYLATLKSAQYK-KQNFRLGIFRSDYL 132

Query: 134 INSDNN--QIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSDNGEVFYDQDIPISPSA 191
           I+      QIKQVEFNTVSVSF GLS KV  LH YLN++  Y   G ++ DQ++ IS S 
Sbjct: 133 IDKKKGTEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYNDQNMVISDSG 192

Query: 192 ELLATGLATAINKYQPADKNKR---PIVAFIVQNGERNVFDQSILALNLLSKYDTKSVRL 248
            LL+  LA A+  Y+    +     PIVAFIVQ  ERNVFDQ +L LNLL K+ TKSVRL
Sbjct: 193 YLLSKALAKAVESYKSQQSSSTTSDPIVAFIVQRNERNVFDQKVLELNLLEKFGTKSVRL 252

Query: 249 TIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQDWENRLTLEISYAIK 308
           T  ++++   +D +T +L+ + T QEI +VY+R+GY  +D+ SE+DWE RL LE S+AIK
Sbjct: 253 TFDDVNDKLFIDDKTGKLFIRDTEQEIAVVYYRTGYTTTDYTSEKDWEARLFLEKSFAIK 312

Query: 309 APNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIYPLDSSVLGEIGKKLA 368
           AP+LLTQLSG+KKIQQLLTD  +L +++SD E    LL TFVKIYPLD + LG  GK+LA
Sbjct: 313 APDLLTQLSGSKKIQQLLTDEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLA 372

Query: 369 LTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMELITPKSTEENFVIRGQ 428
           L+EP  YVLKPQREGGGNN+YKE+IP FL+ ++E  W AYILMELI P+  E N ++R  
Sbjct: 373 LSEPSKYVLKPQREGGGNNVYKENIPNFLKGIEERHWDAYILMELIEPELNENNIILRDN 432

Query: 429 ELFNVPILSELGIFGTILFDHNNIYSNEYAGWLLRSKFSSSNEGGVAAGFGC 480
           + +N PI+SELGI+G +LF+   + SNE++G LLRSKF++SNEGGVAAGFGC
Sbjct: 433 KSYNEPIISELGIYGCVLFNDEQVLSNEFSGSLLRSKFNTSNEGGVAAGFGC 484

>Scas_643.22*
          Length = 495

 Score =  475 bits (1223), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 244/489 (49%), Positives = 323/489 (66%), Gaps = 14/489 (2%)

Query: 4   TESYPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKPELATVAPITLFPTPLPNEA 63
           T   P  P +S + L+  L  E+++WAL++GL +Y P        +  +T +PTP+P   
Sbjct: 2   TSKKPALPQLSKESLEKHLLPELYQWALSHGLLVYKPETPQTQTAMVALTTYPTPVPRAC 61

Query: 64  FQKAIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPEFTGRLWTLYKRAKEYG----- 118
           F+ A +VQ  +N LYA IS +  DWL KET+ L+ SD +FTG+L+ +  +  E+      
Sbjct: 62  FESAQEVQVPFNELYARISSS--DWLYKETKLLSASDEDFTGKLFAIQLKLDEFATTVSK 119

Query: 119 -IVQDLALGVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKVGELHDYLNKSGNYSD-- 175
            ++Q L LG+FRSDY+++ ++N IKQVEFNTVSVSF G S KV  LH  L+  G Y +  
Sbjct: 120 DVIQPLRLGIFRSDYIVDKNSNSIKQVEFNTVSVSFSGFSGKVAALHQTLDSKGLYQEES 179

Query: 176 NGEVFY--DQDIPISPSAELLATGLATAINKYQPADKNKRPIVAFIVQNGERNVFDQSIL 233
           N   F+  + +IP+S  +   A  +  A++KY   +     +VAFIVQ GERNVFDQ  +
Sbjct: 180 NRTPFFQPNYEIPVSFPSAGFAKAMEVALSKYDTPNDRANLVVAFIVQRGERNVFDQKCI 239

Query: 234 ALNLLSKYDTKSVRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFRSGYAPSDFVSEQ 293
              L   +  K+VRL   ++    +LD  + RLY K TGQE+GLVY+R+GY  SD+  E+
Sbjct: 240 ENELWENHGIKTVRLNFDDVLTELKLDANSNRLYMKHTGQEVGLVYYRTGYTTSDYEIEK 299

Query: 294 DWENRLTLEISYAIKAPNLLTQLSGTKKIQQLLTDPKILKEFLSDTESLDHLLPTFVKIY 353
           DW+ R  LE SYAIKAP+L+TQLSG KK+QQLLTD  IL +F+ D    D L  TFVKI+
Sbjct: 300 DWDARFFLEKSYAIKAPDLMTQLSGAKKVQQLLTDDTILTKFVKDEHVKDQLKETFVKIF 359

Query: 354 PLDSSVLGEIGKKLALTEPENYVLKPQREGGGNNIYKEDIPGFLESVDEDEWSAYILMEL 413
           PLD + LGE GK+LA+  P NYVLKPQREGGGNNIYKEDIPGFL  +D+D+W+ YILMEL
Sbjct: 360 PLDDTPLGEEGKRLAMESPHNYVLKPQREGGGNNIYKEDIPGFLRGLDKDQWNGYILMEL 419

Query: 414 ITPKSTEENFVIRGQELFNVPILSELGIFGTILFDHN-NIYSNEYAGW-LLRSKFSSSNE 471
           I   +TE N +  G   F VPILSELG++GT+LFDH+ NI  NE  G  ++RSKF   NE
Sbjct: 420 IDSDATEGNIICNGDSTFAVPILSELGVYGTVLFDHDSNILYNESPGLGIVRSKFGDHNE 479

Query: 472 GGVAAGFGC 480
           GGVAAGFGC
Sbjct: 480 GGVAAGFGC 488

>YHR204W (MNL1) [2489] chr8 (506317..508707) Protein involved in
           endoplasmic reticulum-associated degradation of
           glycoproteins, has similarity to alpha-mannosidase and
           other glycosyl hydrolases [2391 bp, 796 aa]
          Length = 796

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 10/71 (14%)

Query: 29  WALTNGLAMYPPNFKPE-LATVAPIT--------LFPTPLPNEAFQKAIDVQTIYNALYA 79
           W+L  GL + P +F PE L    P+T        LF   L         ++  ++N  Y 
Sbjct: 247 WSLRTGLDLLPMSFHPEKLTPYTPMTGIGASIDSLFEYALKGAILFDDSELMEVWNVAYE 306

Query: 80  SISQN-KNDWL 89
           ++  N KNDW 
Sbjct: 307 ALKTNCKNDWF 317

>KLLA0E22968g join(2038281..2038292,2038423..2038743) similar to
           sp|P53905 Saccharomyces cerevisiae YNL147w LSM7 Sm-like
           (Lsm) protein singleton, start by similarity
          Length = 110

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 233 LALNLLSKYDTKSVRLTIHEIHEATRLDPETKRLYHKTTGQEIGLVYFR 281
           L   +L  YD + + L + E  E  R DPE + + HK   ++IGLV  R
Sbjct: 46  LVTGILKGYD-ELMNLVLDETVEYAR-DPEDETIIHKDQAKKIGLVVIR 92

>KLLA0F25850g 2403616..2404017 some similarities with
           ca|CA1235|IPF20079 Candida albicans unknown function,
           hypothetical start
          Length = 133

 Score = 28.5 bits (62), Expect = 7.1,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 366 KLALTEPEN------YVLKPQREGG-GNNIYKEDIPGFLESVDEDE 404
           ++AL  PE       Y+L+  R G   N + ++DI G LESV  DE
Sbjct: 54  RVALVRPERVKAVEAYLLQMVRSGAIRNKLTEQDIVGILESVGRDE 99

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,872,880
Number of extensions: 780970
Number of successful extensions: 1796
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1776
Number of HSP's successfully gapped: 19
Length of query: 480
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 375
Effective length of database: 12,961,219
Effective search space: 4860457125
Effective search space used: 4860457125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)