Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F07447g97596047890.0
Kwal_55.2157598996223370.0
YDR270W (CCC2)100496721670.0
Scas_615.994292221360.0
CAGL0M08602g101298320360.0
ACR086C81078815190.0
KLLA0D04092g11529697333e-81
AGL041C12339497193e-79
YBR295W (PCA1)12165536893e-75
YGL008C (PMA1)9185393217e-30
AGL085C9095403046e-28
YPL036W (PMA2)9475393046e-28
KLLA0A09031g8995392965e-27
Scas_688.19135392922e-26
Kwal_47.175228995372861e-25
CAGL0I04312g9515952851e-25
Scas_710.419045432823e-25
CAGL0A00495g9025732573e-22
KLLA0A03157g9385932573e-22
CAGL0J01870g9466582261e-18
YGL167C (PMR1)9501712153e-17
Kwal_14.14989391722002e-15
AEL301W9571481956e-15
Scas_707.48*7412041947e-15
Kwal_23.316011003001511e-09
CAGL0A00517g11221441511e-09
Kwal_47.1754712401781492e-09
CAGL0K12034g10872881483e-09
YGL006W (PMC1)11731501464e-09
KLLA0A08910g12802071447e-09
Scas_297.1800941322e-07
AFL011W12421781322e-07
YDR038C (ENA5)10912841295e-07
YDR040C (ENA1)10912841285e-07
YDR039C (ENA2)10912841286e-07
KLLA0F20658g10821821223e-06
AGL097C10962611206e-06
KLLA0E14630g10821831152e-05
Scas_569.0d468831052e-04
AFR567W1449501054e-04
CAGL0M11308g14523011036e-04
KLLA0C08393g11482111010.001
YOR291W1472501000.001
YIL048W (NEO1)115190960.004
Kwal_26.9207146978950.005
Scas_665.30143951950.005
Scas_704.38116190940.006
KLLA0B08217g143950940.007
KLLA0E22352g120652930.008
CAGL0L01419g121476920.010
Sklu_2193.1114390910.013
Kwal_23.5789113390900.017
Scas_583.14*87573900.019
AFR354C121076890.026
ADL079C1166117860.053
CAGL0G06270g1328271850.072
YEL031W (SPF1)121552840.086
Scas_89.127142800.15
CAGL0L00715g114491820.17
Kwal_26.70701315113790.40
Scas_669.3163847780.51
CAGL0H04477g1626115770.58
Kwal_23.35561597126770.61
AFL191W157550770.68
KLLA0E01650g155050760.73
KLLA0A04015g1343117760.76
YAL026C (DRS2)135565760.78
YMR162C (DNF3)165668731.6
Kwal_56.23530128766731.8
ADR350W1311109732.1
YER166W (DNF1)1571166722.3
Sklu_2345.121769692.9
Scas_576.81591151712.9
CAGL0L11814g1576231713.3
KLLA0A08580g54059678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F07447g
         (960 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...  1849   0.0  
Kwal_55.21575                                                         904   0.0  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...   839   0.0  
Scas_615.9                                                            827   0.0  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...   788   0.0  
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...   589   0.0  
KLLA0D04092g complement(344666..348124) some similarities with s...   286   3e-81
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...   281   3e-79
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...   270   3e-75
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   128   7e-30
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   121   6e-28
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   121   6e-28
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   118   5e-27
Scas_688.1                                                            117   2e-26
Kwal_47.17522                                                         114   1e-25
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   114   1e-25
Scas_710.41                                                           113   3e-25
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   103   3e-22
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   103   3e-22
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    92   1e-18
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    87   3e-17
Kwal_14.1498                                                           82   2e-15
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    80   6e-15
Scas_707.48*                                                           79   7e-15
Kwal_23.3160                                                           63   1e-09
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    63   1e-09
Kwal_47.17547                                                          62   2e-09
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    62   3e-09
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    61   4e-09
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    60   7e-09
Scas_297.1                                                             55   2e-07
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    55   2e-07
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    54   5e-07
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    54   5e-07
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    54   6e-07
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    52   3e-06
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    51   6e-06
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    49   2e-05
Scas_569.0d                                                            45   2e-04
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    45   4e-04
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    44   6e-04
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    44   0.001
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    43   0.001
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    42   0.004
Kwal_26.9207                                                           41   0.005
Scas_665.30                                                            41   0.005
Scas_704.38                                                            41   0.006
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    41   0.007
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    40   0.008
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    40   0.010
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          40   0.013
Kwal_23.5789                                                           39   0.017
Scas_583.14*                                                           39   0.019
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    39   0.026
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    38   0.053
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    37   0.072
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    37   0.086
Scas_89.1                                                              35   0.15 
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    36   0.17 
Kwal_26.7070                                                           35   0.40 
Scas_669.3                                                             35   0.51 
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    34   0.58 
Kwal_23.3556                                                           34   0.61 
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    34   0.68 
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    34   0.73 
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    34   0.76 
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    34   0.78 
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    33   1.6  
Kwal_56.23530                                                          33   1.8  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    33   2.1  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    32   2.3  
Sklu_2345.1 YCR020C, Contig c2345 1258-1911                            31   2.9  
Scas_576.8                                                             32   2.9  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    32   3.3  
KLLA0A08580g 754857..756479 similar to sp|P25578 Saccharomyces c...    30   8.0  

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 1849 bits (4789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 912/960 (95%), Positives = 912/960 (95%)

Query: 1   MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILE 60
           MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILE
Sbjct: 1   MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILE 60

Query: 61  TIDECGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDV 120
           TIDECGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDV
Sbjct: 61  TIDECGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDV 120

Query: 121 SLVTEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLKIFGMLSES 180
           SLVTEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLKIFGMLSES
Sbjct: 121 SLVTEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLKIFGMLSES 180

Query: 181 DRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDN 240
           DRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDN
Sbjct: 181 DRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDN 240

Query: 241 STQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFY 300
           STQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFY
Sbjct: 241 STQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFY 300

Query: 301 RDXXXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXXXXXXXXXXXH 360
           RD               SYFYKAAWISLKHGSGTMDTLIGLSTVCA             H
Sbjct: 301 RDIIGIIITTYVQIYVGSYFYKAAWISLKHGSGTMDTLIGLSTVCAYIFSCYSIISSIYH 360

Query: 361 KSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTRE 420
           KSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTRE
Sbjct: 361 KSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTRE 420

Query: 421 ISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNG 480
           ISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNG
Sbjct: 421 ISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNG 480

Query: 481 PGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITW 540
           PGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITW
Sbjct: 481 PGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITW 540

Query: 541 MLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGV 600
           MLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGV
Sbjct: 541 MLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGV 600

Query: 601 LIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMISLCESIGEHP 660
           LIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMISLCESIGEHP
Sbjct: 601 LIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMISLCESIGEHP 660

Query: 661 VAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE 720
           VAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE
Sbjct: 661 VAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE 720

Query: 721 SLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780
           SLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSA
Sbjct: 721 SLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780

Query: 781 LKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
           LKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI
Sbjct: 781 LKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840

Query: 841 SSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIA 900
           SSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIA
Sbjct: 841 SSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIA 900

Query: 901 MGLLAPWGITLHPXXXXXXXXXXXXXXXXXXXXLKRWTPPSLNIKSMEASGGLSWLRFGR 960
           MGLLAPWGITLHP                    LKRWTPPSLNIKSMEASGGLSWLRFGR
Sbjct: 901 MGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLKRWTPPSLNIKSMEASGGLSWLRFGR 960

>Kwal_55.21575
          Length = 989

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/962 (48%), Positives = 649/962 (67%), Gaps = 23/962 (2%)

Query: 6   ALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDEC 65
           A++ V+GMTCGACV T+++Q+  + GV E  VSL+T EC V F+K  T    +   I +C
Sbjct: 7   AVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDC 66

Query: 66  GFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTE 125
           GF  +++  + ++      ++ + +L V  MTCGACV T+T  +    GVLE  VSL TE
Sbjct: 67  GFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATE 126

Query: 126 ECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSS--SVPSNEKRLCLKIFGMLSESDRA 183
           EC+V+FDP   + AE+   IDD GF+A++I++++   +  S  ++  LK+ GM   +  +
Sbjct: 127 ECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRGSTVRKATLKVLGMTCGACVS 186

Query: 184 DIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDNSTQ 243
            +ES +S+  GV+SI  SL +EEA + ++   IG R I   IE++GF++   N+ ++  Q
Sbjct: 187 TVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNSFNSVAQ 246

Query: 244 LSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFYRDX 303
           ++LL+K +EI FWK+ C++     +L++ LY   P+  PA    F + QT I GLFYRD 
Sbjct: 247 VNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPARNLFF-YKQTGIPGLFYRDI 305

Query: 304 XXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXXXXXXXXXXXHKST 363
                          +FY A W S++HGSG+MDT++ LST+C+              KS 
Sbjct: 306 IGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNVAKKSE 365

Query: 364 KMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISV 423
           +MP VIFD +VML+ FIS+GKLLENKAKS+T+ ++SKL+SL PS+C+I+  +G  REI V
Sbjct: 366 RMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTII-ENGKAREIPV 424

Query: 424 ELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNGPGH 483
           E LQ  D VE+ PG KIP DGV+I  E+EVDESLITGES++V +  G  VI GS+NGP  
Sbjct: 425 EFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSINGPNR 484

Query: 484 FYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLV 543
           F   A  VG+DTKLA II TMK+AQLSKAPIQ YAD +A  FVP V+ L+ ITF+TW ++
Sbjct: 485 FLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTIL 544

Query: 544 SYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIK 603
           S  +  PP IF+S NGKFF+C++M+ISVI+VACPCALGLAAPTAIMVGTG+GA HGVLIK
Sbjct: 545 SRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIK 604

Query: 604 GGDVLEKCSALQTFLFDKTGTLTTGRMSVENFI--NYNSDVSDLHWKMISLCESIGEHPV 661
           GGD+LEKCS+L+TFLFDKTGTLTTG M+VE F+      +++      I+  E++ EHPV
Sbjct: 605 GGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPV 664

Query: 662 AKAIVNYADSHV---NKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFP 718
            KAIV + DS +   +++++    ++  + ++G G+ C+   +   K + + IGN+ +  
Sbjct: 665 GKAIVEFTDSLIEDCDRTAV----VTKSKTILGGGLICDC--ELDGKAYHVVIGNRNVMQ 718

Query: 719 DESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQ 778
           D SLS  ASSTL  +YV I+G LVG+FEISD +K+DA  VV+YL   G + CMVTGD H+
Sbjct: 719 DMSLSADASSTL--AYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHK 776

Query: 779 SALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGI 838
           SA+KVA +LGI AN+V+SE+TP  K  +V  LQ+ G + VAF+GDGINDSPALV +DLG+
Sbjct: 777 SAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGV 836

Query: 839 SISSGTDIAIEAADIVILD-SDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMI 897
           SIS+GTDIA+EAAD++IL+ S+N + SL+ L+YALDIA+KTF RVK+NFFWA+CYN FM+
Sbjct: 837 SISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFML 896

Query: 898 PIAMGLLAPWGITLHPXXXXXXXXXXXXXXXXXXXXLKRWTPPSLNI--KSMEASGGLSW 955
           PIAMG+L PW IT+ P                    L  W PP L++  KS + S   +W
Sbjct: 897 PIAMGVLVPWEITMDPIVAVACMAASSVSVVGNSLLLNLWKPPKLDVSPKSQKPS---AW 953

Query: 956 LR 957
            R
Sbjct: 954 SR 955

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%)

Query: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64
           +A + V GMTCGACV TV++ +    GV   +VSL TEE  + ++        I   I++
Sbjct: 171 KATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIED 230

Query: 65  CGFDGSLIS 73
            GF+ + ++
Sbjct: 231 LGFESAPVN 239

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/967 (48%), Positives = 636/967 (65%), Gaps = 40/967 (4%)

Query: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64
           + +++V GMTC AC  T+ TQ+  + GVT+C++SL+T EC V +D    T   I E I++
Sbjct: 3   EVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDN-EVTADSIKEIIED 61

Query: 65  CGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVT 124
           CGFD  ++     D ++T      G+L V GMTCG+CV TVT QV  + GV    VSLVT
Sbjct: 62  CGFDCEILR----DSEITAISTKEGLLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVT 117

Query: 125 EECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLKIFGMLSESDRAD 184
           EEC V ++P  T++    E I+DCGFD+ +I + + +    EK + LK+     E +   
Sbjct: 118 EECHVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAF-EDESPL 176

Query: 185 IESKVSEL------KGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTL 238
           I S VSE        GV SI+ S      T+ +  NE+G RD++  +E  G++  + + L
Sbjct: 177 ILSSVSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNL 236

Query: 239 DNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTH--FPFVQTPII 296
           DN+TQL LLSK  EI+FWKKN I+  + +I+ M LYM VPM++P ++    FP+ +T  +
Sbjct: 237 DNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSFV 296

Query: 297 -GLFYRDXXXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXXXXXXX 355
            GLFYRD                YFYKAAW SLKHGSGTMDTL+ +ST CA         
Sbjct: 297 RGLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLV 356

Query: 356 XXXXHKST--KMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIV- 412
               H S+  K+P+++FDT++M++++IS+GK LE  AKS+TSTA+SKLI LTPS CSI+ 
Sbjct: 357 HNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIIS 416

Query: 413 -LPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGS 471
            +    T+EI +ELLQ NDIVE+ PGMKIPADG++ R E+E+DESL+TGES+LV K  G 
Sbjct: 417 DVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGF 476

Query: 472 QVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVIS 531
            VI GSVNGPGHFYFR   VGE+TKLANII  MK+AQLSKAPIQ YAD +A IFVP ++ 
Sbjct: 477 PVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILI 536

Query: 532 LSAITFITWMLVSYTMKTPPLIF--NSENGKFFMCMQMSISVIIVACPCALGLAAPTAIM 589
           L+ +TF  W  +      PP+ F  N++   FF+C+Q + SV+IVACPCALGLA PTAIM
Sbjct: 537 LAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIM 596

Query: 590 VGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKM 649
           VGTGVGA +GVLIKGG+VLEK +++ TF+FDKTGTLTTG M V+ F+  ++ V ++    
Sbjct: 597 VGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDEDE 656

Query: 650 ISLC----ESIGEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGI--SCNITDKNT 703
           +  C    ESI +HPV+KAI+ Y D  +N +   +  +   E ++GKGI   C + + NT
Sbjct: 657 VLACIKATESISDHPVSKAIIRYCDG-LNCNKALNAVVLESEYVLGKGIVSKCQV-NGNT 714

Query: 704 SKIHTITIGNKKLFPDESL--SDIASSTL----TESYVSIDGSLVGKFEISDRVKEDAHF 757
              + I IGN+ L  +++L  S   +S +    T SYVS++G + G FEI+D VK D++ 
Sbjct: 715 ---YDICIGNEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYA 771

Query: 758 VVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNN-GTE 816
            V+YLQ  G +  M+TGD + +A +VA+++GIS  +V+S+V+P  K D+V ++Q+  G  
Sbjct: 772 TVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNN 831

Query: 817 RVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKN-NSLKGLVYALDIA 875
           +VA VGDGIND+PAL  +DLGI+IS+GT+IAIEAADIVIL  ++ N NSL+GL  A+DI+
Sbjct: 832 KVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDIS 891

Query: 876 RKTFYRVKLNFFWAVCYNTFMIPIAMGLLAPWGITLHPXXXXXXXXXXXXXXXXXXXXLK 935
            KTF R+KLN FWA+CYN FMIPIAMG+L PWGITL P                    LK
Sbjct: 892 LKTFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFSSVSVVLSSLMLK 951

Query: 936 RWTPPSL 942
           +WTPP +
Sbjct: 952 KWTPPDI 958

>Scas_615.9
          Length = 942

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/922 (49%), Positives = 599/922 (64%), Gaps = 55/922 (5%)

Query: 83  TTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTEECKVKFDPHFTSMAEIA 142
           +T    G L V GMTC AC   +  QV KL GV   +VSLVT EC V+F     S+  I 
Sbjct: 7   STTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIR 66

Query: 143 ECIDDCGFDAKVISENSSSVPSNE--KRLCLKIF--------GMLSES-DRADIE--SKV 189
           E ++DCGFDA+V++         +  + +  K+         G  +ES D   +E   KV
Sbjct: 67  ETVEDCGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKV 126

Query: 190 SELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNT----LDNSTQLS 245
            +  G++S++ +L+     + +D N+IG RD+I     +G+   + ++    + ++TQL+
Sbjct: 127 GKQDGILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLA 186

Query: 246 LLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVL--THFPFVQTPII-GLFYRD 302
           LLSK  EIQFWK  C++  + +I+ M LYM +PM+FP ++   HFPF +T  + GLFYRD
Sbjct: 187 LLSKWDEIQFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRD 246

Query: 303 XXXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAX-----XXXXXXXXXX 357
                           YFYKAAW S+KHGSGTMDTLI LST CA                
Sbjct: 247 IIGWAIATYSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSR 306

Query: 358 XXHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPD-- 415
              +S  +P V+FDT+VML+ FIS GKLLENKAK++TS+++SKLI LTPS C I+L D  
Sbjct: 307 GNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKC-IILQDKN 365

Query: 416 ---GSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQ 472
               S  EI   LLQ NDI+E+ PGMKIPADG++I+ E+E+DESL+TGES+LV K  GSQ
Sbjct: 366 NIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQ 425

Query: 473 VIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISL 532
           VI GS+NGPGHFYF+AI +G+DTKLA II TMK AQL+KAPIQ  AD +A IFVP ++ L
Sbjct: 426 VIAGSLNGPGHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCL 485

Query: 533 SAITFITWMLVSYTMKTPPLIF-NSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVG 591
           S ITFITW+ +S  +  PP+IF N+ NGKF+   Q++ISVI+VACPCALGLA PTAIMVG
Sbjct: 486 SIITFITWITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVG 545

Query: 592 TGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLH-WKMI 650
           TG+GA HGVLIKGGD+LE+ + +   +FDKTGT+TTG+M+V+ FI Y++D  DL     I
Sbjct: 546 TGIGAQHGVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYSND--DLPVLPCI 603

Query: 651 SLCESIGEHPVAKAIVNYADSHVNKSSIFDLD----LSNEEVLIGKGISCNITDKNTSKI 706
              +SI EHPVAKAIVNY        S  D D    ++  E++IGKG+ C    +   + 
Sbjct: 604 MAAQSISEHPVAKAIVNYC-----GESSQDCDAGVIVTKSEIIIGKGVRCEC--EYQGRN 656

Query: 707 HTITIGNKKLFPD---ESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQ 763
           +T+T+G+K L  D   +S SD  S   T+SYVSI+ +LVGKFEI D VKED   +++YLQ
Sbjct: 657 YTVTVGHKALMTDSMFDSNSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQ 716

Query: 764 NLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823
            L     MVTGD+H +A+KVAQQ+GI+AN+V+S VTP  K +IV  LQ +    VAFVGD
Sbjct: 717 GLHYDIYMVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGD 776

Query: 824 GINDSPALVEADLGISISSGTDIAIEAADIVILDSD-NKNNSLKGLVYALDIARKTFYRV 882
           GINDSP LV +D+G+++S+GTDIA+EAADIV+L +D ++  SLKGL+YALDI+  TF RV
Sbjct: 777 GINDSPVLVTSDIGVALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRV 836

Query: 883 KLNFFWAVCYNTFMIPIAMGLLAPWGITLHPXXXXXXXXXXXXXXXXXXXXLKRWTPPSL 942
           K N FWA+ YN FMIPIAMG+L PWGIT+HP                    LK W PP +
Sbjct: 837 KWNLFWALGYNIFMIPIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVI 896

Query: 943 NIKSMEASG-----GLSWLRFG 959
             +   +S      G SW+R G
Sbjct: 897 GDEHPLSSDYYHHKGTSWIRSG 918

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 86/170 (50%), Gaps = 10/170 (5%)

Query: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64
           +  ++VQGMTC AC   +  QVG +DGV   EVSL+T ECHV F   + +   I ET+++
Sbjct: 12  KGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVED 71

Query: 65  CGFDGSLISEEPL---DYDVTTTEQI----SGILLVSGMTC--GACVKTV-TGQVLKLSG 114
           CGFD  +++  P+   D D+  T       S   + SG +   G  V    T +V K  G
Sbjct: 72  CGFDAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQDG 131

Query: 115 VLECDVSLVTEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPS 164
           +L  + +L      + +D +   + ++    +  G+DA V S N  SV S
Sbjct: 132 ILSLEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSS 181

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/983 (45%), Positives = 615/983 (62%), Gaps = 40/983 (4%)

Query: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64
           + ++ V+GMTC +CV  V  QV  ++GV+ C+VSL+T EC V+  +    T  I+E +++
Sbjct: 3   EVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVV-SEDSVATDGIIEAVED 61

Query: 65  CGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVT 124
           CGFD  LI E+ +           G + + GMTC +CV TVT Q+  + GV + DVSL+T
Sbjct: 62  CGFDCELIREKSM-----APALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMT 116

Query: 125 EECKVKFDPHFTSMAEIAECIDDCGFDAKVIS-ENSSSVPSNEKRLCLKIFGMLSESDRA 183
           EEC V FDP   ++ +I E IDDCGFD  V S E      S  K + L++ G  S+ D  
Sbjct: 117 EECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVDLRLLGFNSKDDN- 175

Query: 184 DIESKVSELKGVIS-----IDTSLQSEEA--TVIHDANEIGNRDIIDCIEEMGFQTFISN 236
           +++    +L+G        +D +L +E+   +V  D   IG R IID +E +G    +  
Sbjct: 176 ELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGINAVVDV 235

Query: 237 TLDNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTH--FPFVQTP 294
           + D  TQL+LL+K  EI++WK  C++  I + + M LYM +P LFP+++    FP+    
Sbjct: 236 SFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFPYSSVG 295

Query: 295 II-GLFYRDXXXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXXXXX 353
            + GL+YRD               + FYK+AW SLKH +GTMDTL+  ST CA       
Sbjct: 296 AVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYLFSLYS 355

Query: 354 XXXXXXH--KSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSI 411
                     S K+PKVIFDT+VM++ +IS+GK LENKAKS+TSTA+SKLISLTPSSC I
Sbjct: 356 MTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCII 415

Query: 412 VLPDGS--TREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIV 469
           V  D    T+EI +ELL+  DI  V PG KIP+DG+V +  +EVDESL+TGE+ LV K +
Sbjct: 416 VDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNLVVKEI 475

Query: 470 GSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFV 529
           GS V GG++NG G  YF    VG+DTKLANII  MK AQL KA IQ+Y D +A IFVP V
Sbjct: 476 GSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTV 535

Query: 530 ISLSAITFITWMLVSYTMK--TPPLIF-NSENGKFFMCMQMSISVIIVACPCALGLAAPT 586
           + LS +TFI W  ++ + K  +   IF  +   +F+MC+Q++ SV+IVACPCALGLA PT
Sbjct: 536 LILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATPT 595

Query: 587 AIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLH 646
           AIMVGTGV + +GVLIKGGDVLEK + + TF+FDKTGTLTTG M+V+ F+     + +L 
Sbjct: 596 AIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEMIKNLF 655

Query: 647 W-KMISLCESIGEHPVAKAIVNYADSHVNKSSIFD---LDLSNEEVLIGKGISCNITDKN 702
           + + I   E++ +HPV+KA+V Y    + +S  F+   + + +E+++ GKGI C +  K 
Sbjct: 656 YLECIERAEALSDHPVSKAVVKYCRDLLGES--FEGTSMIIEDEQLITGKGIKCTV--KA 711

Query: 703 TSKIHTITIGNKKLFPDESLSDI-----ASSTLTESYVSIDGSLVGKFEISDRVKEDAHF 757
             K   IT+GNK L  ++SL +       +   T +Y++ID  + G+FE+ D VK DA  
Sbjct: 712 ADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSDAKD 771

Query: 758 VVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTER 817
           V+ YL+N   +  MVTGD H+SA+KVA+ + I  N+V+SEVTP+ K   V  L+  G   
Sbjct: 772 VIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG-RV 830

Query: 818 VAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVIL-DSDNKNNSLKGLVYALDIAR 876
           +AF+GDGINDS ALV +DLGI+ISSGT++AIEAA IVIL D D    +LKG+V ALD++ 
Sbjct: 831 IAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSI 890

Query: 877 KTFYRVKLNFFWAVCYNTFMIPIAMGLLAPWGITLHPXXXXXXXXXXXXXXXXXXXXLKR 936
           +TF RVKLN FWA+CYN FM+PIAMG+L PWGITLHP                    LK 
Sbjct: 891 RTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFSSVSVVVNSLMLKW 950

Query: 937 WTPPSLNIKSMEASGGLSWLRFG 959
           W  P L  K+  +S G  +   G
Sbjct: 951 WKAPELTSKNSHSSKGYGYYTKG 973

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/788 (41%), Positives = 483/788 (61%), Gaps = 21/788 (2%)

Query: 171 LKIFGMLSESDRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGF 230
           L + GM   +    ++  V  + GV++ + SL +EE  V ++   +G R I++ IE+ GF
Sbjct: 25  LSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDCGF 84

Query: 231 QTFISNTLDNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPF 290
           +  +        Q+  L++ +E   W++   +   ++ ++MGLYM  P+           
Sbjct: 85  EARVGGC-AREEQVRRLARAEETAQWRRRAAQAWAAAAVMMGLYMVAPL-------EEAL 136

Query: 291 VQTPIIGLFYRDXXXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXX 350
             TP+ GLF+RD                 F +    +L+HG GTMDTL+ LS+       
Sbjct: 137 GPTPLAGLFWRDVAGLAVASGVLATAGRPFLRGLG-ALRHGRGTMDTLVALSSGVTYLFS 195

Query: 351 XXXXXXXXXHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCS 410
                      S   P    DT VML+ FI +GKLLE++A++  + ++++++S  PS C+
Sbjct: 196 VATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCT 255

Query: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVG 470
           I    GS RE+ VELLQ  D+V + PG K+PADG V+  E EVDESL+TGES LV K  G
Sbjct: 256 I-RESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEGEAEVDESLMTGESTLVPKYPG 314

Query: 471 SQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVI 530
           S+V+ GSVNG   F +RA  VGE+T+LA I+A MK+AQL+KAPIQ+YAD +A  F+P V+
Sbjct: 315 SRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVL 374

Query: 531 SLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMV 590
            L+ +TF+ WML+   + TPP IFN+ N + ++C +++I+VI+VACPC LGLAAPTAIMV
Sbjct: 375 ILALLTFVCWMLICTLLATPPSIFNNSN-RLYVCSRIAITVIVVACPCPLGLAAPTAIMV 433

Query: 591 GTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMI 650
           GTG+GA  G+L KGGDV+E  +A+Q  LFDKTGTLTTG+++V NF + +  ++   W ++
Sbjct: 434 GTGLGAERGLLFKGGDVIETAAAVQAILFDKTGTLTTGKLTVHNFTSESKALTPDQWALV 493

Query: 651 SLCESIGEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTIT 710
              E + EHP+A+AIV YA+ + +  ++  + + N EVL+G G+ C +        H IT
Sbjct: 494 CAAERLSEHPIARAIVTYAEPYASPEAVARIVVLNHEVLVGLGVRCVLQLDGVE--HRIT 551

Query: 711 IGNKKLFPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCC 770
           IG+ +L P E  S  + S  T S+V+++  L+G+F++SD ++EDA+ VV+ L + G    
Sbjct: 552 IGSARLLP-ERPSKFSGS--TASFVAVNDVLLGRFDLSDSLREDAYEVVQALLSRGHYVG 608

Query: 771 MVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPA 830
           MVTGD H++A+ V+  LGI  N+VFSE  PE K D++ QL+    + VAF+GDGINDS A
Sbjct: 609 MVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVLRQLRQK-YDYVAFIGDGINDSVA 667

Query: 831 LVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAV 890
           L E+DLGIS+S  +DI  +AA IV+LD  +    L  ++YA+D+AR TF RVKLN FWAV
Sbjct: 668 LAESDLGISLSGNSDIVADAAGIVVLDHSSA-PPLTRILYAIDLARATFNRVKLNIFWAV 726

Query: 891 CYNTFMIPIAMGLLAPWGITLHPXXXXXXXXXXXXXXXXXXXXLKRWTPPSLNIKSMEAS 950
            YN+ M+P++MG+L PWGI L P                    L RW P  +   S +A+
Sbjct: 727 LYNSLMLPVSMGVLIPWGIQLPPMAAAAGMAMSSVSVVTSSLLLARWRP--VPAASRKAA 784

Query: 951 GGLSWLRF 958
            G SW  F
Sbjct: 785 VG-SWRNF 791

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 51/71 (71%)

Query: 1  MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILE 60
          MA T A++SV+GMTC ACVKTV   V  VDGV   EVSL+TEEC V +++ R    +I+E
Sbjct: 18 MAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVE 77

Query: 61 TIDECGFDGSL 71
          TI++CGF+  +
Sbjct: 78 TIEDCGFEARV 88

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%)

Query: 88  SGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTEECKVKFDPHFTSMAEIAECIDD 147
           + +L V GMTC ACVKTV   V  + GV+  +VSLVTEEC+V+++     + +I E I+D
Sbjct: 22  TAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIED 81

Query: 148 CGFDAKV 154
           CGF+A+V
Sbjct: 82  CGFEARV 88

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score =  286 bits (733), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 246/969 (25%), Positives = 455/969 (46%), Gaps = 142/969 (14%)

Query: 9    SVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKG-RTTTSEILETIDECGF 67
            S+ G+TC AC  ++   V ++D V++  V+++++    + D   ++   ++ ET+++CGF
Sbjct: 192  SIGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFILDSDDQSKLDQLKETVEDCGF 251

Query: 68   DGSLISEEPLDYDVTTTEQISGILL-VSGMTCGACVKTVTGQVLKLSG---VLECDVSLV 123
                +    L   ++       + + + GM C  C       +L ++    +++    L 
Sbjct: 252  VYEAVGSPTLTNHISVKSPARHVTVKIEGMFCSNCPVRTIKSLLDIANAELIIDNTDELT 311

Query: 124  TEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLK-IFGMLSESDR 182
             +   +KF                            + +P+ E+ + ++ IF  ++E   
Sbjct: 312  LKHPYIKF----------------------------TYIPNVERGITIRNIFSKITEELT 343

Query: 183  ADIESKVSELKGVISIDTSLQSE-EATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDNS 241
             + E K  ++K VI  + +L+   +     +   I  R I   +  M   TF    +   
Sbjct: 344  TE-EHK--DIKVVIVKEVTLEEHLKEMAKKETWSIAKRLI--AVTVMAIPTFAFGIVG-- 396

Query: 242  TQLSLLSKTKEIQFW-KKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFY 300
              ++LL  + + + W  +    G +S ++ +   +  P+ F        FV      +F+
Sbjct: 397  --MALLPSSNKFREWVDEPTWVGNVSRVVWILFIISTPVYF--------FVAD----IFH 442

Query: 301  RDXXXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXXXXXXXXXXXH 360
            R                 + +   W       G+M+ L+ L T  A              
Sbjct: 443  RKAVKEIYSL--------WKHSNNWKRRLFRFGSMNLLMSLGTTVAYFASIALLGIAASR 494

Query: 361  ----KSTKMPK----VIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIV 412
                  ++M K      FD+ V L  F+ +G+LLE+ AK++T++A+S L S    + +++
Sbjct: 495  PRDTSDSRMHKGLSTTYFDSVVFLTFFLLIGRLLESLAKTKTASAISNLSSFKQETATLM 554

Query: 413  LPDGSTRE----ISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKI 468
               G   +    + ++ L+  D +++ PG   P D +++  ETE DES +TGES+ + ++
Sbjct: 555  QKVGDQYQEVETVQIQYLELGDYIKISPGQSPPLDSIILEGETEFDESALTGESIPMVRL 614

Query: 469  VGSQVIGGSVN-GPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVP 527
             G Q+  G+VN G      +      ++ L  I+ T++  QL++API++ AD + G FVP
Sbjct: 615  RGDQIFAGTVNVGSSSVIAKVSSFDGESLLDQIVNTVRDGQLNRAPIERLADILTGYFVP 674

Query: 528  FVISLSAITFITWMLVSYTMKTPPLIFNSENGKF-FMCMQMSISVIIVACPCALGLAAPT 586
             +I L+ +T++ W+ +  + K P    +++ G +    ++ +ISV ++ACPC +GLAAPT
Sbjct: 675  IIIFLAILTWVVWLSLGLSGKLPEHYLDTDIGGWPVWSLEFAISVFVIACPCGIGLAAPT 734

Query: 587  AIMVGTGVGASHGVLIKGGD-VLEKCSALQTFLFDKTGTLTTG-RMSVENF-INYNSDVS 643
            A+ VG+G+ A  G+L +GG    ++   +    FDKTGTLT G  M V N+ ++ +  ++
Sbjct: 735  ALFVGSGMAAKFGILCRGGGAAFQEGCKIAIVCFDKTGTLTLGNEMKVTNYSLHGDEKLA 794

Query: 644  DLHWKMISLCESIGEHPVAKAIVNYADSHVNKSS--------------------IFDLDL 683
             +  ++    ES   HP+A  +  + D+   K +                    I D DL
Sbjct: 795  KIGIEVTRDMESGSRHPLAIGVKKFIDNTFGKKTGTVKVPDPVEITGGGLKGEIIIDNDL 854

Query: 684  SNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPD-------ESLSDIA---------- 726
            S  +  I K +   +            +GN++L  D       E L  +A          
Sbjct: 855  SLPDARIWKEVDPEMA----------IVGNERLLRDYKCHLTSEQLKLLAEWKARGKSLM 904

Query: 727  -SSTLTESYVSIDGSL-VGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVA 784
             ++  + SY   D    V      D ++ +A  V++ L+  GI+C M++GD   +A  VA
Sbjct: 905  VTAIKSRSYFGNDNFYPVMMCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

Query: 785  QQLGISANDVFSEVTPEQKRDIVIQLQNNGT------ERVAFVGDGINDSPALVEADLGI 838
            Q+L I  ++V +EV PE+K   V  +Q+N        + VA VGDGIND+PAL  AD+GI
Sbjct: 965  QELDI--DNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGI 1022

Query: 839  SISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIP 898
            +++SG+++A+ + D V+L   +  N+L  L+  L +++  F R+K NF WA+ YN   +P
Sbjct: 1023 ALASGSELAMTSCDFVLL---SPINTLVSLLALLKLSKTVFNRIKFNFTWALVYNMLALP 1079

Query: 899  IAMGLLAPW 907
            IA G++ P+
Sbjct: 1080 IAAGVIYPY 1088

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score =  281 bits (719), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 243/949 (25%), Positives = 444/949 (46%), Gaps = 115/949 (12%)

Query: 10   VQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEIL-ETIDECGFD 68
            + G+TC +C  ++      +D + +  V+ +T+    + D         L + ++ECGF+
Sbjct: 289  IGGITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVVEECGFE 348

Query: 69   GSLIS-EEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTEEC 127
              L+   +   +    TE+    + + GM C +C + V   V  L    + ++  VT+  
Sbjct: 349  FELVGVPQSTIHSSVQTERRVVTIEIDGMYCQSCPQRV---VASLENYNKANIE-VTQVP 404

Query: 128  KVKFDPHFTSMAEIAECIDDCGFDAKVISENSSSVPSNEKRLCLKIFGMLSESDRADIES 187
             +K  PH T  + +    +     A V    +S +P+N                 +  + 
Sbjct: 405  TLK-SPHLT-FSYVPNQSNGTTIRALVEHVRTSILPAN-----------------SSYQI 445

Query: 188  KVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCI---EEMGFQTFISNTLDNSTQL 244
             V  ++G + +D+ L+        D NE   + I+ C+     +   TF+   +     +
Sbjct: 446  SVKVVEGSL-LDSKLK--------DLNEREQKSIMRCLIFAAIVAIPTFVFGIIG----M 492

Query: 245  SLLSKTKEIQFW-KKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFYRDX 303
            SLL      + W +K      +  ++ + L +  P+ F +V   F       +   +   
Sbjct: 493  SLLPGEHRFRKWLEKPLWVKNVPRVIWILLILSTPVYF-SVAEQFHAKACRELHFLWA-- 549

Query: 304  XXXXXXXXXXXXXXSYFYKAAWISLKHGSGTMDTLIGLSTVCAXXXXXXXXXX------X 357
                             Y+ +W +     G+M+ L+ L T  A                 
Sbjct: 550  -----------------YQKSWTARLFKFGSMNLLVSLGTSVAYFASILLLILSALKKDA 592

Query: 358  XXHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGS 417
              HK +  P   FD+ V L  F+ +G+LLE+ +KS+    +  L SL   +  ++  DG+
Sbjct: 593  NHHKGS--PDTYFDSVVFLTLFLLIGRLLESLSKSKMVKTLESLTSLKQRTGILMQADGA 650

Query: 418  T-----REISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQ 472
                    +S E+L+  D + + PG     D ++++ ETE DES +TGES  +    G Q
Sbjct: 651  RDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQGETEFDESSLTGESRPITHFPGDQ 710

Query: 473  VIGGSVN-GPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVIS 531
            +  G+VN G      +      ++ L ++I+ ++  QL  API++ AD + G FVPF++ 
Sbjct: 711  IFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIADVLTGYFVPFIVL 770

Query: 532  LSAITFITWMLVSYT-MKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMV 590
            L+ +T+  W+++ +  + +   +  S  G  F  ++ +I+V ++ACPC +GLAAPTA+ V
Sbjct: 771  LAILTWAIWLILGFAGVLSQEKLDGSVGGWPFWSLEFAIAVFVIACPCGIGLAAPTALFV 830

Query: 591  GTGVGASHGVLIKGGD-VLEKCSALQTFLFDKTGTLTTG-RMSVENFINY-NSDVSDLHW 647
            G  + A +G+L +GG    +  S + T  FDKTGTLT G    V ++  Y +  +  +  
Sbjct: 831  GANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLTKGCAPEVTDYAIYPDPRIHKILG 890

Query: 648  KMISLCESIGEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITD------- 700
            K++       +HP++ ++  +A   + +  + D+++   + + GKG++  I         
Sbjct: 891  KVLHEFGLASKHPLSHSMKCFALKTLGE-DLSDINVLEIKEIPGKGMTGVIEPSPAQPSG 949

Query: 701  -KNTSKIHTITIGNKK--------LFPDESLSDIASSTLTESYVSI-----DGSLVGKF- 745
             ++      + +GN+K        L PD+     +      S + I     +G+    F 
Sbjct: 950  FRDELVPSEVIVGNEKFMAENGCQLSPDQESLLYSWKIEGRSIIIIGMNFPEGAATQCFI 1009

Query: 746  -----EISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTP 800
                  + D ++ +A  VV+ L   GI+C M++GD   +A  VA ++GI    V ++V P
Sbjct: 1010 PTLFLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI--KHVIADVLP 1067

Query: 801  EQKRDIVIQLQNNGTERV--AFVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDS 858
            E K + +  ++    + V  A VGDG+ND+PA+  AD+GIS++SG+D+A+ + D V+L  
Sbjct: 1068 EGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGSDLAMISCDFVLL-- 1125

Query: 859  DNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIAMGLLAPW 907
             +K N L G+V  L +++K F RVK NF WA+ YN   +PIA G+L P+
Sbjct: 1126 -SKKNPLTGIVVLLQLSKKVFRRVKFNFVWALVYNIICVPIAAGVLYPY 1173

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score =  270 bits (689), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 174/553 (31%), Positives = 296/553 (53%), Gaps = 36/553 (6%)

Query: 370  FDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPN 429
            F+T+ +L+T I +G+ +   A+     ++S + SL  SS  +V   G   EI++ LLQ  
Sbjct: 659  FETSSLLVTLIMVGRFVSELARHRAVKSIS-VRSLQASSAILVDKTGKETEINIRLLQYG 717

Query: 430  DIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNGPGHFYFRAI 489
            DI +V+P  +IP DG VI   +EVDE+LITGESM V K   S V+ GSVNG G  + +  
Sbjct: 718  DIFKVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLS 777

Query: 490  RVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMKT 549
            ++  +  ++ I   + +A+L+K  IQ  ADK+A  FVP +I ++ +TF  W+ V   ++ 
Sbjct: 778  KLPGNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEK 837

Query: 550  PPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLE 609
                  S +      +  +I+V+IV+CPC +GLA P   ++ +GV A  GV+ K  + +E
Sbjct: 838  -----QSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIE 892

Query: 610  KCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMISLCESIGEHPVAKAIVNYA 669
                    +FDKTGTLT G+++V +      D  +    ++ L E I +HPV+ AI +Y 
Sbjct: 893  VAHNTSHVVFDKTGTLTEGKLTVVHE-TVRGDRHNSQSLLLGLTEGI-KHPVSMAIASY- 949

Query: 670  DSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASST 729
               + +  +   ++SN + + GK +    T  +  K+     GN +     +  D+  + 
Sbjct: 950  ---LKEKGVSAQNVSNTKAVTGKRVEG--TSYSGLKLQG---GNCRWLGHNNDPDVRKA- 1000

Query: 730  LTESY----VSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQ 785
            L + Y     S++GS+   + + D ++ DA   +  L+  GI   +++GD   +   +A 
Sbjct: 1001 LEQGYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAA 1060

Query: 786  QLGISANDVFSEVTPEQK----RDIVIQLQNNGTER-----VAFVGDGINDSPALVEADL 836
            +LGI ++++ S  TP +K    +DIV     + + +     V F GDG ND+  L +A +
Sbjct: 1061 RLGIESSNIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATI 1120

Query: 837  GISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFM 896
            G+ I+ G+++A  AAD+V+L        L  ++  + +++K  +RVKLNF W+  YN F 
Sbjct: 1121 GVHINEGSEVAKLAADVVMLKP-----KLNNILTMITVSQKAMFRVKLNFLWSFTYNLFA 1175

Query: 897  IPIAMGLLAPWGI 909
            I +A G    + I
Sbjct: 1176 ILLAAGAFVDFHI 1188

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  128 bits (321), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 132/539 (24%), Positives = 228/539 (42%), Gaps = 86/539 (15%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGES 462
           T ++ ++V+ DG   EI    + P DI+++  G  IP DG ++  +   ++D+S ITGES
Sbjct: 175 TLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGES 234

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           + V+K  G Q    S    G  +      G++T +    A + KA   +     + + + 
Sbjct: 235 LAVDKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQG---HFTEVLN 291

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
           GI +  ++ + A   + W    Y            NG     ++ ++ + I+  P  L  
Sbjct: 292 GIGIILLVLVIATLLLVWTACFY----------RTNG-IVRILRYTLGITIIGVPVGLPA 340

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +      
Sbjct: 341 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS 400

Query: 642 VSDLHWKMISLC------------------ESIGEHPVAK-AIVNYA-------DSHVNK 675
             DL   M++ C                  +S+ ++P AK A+  Y        D    K
Sbjct: 401 PDDL---MLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKK 457

Query: 676 SSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYV 735
            +        E ++  KG    +  K   + H I     + + +  ++++AS       V
Sbjct: 458 VTAVVESPEGERIVCVKGAPLFVL-KTVEEDHPIPEDVHENY-ENKVAELASRGFRALGV 515

Query: 736 SID-----GSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGIS 790
           +         ++G     D  ++D    V   ++LG++  M+TGDA   A +  +QLG+ 
Sbjct: 516 ARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLG 575

Query: 791 AN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823
            N                           D F+EV P+ K  +V  LQN G   VA  GD
Sbjct: 576 TNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGY-LVAMTGD 634

Query: 824 GINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           G+ND+P+L +AD GI++   TD A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 635 GVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 688

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  121 bits (304), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 125/540 (23%), Positives = 228/540 (42%), Gaps = 88/540 (16%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGES 462
           T ++ ++V+ DGS  EI    + P DI+++  G+ IPADG ++      ++D+S ITGES
Sbjct: 156 TLANSAVVIRDGSLVEIPANEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGES 215

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           + V+K  G      S    G  +      G+ T +    A + KA        +  + + 
Sbjct: 216 LAVDKRYGDATFSSSTVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIG 275

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
            I +  VI    + ++     S  + T               ++ ++++ +V  P  L  
Sbjct: 276 TILLILVILTLLVVYVACFYRSIDIVT--------------ILRYTLAITVVGVPVGLPA 321

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +     +
Sbjct: 322 VVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVE 381

Query: 642 VSDLHWKMISLCESIG---------EHPVAKAIVNY--ADSHVNKSSIFDLDLSNEEVLI 690
             DL   M++ C +           +    K+++NY  A + + K  + +    +    +
Sbjct: 382 ADDL---MLTACLAASRKKKGLDAIDKAFLKSLINYPRAKAALTKYKVLEFHPFDP---V 435

Query: 691 GKGISCNITDKNTSKIHTI---------TIGNKKLFPD---ESLSDIASSTLTESYVSI- 737
            K ++  +      +I  +         T+    L P+   E+  +  +   +  Y ++ 
Sbjct: 436 SKKVTAIVESPEGERIVCVKGAPLFVLKTVEENHLIPEDVKENYENKVAELASRGYRALG 495

Query: 738 --------DGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGI 789
                      ++G     D  ++D    V   ++LG++  M+TGDA   A +  +QLG+
Sbjct: 496 VARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGL 555

Query: 790 SAN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVG 822
             N                           D F+EV P+ K ++V  LQ  G   VA  G
Sbjct: 556 GTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGY-LVAMTG 614

Query: 823 DGINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           DG+ND+P+L +AD GI++   TD A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 615 DGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 669

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  121 bits (304), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 130/539 (24%), Positives = 229/539 (42%), Gaps = 86/539 (15%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGES 462
           T ++ + V+ DG   EI    + P +I+++  G   PADG ++  +   ++D+S ITGES
Sbjct: 204 TLANTATVIRDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGES 263

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           +  EK  G +V   S    G  +      G++T +    A + +A   +     + + + 
Sbjct: 264 LAAEKHYGDEVFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEG---HFTEVLN 320

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
           GI +  ++ + A   + W    Y  +T  ++           ++ ++ + I+  P  L  
Sbjct: 321 GIGIILLVLVIATLLLVWTACFY--RTVGIV---------SILRYTLGITIIGVPVGLPA 369

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +      
Sbjct: 370 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS 429

Query: 642 VSDLHWKMISLC------------------ESIGEHPVAK-AIVNYA-------DSHVNK 675
             DL   M++ C                  +S+ E+P AK A+  Y        D    K
Sbjct: 430 PDDL---MLTACLAASRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKK 486

Query: 676 SSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYV 735
            +        E ++  KG    +  K   + H I     + + +  ++++AS       V
Sbjct: 487 VTAVVESPEGERIVCVKGAPLFVL-KTVEEDHPIPEDVHENY-ENKVAELASRGFRALGV 544

Query: 736 SID-----GSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGIS 790
           +         ++G     D  ++D    +   +NLG++  M+TGDA   A +  +QLG+ 
Sbjct: 545 ARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLG 604

Query: 791 AN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823
            N                           D F+EV P+ K  +V  LQN G   VA  GD
Sbjct: 605 TNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGY-LVAMTGD 663

Query: 824 GINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           G+ND+P+L +AD GI++   TD A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 664 GVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 717

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  118 bits (296), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 131/539 (24%), Positives = 228/539 (42%), Gaps = 86/539 (15%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGES 462
           T ++ ++V+ DG+  E+    + P DI+++  G+ IPADG ++  +   ++D+S ITGES
Sbjct: 156 TLANSAVVIRDGNLVEVPSNEVVPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGES 215

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           + V+K  G      S    G  +      G+ T +    A + KA         + + + 
Sbjct: 216 LAVDKRFGDSTFSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSG---HFTEVLN 272

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
           GI    +I +     + W+   Y              K    ++ ++++ IV  P  L  
Sbjct: 273 GIGTILLILVIVTLLLVWVASFY-----------RTNKIVRILRYTLAITIVGVPVGLPA 321

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +     D
Sbjct: 322 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVD 381

Query: 642 VSDLHWKMISLC------------------ESIGEHPVAK-AIVNYA-------DSHVNK 675
             DL   M++ C                  +S+  +P AK A+  Y        D    K
Sbjct: 382 PDDL---MLTACLAASRKKKGLDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKK 438

Query: 676 SSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYV 735
            +        E ++  KG    +  K   + H I    ++ + +  ++++AS       V
Sbjct: 439 VTAIVESPEGERIICVKGAPLFVL-KTVEEEHPIPEDVRENY-ENKVAELASRGFRALGV 496

Query: 736 SID-----GSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGIS 790
           +         ++G     D  ++D    V   ++LG++  M+TGDA   A +  +QLG+ 
Sbjct: 497 ARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLG 556

Query: 791 AN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823
            N                           D F+EV P+ K ++V  LQ  G   VA  GD
Sbjct: 557 TNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGY-LVAMTGD 615

Query: 824 GINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           G+ND+P+L +AD GI++   TD A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 616 GVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 669

>Scas_688.1
          Length = 913

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 130/539 (24%), Positives = 228/539 (42%), Gaps = 86/539 (15%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGES 462
           T ++ +IV+ DG   E+    + P DI+++  G+ IPADG ++  +   ++D+S ITGES
Sbjct: 170 TLANSAIVIRDGQLVEVPANEVVPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGES 229

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           +  +K  G Q    S    G  +      G++T +    A + KA   +     + + + 
Sbjct: 230 LAADKHYGDQTFSSSTVKRGEAFMVITATGDNTFVGRAAALVNKASGGQG---HFTEVLN 286

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
           GI +  ++ +     + W    Y  +T  ++           ++ ++ + IV  P  L  
Sbjct: 287 GIGIILLVLVIVTLLLVWTASFY--RTDGIV---------RILRYTLGITIVGVPVGLPA 335

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +      
Sbjct: 336 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS 395

Query: 642 VSDLHWKMISLC------------------ESIGEHPVAK-AIVNYA-------DSHVNK 675
             DL   M++ C                  +S+ ++P AK A+  Y        D    K
Sbjct: 396 ADDL---MLTACLAASRKKKGLDAIDKAFLKSLAQYPAAKNALTKYKVLEFHPFDPVSKK 452

Query: 676 SSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYV 735
            +        E ++  KG    +  K   + H I     + + +  ++++AS       V
Sbjct: 453 VTAVVESPEGERIICVKGAPLFVL-KTVEEDHPIPEDIHENY-ENKVAELASRGFRALGV 510

Query: 736 SID-----GSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGIS 790
           +         ++G     D  ++D    V   + LG++  M+TGDA   A +  +QLG+ 
Sbjct: 511 ARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLG 570

Query: 791 AN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823
            N                           D F+EV P+ K  +V  LQ  G   VA  GD
Sbjct: 571 TNVYNAERLGLSGGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGY-LVAMTGD 629

Query: 824 GINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           G+ND+P+L +AD GI++   TD A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 630 GVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 683

>Kwal_47.17522
          Length = 899

 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 126/537 (23%), Positives = 224/537 (41%), Gaps = 86/537 (16%)

Query: 407 SSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGESML 464
           ++ ++V+ DG+  EI    + P DI+++  G+ I ADG ++  E   ++D+S ITGES+ 
Sbjct: 158 ANSAVVVRDGNLVEIPANEVVPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLA 217

Query: 465 VEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGI 524
           V+K  G      S    G  +      G++T +    A + +A   +     + + + GI
Sbjct: 218 VDKHYGDTTFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQAAGDQG---HFTEVLNGI 274

Query: 525 FVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAA 584
               ++ +     + W    Y              +    ++ ++ + I+  P  L    
Sbjct: 275 GTILLVLVIVTLLLVWTACFY-----------RTDRIVRILRYTLGITIIGVPVGLPAVV 323

Query: 585 PTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSDVS 643
            T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +     +  
Sbjct: 324 TTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPD 383

Query: 644 DLHWKMISLC------------------ESIGEHPVAK-AIVNYA-------DSHVNKSS 677
           DL   M++ C                  +S+ ++P AK A+  Y        D    K +
Sbjct: 384 DL---MLTACLAASRKKKGLDAIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKKVT 440

Query: 678 IFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYVSI 737
                   E ++  KG    +  K   + H I     + + +  ++++AS       V+ 
Sbjct: 441 AVVESPEGERIICVKGAPLFVL-KTVEEDHPIPEDVHENY-ENKVAELASRGFRALGVAR 498

Query: 738 D-----GSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAN 792
                   ++G     D  ++D    V   + LG++  M+TGDA   A +  +QLG+  N
Sbjct: 499 KRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTN 558

Query: 793 ---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGI 825
                                      D F+EV P+ K  +V  LQ  G   VA  GDG+
Sbjct: 559 IYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYSVVEILQQRGY-LVAMTGDGV 617

Query: 826 NDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           ND+P+L +AD GI++   TD A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 618 NDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 669

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score =  114 bits (285), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 142/595 (23%), Positives = 233/595 (39%), Gaps = 147/595 (24%)

Query: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIR-N 449
           +SE S  +  L  L P  C ++     +  ++  L+ P D+V    G +IPAD  +I  N
Sbjct: 145 RSEKS--LEALNKLVPQECHLIRGGRESNVLATNLV-PGDLVRFRIGDRIPADIRIIECN 201

Query: 450 ETEVDESLITGESMLVEKIVGSQVIGGSVNGPGHFYFRAIRV------------------ 491
           +  +DES +TGE+  V K   +       + P      A R                   
Sbjct: 202 DLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIV 261

Query: 492 ---GEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMK 548
              G +T   N+   M   +  K P+Q   DK+          LS        L S+ + 
Sbjct: 262 VGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK-------DLS--------LASFVVI 306

Query: 549 TPPLIFNSENGKFFMCM-QMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDV 607
               +     G+ ++ M Q+S+S+ + A P  L +     + +G    A    +++    
Sbjct: 307 GIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS 366

Query: 608 LEKCSALQTFLFDKTGTLTTGRMSVE-----------------------NFINY------ 638
           +E   ++     DKTGTLT+  M+V                        N  NY      
Sbjct: 367 VETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVK 426

Query: 639 ----------NSDVSDLHWKM------ISLCESIGEHPVAKAIVNYAD----SHVNKSSI 678
                     N+  S  H K       ++L E + +  +A     Y      S  +K  +
Sbjct: 427 TTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSFNSKRKM 486

Query: 679 FDLDLSNEE---VLIGKGISCNITDKNTS------KIHTITIGNKK-------------- 715
               + + E    L  KG    I DK++S      KI  +T G+++              
Sbjct: 487 MATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGL 546

Query: 716 ---LFPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
               F   +++D +SS L E  +S D    G   ++D  +    F ++     GI   M+
Sbjct: 547 RVLAFAKRAMTD-SSSKLVEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMI 604

Query: 773 TGDAHQSALKVAQQLGISAND---------------------------VFSEVTPEQKRD 805
           TGD+  +A+ +A+Q+GI   D                           +F+  TPE K +
Sbjct: 605 TGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLN 664

Query: 806 IVIQLQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859
           IV  L+  G + VA  GDG+ND+PAL  AD+G+S+   GTD+A EA+D+++ D D
Sbjct: 665 IVRALRRRG-DVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDD 718

>Scas_710.41
          Length = 904

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 130/543 (23%), Positives = 224/543 (41%), Gaps = 94/543 (17%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNET--EVDESLITGES 462
           T ++ + V+ DG+ +EI    + P DI+E+  G  IPADG ++      +VD+S ITGES
Sbjct: 162 TLANTARVIRDGTLQEIPANEIVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGES 221

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           + V+K  G      S    G         G++T +    A + +A   +     + D + 
Sbjct: 222 LAVDKNYGDVTFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQG---HFTDILN 278

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
            I    ++ +     + W    Y  +T  ++         M ++ ++ + I+  P  L  
Sbjct: 279 DIGTILLVLVIITLLLVWTACFY--RTDGIV---------MILRFTLGITIIGVPVGLPA 327

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +      
Sbjct: 328 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS 387

Query: 642 VSDLHWKMISLC------------------ESIGEHPVA-KAIVNYA-------DSHVNK 675
             DL   M++ C                  +S+ ++P A  A+  Y        D    K
Sbjct: 388 ADDL---MLTACLAATRKKKGLDAIDRAFLKSLNQYPKAMNALPKYKILEFHPFDPVSKK 444

Query: 676 SSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLT---- 731
            +        E +   KG    +  K   + H +     + + +  ++++AS        
Sbjct: 445 VTAVVKSPEGETITCVKGAPLFVL-KTVEEDHPVPEDVHENY-ENKVAELASRGFRSLGV 502

Query: 732 -----ESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQ 786
                E Y  I    +G     D  ++D    +   + LG++  M+TGDA   A + ++Q
Sbjct: 503 ARKRGEGYWEI----LGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQ 558

Query: 787 LGISAN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVA 819
           LG+  N                           D F+EV P+ K  +V  LQN G   VA
Sbjct: 559 LGLGVNIYNAEKLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGY-LVA 617

Query: 820 FVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTF 879
             GDG+ND+P+L +AD GI++   TD A  AADIV L        L  ++  L  +R+ F
Sbjct: 618 MTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP-----GLSAIIDGLKTSRQIF 672

Query: 880 YRV 882
           +R+
Sbjct: 673 HRM 675

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 131/573 (22%), Positives = 235/573 (41%), Gaps = 98/573 (17%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE--TEVDESLITGES 462
           T ++ ++V+ DG   E+    + P DI+++  G  IPADG ++      +VD+S ITGES
Sbjct: 159 TLANVAVVIRDGQLVEVPANEVVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGES 218

Query: 463 MLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMA 522
           + V+K  G Q    S    G  +      G++T +    A + KA   +     + + + 
Sbjct: 219 LAVDKGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQG---HFTEVLN 275

Query: 523 GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGL 582
           GI +  ++ +       W    Y                   ++ ++ + I+  P  L  
Sbjct: 276 GIGILLLVLVIVTLLGVWAACFY-----------RTDNIVKILRFTLGITIIGVPVGLPA 324

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV-ENFINYNSD 641
              T + VG    A    +++    +E  + ++    DKTGTLT  ++S+ E +      
Sbjct: 325 VVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS 384

Query: 642 VSDLHWKMISLCESIG---------EHPVAKAIVNY--ADSHVNKSSIFDLDLSNEEVLI 690
             DL   M++ C +           +    K+++NY  A   + K  + +    +    +
Sbjct: 385 ADDL---MLTACLAASRKKKGLDAIDKAFLKSLINYPKAKDALTKYKVIEFHPFDP---V 438

Query: 691 GKGISCNITDKNTSKIHTI---------TIGNKKLFPDE-------SLSDIASSTLTESY 734
            K ++  +      +I  +         T+      P++        ++++AS       
Sbjct: 439 SKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG 498

Query: 735 VSID-----GSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGI 789
           V+         ++G     D  ++D    V   + LG++  M+TGDA   A +  +QLG+
Sbjct: 499 VARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGL 558

Query: 790 SAN---------------------------DVFSEVTPEQKRDIVIQLQNNGTERVAFVG 822
             N                           D F+EV P+ K  +V  LQN G   VA  G
Sbjct: 559 GTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGY-LVAMTG 617

Query: 823 DGINDSPALVEADLGISISSGTDIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRV 882
           DG+ND+P+L +AD GI++   +D A  AADIV L        L  ++ AL  +R+ F+R+
Sbjct: 618 DGVNDAPSLKKADTGIAVEGASDAARSAADIVFLAP-----GLSAIIDALKTSRQIFHRM 672

Query: 883 KLNFFWAVCYNTFMIPIAMGL---LAPWGITLH 912
                    Y  + I +++ L   L  W I L+
Sbjct: 673 -------YSYVVYRIALSLHLELFLGLWIIILN 698

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 147/593 (24%), Positives = 236/593 (39%), Gaps = 143/593 (24%)

Query: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN- 449
           KSE S  +  L  L P+ C +    G    +    L P D+V    G +IPAD  ++ + 
Sbjct: 132 KSEKS--LEALNKLVPAECHLTR-SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESI 188

Query: 450 ETEVDESLITGESMLVEKIVG-------SQVIG--------------GSVNGPGHFYFRA 488
           +  VDES +TGE+  V K  G       S + G              G++   GH     
Sbjct: 189 DLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIV 248

Query: 489 IRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMK 548
           I  G+ T   ++   M      K P+Q   DK+          LS ++F+   ++     
Sbjct: 249 IATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ-------DLSYMSFVLIGIICLIGI 301

Query: 549 TPPLIFNSENGKFFMCM-QMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDV 607
                     G+ ++ M Q+++S+ + A P  L +     + +G    A    +++    
Sbjct: 302 I--------QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS 353

Query: 608 LEKCSALQTFLFDKTGTLTTGRMSV---------ENFIN--YNSDVSDLHWKM---ISLC 653
           +E   ++     DKTGTLT   M+V         EN  N    S V +   KM   ++  
Sbjct: 354 VETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATT 413

Query: 654 ESIG----------EH------PVAKAI--------VNYADSHVNK------------SS 677
             IG          EH      P   AI        +N   + VNK             +
Sbjct: 414 LRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMA 473

Query: 678 IFDLDLSNEEVLIGKGISCNITDKNTS------KIHTITIGNKKLFPD-------ESLSD 724
           +  +D +++ V+  KG    I +K+ +      K+H +   +K +  D       E L  
Sbjct: 474 VKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRT 533

Query: 725 IASSTLTESYVSIDG----------SLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTG 774
           +A + L  S    D           +  G   ++D  +      +E L    +   M+TG
Sbjct: 534 LAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITG 593

Query: 775 DAHQSALKVAQQLGISA---------------------------NDVFSEVTPEQKRDIV 807
           DA  +A+ +A+Q+GI                              +VF+  TPE K +IV
Sbjct: 594 DAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIV 653

Query: 808 IQLQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859
             LQ  G + VA  GDG+ND+PAL  AD+G+S+   GTD+A EA+D+V+ D D
Sbjct: 654 RALQKRG-DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 705

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 145/658 (22%), Positives = 269/658 (40%), Gaps = 156/658 (23%)

Query: 373 AVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIV 432
           ++ +L  +++G + E +++     ++  L  L P+ C ++     +  ++ EL+ P D+V
Sbjct: 131 SLAILIVVTVGFIQEYRSEK----SLEALNKLVPTKCHLIRYGRESNTLASELV-PGDLV 185

Query: 433 EVVPGMKIPADGVVIRN-ETEVDESLITGESMLVEKIVGSQVIG---------------- 475
               G +IPAD  +I   +  +DES +TGE+  + K   +Q I                 
Sbjct: 186 RFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHK--DAQTIDPEEYDNRNVPVSERSC 243

Query: 476 ----GSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVIS 531
               G++   GH     I  G +T    I   +   +  K P+Q+  D++          
Sbjct: 244 IAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQETMDRLG--------- 294

Query: 532 LSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVG 591
            + +++I++ +++       +  NS      M  Q+S+S+ + A P  L +     + +G
Sbjct: 295 -TELSYISFFIIAIISIVGIIRGNS----LLMMFQVSVSLAVAAIPEGLPIIVTVTLALG 349

Query: 592 TGVGASHGVLIKGGDVLEKCSALQTFLFDK-----TGTLTTGRM-------SVENFINYN 639
                    +++    +E   ++     DK     T  +T  ++       + EN I+  
Sbjct: 350 VLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYENAISPE 409

Query: 640 SDVS-DLH-------WKMISLCESIG---EH------PVAKAIV---------NYADSHV 673
            D   D+H         + ++C +     EH      P   A++         +  DSH 
Sbjct: 410 EDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYIGNPTDVALIEVLTKFGIPDQRDSHE 469

Query: 674 NKS-----------SIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDES- 721
                         +I     S E VL  KG    I DK  S  +    G  + F + S 
Sbjct: 470 KMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDK--SSYYLDKAGEVREFDEHSK 527

Query: 722 --------------LSDIASS---TLTESYVSIDG----SLVGKFEISDRVKEDAHFVVE 760
                         L  IA +   T +++ +S D     +  G F ++D  + +    +E
Sbjct: 528 VMVLEAAHSCASDGLRTIACAFKPTDSDNVISEDDINGLTFTGLFGLADPPRPNVKASIE 587

Query: 761 YLQNLGIKCCMVTGDAHQSALKVAQQLGISAND--------------------------- 793
            L   G+   M+TGD+  +A+ +A+++G+S  D                           
Sbjct: 588 KLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGDKVSELTEDELSKVIDKVN 647

Query: 794 VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAAD 852
           +F+  TPE K +IV  L+  G + VA  GDG+ND+PAL  AD+GI++  SGTD+A E +D
Sbjct: 648 IFARATPENKLNIVKALRKRG-DIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSD 706

Query: 853 IVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIAMGLLAPWGIT 910
           +++ D D        ++ A++  +  F  ++ NF       TF + I++  L+   IT
Sbjct: 707 MILTDDD-----FSSILTAIEEGKGIFNNIR-NFL------TFQLSISVATLSLIAIT 752

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 90/171 (52%), Gaps = 31/171 (18%)

Query: 717 FPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDA 776
           F   +LSD +S+ LTE  +  D +  G   ++D  + +  F +E L   G+   M+TGD+
Sbjct: 550 FAKLTLSD-SSTPLTEDLIK-DLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDS 607

Query: 777 HQSALKVAQQLGISAND---------------------------VFSEVTPEQKRDIVIQ 809
             +A+ +A+Q+GI   D                           +F+  TPE K +IV  
Sbjct: 608 ENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRA 667

Query: 810 LQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859
           L+  G + VA  GDG+ND+PAL  +D+G+S+   GTD+A EA+D+V+ D D
Sbjct: 668 LRKRG-DVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDD 717

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 113/284 (39%), Gaps = 43/284 (15%)

Query: 373 AVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIV 432
           ++ L  FI +      + +SE S  +  L  L P+ C + +  G    +    L P D+V
Sbjct: 119 SITLAIFIVVTVGFVQEYRSEKS--LEALNKLVPAECHL-MRCGQESHVLASTLVPGDLV 175

Query: 433 EVVPGMKIPADGVVIRN-ETEVDESLITGESMLVEKIVGSQVIG---------------- 475
               G +IPAD  +I   +  +DES +TGE+  V K   SQ I                 
Sbjct: 176 HFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKT--SQTIEKSSFNDQPNSIVPISE 233

Query: 476 -------GSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPF 528
                  G++   GH     +  G +T    +   M   +  K P+Q   DK+       
Sbjct: 234 RSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGK----- 288

Query: 529 VISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAI 588
              LS ++FI   ++        L+   +   +    Q+S+S+ + A P  L +     +
Sbjct: 289 --DLSLVSFIVIGMIC-------LVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTL 339

Query: 589 MVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV 632
            +G    A    +++    +E   ++     DKTGTLT+  M+V
Sbjct: 340 ALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV 383

>Kwal_14.1498
          Length = 939

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 85/172 (49%), Gaps = 32/172 (18%)

Query: 717 FPDESLSDIASSTLTESYVSIDG-SLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGD 775
           F    LS+  S  LTE    I+G +  G   ++D  +      VE L    +   M+TGD
Sbjct: 538 FAQLELSNGNSKKLTED--DINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGD 595

Query: 776 AHQSALKVAQQLGISAND---------------------------VFSEVTPEQKRDIVI 808
           A  +A+ +A+Q+GI   +                           +F+  TPE K +IV 
Sbjct: 596 AENTAVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARATPEHKLNIVR 655

Query: 809 QLQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859
            LQ  G + VA  GDG+ND+PAL  AD+G+S+   GTD+A EA+D+V+ D D
Sbjct: 656 ALQKRG-DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 706

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 107/264 (40%), Gaps = 39/264 (14%)

Query: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN- 449
           +SE S  +  L  L P  C ++   G   ++   +L P D+V    G +IPAD  +I   
Sbjct: 132 RSEKS--LEALNRLVPDQCHLIRC-GQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAV 188

Query: 450 ETEVDESLITGESMLVEKI------------VGSQV---------IGGSVNGPGHFYFRA 488
           +  ++ES +TGE+  V K             +GS V           G++   GH     
Sbjct: 189 DLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIV 248

Query: 489 IRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMK 548
           I   ++T    +   M   +  K P+Q   DK+          LS ++FI   ++     
Sbjct: 249 IGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGK-------DLSFMSFIVIGIIC---- 297

Query: 549 TPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVL 608
              LI   +   +    Q+S+S+ + A P  L +     + +G    A    +I+    +
Sbjct: 298 ---LIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSV 354

Query: 609 EKCSALQTFLFDKTGTLTTGRMSV 632
           E   ++     DKTGTLT   MSV
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMSV 378

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 29/148 (19%)

Query: 740 SLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISA-------- 791
           + VG   + D  +      +E L   G+   M+TGDA  +A+ +A+Q+GI          
Sbjct: 578 TFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVL 637

Query: 792 -------------------NDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALV 832
                               ++F+  TPE K +IV  LQ  G + VA  GDG+ND+PAL 
Sbjct: 638 TGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPALK 696

Query: 833 EADLGISISS-GTDIAIEAADIVILDSD 859
            AD+G+++   GTD+A EA+D+V+ D D
Sbjct: 697 LADIGVAMGHMGTDVAKEASDMVLTDDD 724

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 111/266 (41%), Gaps = 45/266 (16%)

Query: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN- 449
           +SE S  +  L  L P+SC ++   G+   +    L P D+V    G +IPAD  +I + 
Sbjct: 143 RSEKS--LEALHKLVPASCHLIR-FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIEST 199

Query: 450 ETEVDESLITGESMLVEK-------IVGSQVIGG--------------SVNGPGHFYFRA 488
           +  +DES +TGE+  V K          S V GG              ++   GH     
Sbjct: 200 DLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIV 259

Query: 489 IRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAG--IFVPFVISLSAITFITWMLVSYT 546
           +  G+ T    +   M   +  K P+Q   D +     +V FV  LS I F+  ++    
Sbjct: 260 VATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFV--LSGIIFLLGVI---- 313

Query: 547 MKTPPLIFNSENGKFFMCM-QMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGG 605
                       G+ ++ M Q+S+S+ + A P  L +     + +G    A+   +++  
Sbjct: 314 -----------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRL 362

Query: 606 DVLEKCSALQTFLFDKTGTLTTGRMS 631
             +E   ++     DKTGTLT   M+
Sbjct: 363 PSVETLGSVNVICSDKTGTLTANHMT 388

>Scas_707.48*
          Length = 741

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 98/204 (48%), Gaps = 36/204 (17%)

Query: 717 FPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDA 776
           F   +L D + + LTE  V  D    G   ++D  +      +E L   G+   M+TGD+
Sbjct: 543 FAKTTLPD-SPTLLTEESVG-DLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDS 600

Query: 777 HQSALKVAQQLGISAND---------------------------VFSEVTPEQKRDIVIQ 809
             +A+ +A+Q+GI   D                           +F+  TPE K +IV  
Sbjct: 601 ENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATPEHKLNIVRA 660

Query: 810 LQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSDNKNNSLKGL 868
           L+  G + VA  GDG+ND+PAL  AD+G+S+   GTD+A EA+D+V+ D D        +
Sbjct: 661 LRKRG-DVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDD-----FSTI 714

Query: 869 VYALDIARKTFYRVKLNFFWAVCY 892
           + A++  +  F  ++    + +C+
Sbjct: 715 LTAIEEGKGIFNNIQNFLTFQLCW 738

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 104/264 (39%), Gaps = 41/264 (15%)

Query: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN- 449
           +SE S  +  L  L P+ C ++   G    +    L P D+V    G +IPAD  +I   
Sbjct: 137 RSEKS--LEALNKLVPAECHLIRC-GQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAV 193

Query: 450 ETEVDESLITGESMLVEKIVGSQVIGGSVNG----------------------PGHFYFR 487
           +  +DES +TGE+  V K    +V   S N                        GH    
Sbjct: 194 DLSIDESNLTGENEPVHK-SAKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKGI 252

Query: 488 AIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTM 547
            + +G++T    I   +   +  K P+Q   DK+          LS  +FI   L+    
Sbjct: 253 VVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGK-------DLSLFSFIVIGLIC--- 302

Query: 548 KTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDV 607
               L+   +   +    Q+S+S+ + A P  L +     + +G    A    +++    
Sbjct: 303 ----LVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS 358

Query: 608 LEKCSALQTFLFDKTGTLTTGRMS 631
           +E   ++     DKTGTLT+  M+
Sbjct: 359 VETLGSVNVICSDKTGTLTSNHMT 382

>Kwal_23.3160
          Length = 1100

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 130/300 (43%), Gaps = 52/300 (17%)

Query: 373 AVMLLTFISLGKLLENKAKSETSTAMSKLISL-TPSSCSIVLPDGSTREISVELLQPNDI 431
           A ++   +++G   E KA    S  M+ L SL TPS+   V+ DG+   I  + L P D+
Sbjct: 104 AFVVFINVAIGSYQEYKA----SKTMNSLKSLSTPSAH--VIRDGNDETIPSKQLVPGDL 157

Query: 432 VEVVPGMKIPADGVVIR-NETEVDESLITGESMLVEKIVGSQVIGGSVNGP--------- 481
             V  G  +PAD  +I     E DE+L+TGES+ + K   SQV   + + P         
Sbjct: 158 CVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAK-EASQVYPATEDTPVGDRLNLAF 216

Query: 482 -------GHFYFRAIRVGEDTKLANIIATMK--KAQLSKAPIQKYADKMAGIFV------ 526
                  G      ++ G +T++  I  ++K   + +SK   + +    AGI +      
Sbjct: 217 ASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWAN-AGITLAATIGS 275

Query: 527 --------PFVISLSAIT----FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIV 574
                   P    LS +     FI  +     M T   + N E   + +C+ +S+     
Sbjct: 276 FLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIYAICVAVSM----- 330

Query: 575 ACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVEN 634
             P +L +     + VG  + A+  V+++  D LE   A+     DKTGTLT G+M V+ 
Sbjct: 331 -IPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQ 389

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 35/161 (21%)

Query: 734 YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAND 793
           +V  D    G   I D  +++    V+     GI   M+TGD   +A  +AQ++GI   +
Sbjct: 640 FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRN 699

Query: 794 V-----------------FSEVTPE-----------------QKRDIVIQLQNNGTERVA 819
           +                 F ++T E                 Q +  +I   +   +  A
Sbjct: 700 LYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKVRMIDALHRREKFCA 759

Query: 820 FVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVILDSD 859
             GDG+NDSP+L +A++GI++  +G+D+A +A+DIV+ D +
Sbjct: 760 MTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDN 800

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 70/144 (48%), Gaps = 32/144 (22%)

Query: 747 ISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGI----SAND--------- 793
           I D ++E+    V   Q  G+   MVTGD   +A  +A+  GI    S ND         
Sbjct: 691 IQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLNDSACAMEGPA 750

Query: 794 -----------------VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADL 836
                            V +  +PE K+ +V  L+  G E VA  GDG ND+PAL  AD+
Sbjct: 751 FRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMG-EVVAVTGDGTNDAPALKLADV 809

Query: 837 GISIS-SGTDIAIEAADIVILDSD 859
           G S+  +GT++A EA+DI+++  D
Sbjct: 810 GFSMGITGTEVAREASDIILMTDD 833

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 117/271 (43%), Gaps = 59/271 (21%)

Query: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIV- 469
           +V+ D +   IS+  L   D++++  G  +PAD V++R E E DES +TGES  ++K+  
Sbjct: 160 VVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLPL 219

Query: 470 ----------GSQVIGG-SVNG----------PGHFYFRAIR------------VGEDTK 496
                     G + IG  S +G          P        R            VG ++ 
Sbjct: 220 ADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSV 279

Query: 497 LANIIATMKKAQLSKAPIQ----KYADKMAGIFVPFVISLSAITFITWMLVSYTMKT--- 549
               +A++K+      P+Q    +  D ++       I+L  + F  ++  SY + +   
Sbjct: 280 HGKTMASLKEDS-EDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYL--SYILPSGGK 336

Query: 550 ----PPLIFNSENGKFFMCMQM-SISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKG 604
               PP    +E G  FM + + +I+VI+VA P  L LA   A+   T      G L++ 
Sbjct: 337 YHDLPP----AEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVR- 391

Query: 605 GDVLEKCSALQT---FLFDKTGTLTTGRMSV 632
             VL  C  + +      DKTGTLT   M+V
Sbjct: 392 --VLRSCETMGSATAVCSDKTGTLTENIMTV 420

>Kwal_47.17547
          Length = 1240

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 86/178 (48%), Gaps = 39/178 (21%)

Query: 716 LFPDE-SLSDIASSTLTE--SYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           LF DE S SD  S    E  S + +DG +VG   I D +++     VE  Q  G+   MV
Sbjct: 693 LFGDEVSRSDSVSEPAQELVSPMVLDG-IVG---IQDPLRKGVRKSVEQCQKAGVTVRMV 748

Query: 773 TGDAHQSALKVAQQLGISAND------------------------------VFSEVTPEQ 802
           TGD   +A  +A++  I + +                              V +  +PE 
Sbjct: 749 TGDNILTATAIAKKCSILSEEQAENPESSMEGPRFRKLSNKERVRILPNLRVLARSSPED 808

Query: 803 KRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVILDSD 859
           KR +V  L+  G + VA  GDG ND+PAL  AD+G S+  +GT++A EA+DI+++  D
Sbjct: 809 KRILVETLKKMG-DVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDD 865

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 112/260 (43%), Gaps = 43/260 (16%)

Query: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLV----- 465
           IVL +G    IS+  +   DI+ +  G  +PAD ++++   E DES +TGES  +     
Sbjct: 189 IVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKGSCECDESALTGESATIKKAAI 248

Query: 466 ------------------------EKIVGSQVIGGS--VNGPGHFYFRAI--RVGEDTKL 497
                                   EK+    +I GS  ++G G    RA+   VG ++  
Sbjct: 249 DVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLG----RAVVTSVGVNSMH 304

Query: 498 ANIIATMKKAQLSKAPIQKYADKMAG-IFVPFVISLSAITFITWMLVSYTMKTPPLIFN- 555
              +  + K +    P+Q+  D +A  I V    +   + FI +M     +K    + + 
Sbjct: 305 GRTLMAL-KVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDL 363

Query: 556 --SENGKFFMCMQM-SISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLEKCS 612
             ++ G  FM + +  I+VI+VA P  L LA   A+   T   A  G L++     E   
Sbjct: 364 TPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMG 423

Query: 613 ALQTFLFDKTGTLTTGRMSV 632
           +      DKTGTLT  RM+V
Sbjct: 424 SATAVCSDKTGTLTENRMTV 443

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 128/288 (44%), Gaps = 56/288 (19%)

Query: 382 LGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIP 441
           +G + E KA    S  M+ L +L+ S  + V+ +G++  +    + P D+V V  G  IP
Sbjct: 103 IGLIQEYKA----SKTMNALRALS-SPNAHVIRNGNSEVVDSTDVVPGDLVVVKVGDTIP 157

Query: 442 AD-GVVIRNETEVDESLITGESMLVEK-------------------IVGSQVIGGSVNGP 481
           AD  +V +   E DE+L+TGES+ V K                      S V+ G   G 
Sbjct: 158 ADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGI 217

Query: 482 GHFYFRAIRVGEDTKLANIIATMKKAQ--LSKAPIQKY-------ADKMAGIFV------ 526
                 AI+ G +T++  I  +++     +S+ P + +         +  G F+      
Sbjct: 218 ------AIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGT 271

Query: 527 PFVISLSAIT-FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVAC---PCALGL 582
           P    LS +   + W+ V + +    ++  S+  KF +   ++I  + VA    P +L +
Sbjct: 272 PLHRKLSKLAVLLFWIAVVFAI----VVMASQ--KFDVDRGVAIYAVCVALSMIPSSLVV 325

Query: 583 AAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630
                + VG  V AS  V+I+  D LE   A+     DKTGTLT G+M
Sbjct: 326 VLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM 373

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 88/207 (42%), Gaps = 46/207 (22%)

Query: 694 ISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTE-----SYVSIDGSLVGKFEIS 748
           I  NI   ++  +  +   NK  +P    SD+    L +      Y     + +G   I 
Sbjct: 588 IKENIDSMSSEGLRVLAFANKS-YPK---SDVNEEKLQKILKERDYAETGLTFLGLIGIY 643

Query: 749 DRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVF------------- 795
           D  +E+    V+     GI   M+TGD   +A  +AQ++GI   +++             
Sbjct: 644 DPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMT 703

Query: 796 ----------------------SEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVE 833
                                 +  +P+ K  ++  L     +  A  GDG+NDSP+L  
Sbjct: 704 GKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRR-EKFCAMTGDGVNDSPSLKM 762

Query: 834 ADLGISIS-SGTDIAIEAADIVILDSD 859
           A++GI++  +G+D+A +A+DIV+ D +
Sbjct: 763 ANVGIAMGINGSDVAKDASDIVLSDDN 789

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (46%), Gaps = 32/150 (21%)

Query: 741 LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEV-- 798
           L G   I D ++      V+  Q  G+   MVTGD   +A  +A+   I + D+ SE   
Sbjct: 730 LDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYS 789

Query: 799 ----------------------------TPEQKRDIVIQLQNNGTERVAFVGDGINDSPA 830
                                       +PE KR +V  L+  G + VA  GDG ND+PA
Sbjct: 790 AMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMG-DVVAVTGDGTNDAPA 848

Query: 831 LVEADLGISIS-SGTDIAIEAADIVILDSD 859
           L  AD+G S+  SGT++A EA+DI+++  D
Sbjct: 849 LKLADVGFSMGISGTEVAREASDIILMTDD 878

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 122/318 (38%), Gaps = 53/318 (16%)

Query: 373 AVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIV 432
           A+M+  F+ +     N  + E   A  KL     +   IV+ +     IS+  +   D++
Sbjct: 159 AIMIAVFVVVLVSAANDYQKELQFA--KLNKKKENRKIIVIRNDQEILISIHHVLVGDVI 216

Query: 433 EVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIG-----GSVNGPGHFYFR 487
            +  G  +PAD V+I  + E DES ITGES  ++K      +       S++   H + +
Sbjct: 217 SLQTGDVVPADCVMISGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSID--SHNHSK 274

Query: 488 AIRVGEDTKLANIIA--------------------------------TMKKAQLSKAPIQ 515
            + +G+  +  N IA                                T   A+    P+Q
Sbjct: 275 PLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQ 334

Query: 516 KYADKMA------GIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSI 569
            +  ++A      G     ++ L   T   + ++    +   L    +  KF      SI
Sbjct: 335 LHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSI 394

Query: 570 SVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQT---FLFDKTGTLT 626
           +VI+VA P  L LA   A+   T      G L++   VL  C  + +      DKTGTLT
Sbjct: 395 TVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVR---VLRSCETMGSATAVCSDKTGTLT 451

Query: 627 TGRMSVENFINYNSDVSD 644
              M+V      NS   D
Sbjct: 452 ENVMTVVRGFPGNSKFDD 469

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 94/207 (45%), Gaps = 46/207 (22%)

Query: 698 ITDKNTSKIHTITIGNK-------KLFPDESLSDIASSTLTESY------VSIDG-SLVG 743
           I D  +  + TI++ ++       K F D +   IAS  L   +      +S +G +L  
Sbjct: 697 IQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDA 756

Query: 744 KFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISA----ND------ 793
              + D ++E     VE  Q  G+   MVTGD   +A  +++   I +    ND      
Sbjct: 757 MVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECAME 816

Query: 794 --------------------VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVE 833
                               V +  +PE KR +V  L+  G E VA  GDG ND+PAL  
Sbjct: 817 GPTFRKLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMG-EVVAVTGDGTNDAPALKL 875

Query: 834 ADLGISIS-SGTDIAIEAADIVILDSD 859
           AD+G S+  SGT++A EA+DI+++  D
Sbjct: 876 ADVGFSMGISGTEVAREASDIILMTDD 902

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 106/262 (40%), Gaps = 46/262 (17%)

Query: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKI-- 468
           +V+ +G    IS+  L   D++ +  G  +PAD V+I    E DES +TGES  ++K+  
Sbjct: 242 VVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGSCECDESALTGESDTIKKVAL 301

Query: 469 ------------------VGSQVIGGSVNGP----GHFYFRAI------RVGEDTKLANI 500
                             +GS  +G  V  P    G      I       VGE++    I
Sbjct: 302 KPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRI 361

Query: 501 IATMKKAQLSKAPIQKYADKMA---------GIFVPFVISLSAITFITWMLVSYTMKT-P 550
           +  +K    S  P+Q+    +A            V F+I    I F+T++         P
Sbjct: 362 MMALKTESES-TPLQERLSNLADNISIYGCMAALVLFIILF--IRFLTYLPNGKKYHDLP 418

Query: 551 PLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLEK 610
           P     +  KF      +++VI+VA P  L LA   A+   T      G L++     E 
Sbjct: 419 PA---QKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACET 475

Query: 611 CSALQTFLFDKTGTLTTGRMSV 632
             +      DKTGTLT  RM+V
Sbjct: 476 MGSATAICSDKTGTLTENRMTV 497

>Scas_297.1
          Length = 800

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 2/94 (2%)

Query: 767 IKCCMVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGIN 826
           I  C + G   ++  K  +   +    V +  +PE KR +V  L+  G + VA  GDG N
Sbjct: 24  IPECAIEGPKFRTLTKQERIKMLPNLRVMARSSPEDKRLLVETLKGMG-DVVAVTGDGTN 82

Query: 827 DSPALVEADLGISIS-SGTDIAIEAADIVILDSD 859
           D+PAL  AD+G S+  SGT++A EA+DI+++  D
Sbjct: 83  DAPALKLADVGFSMGISGTEVAREASDIILMTDD 116

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKI 468
           IV+ +      S+  L   DI+ +  G  IPADGV++  + EVDES ITGES  ++K+
Sbjct: 601 IVIRNSQELLTSIHNLLVGDIITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKKV 658

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 78/178 (43%), Gaps = 37/178 (20%)

Query: 718 PDESLSD--IASSTLTESYVSIDGS---LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           PD  L D  + ++T   S ++ + S   L G   I D ++      V+  Q  G+   M+
Sbjct: 678 PDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMI 737

Query: 773 TGDAHQSALKVAQQLGISAND------------------------------VFSEVTPEQ 802
           TGD   +   +A+  GI +                                V +  +PE 
Sbjct: 738 TGDNITTGRAIARACGILSESEYADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPED 797

Query: 803 KRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVILDSD 859
           KR I + +     E VA  GDG ND+PAL  AD+G S+  SGT +A EA+DI+++  D
Sbjct: 798 KR-IFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDD 854

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 112/265 (42%), Gaps = 51/265 (19%)

Query: 411 IVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKI-- 468
           +V+ +G    ISV  L   D++ +  G  +P D +++  + E DES ITGES  ++K+  
Sbjct: 186 VVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGITGESDTIKKVSL 245

Query: 469 ------------------VGSQ-----------VIGGS--VNGPGHFYFRAIRVGEDTKL 497
                             +GS            +I GS  ++G GH    A  VG  +  
Sbjct: 246 AMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTA--VGPHSVH 303

Query: 498 ANIIATMKKAQLSKAPIQKYADKMA---------GIFVPFVISLSAITFITWMLVSYTMK 548
             ++  + K++    P+Q+  + +A           F+ FV+    + F++++       
Sbjct: 304 GKMMLAL-KSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLF--LRFLSYLPKGRLYH 360

Query: 549 TPPLIFNSENGKFFM-CMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDV 607
             P   ++  G  FM     +++VI+VA P  L LA   A+   T      G L++    
Sbjct: 361 DLP---SARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRA 417

Query: 608 LEKCSALQTFLFDKTGTLTTGRMSV 632
            E   +  T   DKTGTLT  +M V
Sbjct: 418 CETMGSATTVCSDKTGTLTQNKMVV 442

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 46/284 (16%)

Query: 382 LGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIP 441
           +G + E KA    +  M+ L +L+ S  + V+ +G +  I+ + + P DI  V  G  IP
Sbjct: 107 IGLVQEYKA----TKTMNSLKNLS-SPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIP 161

Query: 442 ADGVVIRNET-EVDESLITGESMLVEK----IVGSQ---VIGGSVN--------GPGHFY 485
           AD  +I  +  + DESL+TGES+ V K    + G +    +G  +N          G   
Sbjct: 162 ADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAK 221

Query: 486 FRAIRVGEDTKLANIIATMK--KAQLSKAPIQKY-------ADKMAGIFV------PFVI 530
              I+   ++++  I  +++     +S+ P + +         K+ G F+      P   
Sbjct: 222 GIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR 281

Query: 531 SLSAIT-FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVAC---PCALGLAAPT 586
            LS +   + W+ V + +    ++  S+  KF +  +++I  I VA    P +L +    
Sbjct: 282 KLSKLAVLLFWIAVLFAI----IVMASQ--KFDVDKRVAIYAICVALSMIPSSLVVVLTI 335

Query: 587 AIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630
            + VG  V  S  V+++  D LE   A+     DKTGTLT G+M
Sbjct: 336 TMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 81/183 (44%), Gaps = 39/183 (21%)

Query: 715 KLFPDESLSDIASSTLTESYVSIDGSLV--GKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           K F  + ++D     +T +  + +  LV  G   I D  + +    V+     GI   M+
Sbjct: 613 KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHML 672

Query: 773 TGDAHQSALKVAQQLGISANDVF-----------------------------------SE 797
           TGD   +A  +AQ++GI   +++                                   + 
Sbjct: 673 TGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIAR 732

Query: 798 VTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVIL 856
            +P+ K  ++  L     +  A  GDG+NDSP+L  A++GI++  +G+D++ EA+DIV+ 
Sbjct: 733 CSPQTKVRMIEALHRR-KKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 857 DSD 859
           D +
Sbjct: 792 DDN 794

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 46/284 (16%)

Query: 382 LGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIP 441
           +G + E KA    +  M+ L +L+ S  + V+ +G +  I+ + + P DI  V  G  IP
Sbjct: 107 IGLVQEYKA----TKTMNSLKNLS-SPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIP 161

Query: 442 ADGVVIRNET-EVDESLITGESMLVEK----IVGSQ---VIGGSVN--------GPGHFY 485
           AD  +I  +  + DESL+TGES+ V K    + G +    +G  +N          G   
Sbjct: 162 ADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAK 221

Query: 486 FRAIRVGEDTKLANIIATMK--KAQLSKAPIQKY-------ADKMAGIFV------PFVI 530
              I+   ++++  I  +++     +S+ P + +         K+ G F+      P   
Sbjct: 222 GIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR 281

Query: 531 SLSAIT-FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVAC---PCALGLAAPT 586
            LS +   + W+ V + +    ++  S+  KF +  +++I  I VA    P +L +    
Sbjct: 282 KLSKLAVLLFWIAVLFAI----IVMASQ--KFDVDKRVAIYAICVALSMIPSSLVVVLTI 335

Query: 587 AIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630
            + VG  V  S  V+++  D LE   A+     DKTGTLT G+M
Sbjct: 336 TMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 80/183 (43%), Gaps = 39/183 (21%)

Query: 715 KLFPDESLSDIASSTLTESYVSIDGSLV--GKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           K F  + ++D     +T +  + +  LV  G   I D  + +    V+     GI   M+
Sbjct: 613 KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHML 672

Query: 773 TGDAHQSALKVAQQLGISANDVF-----------------------------------SE 797
           TGD   +A  +AQ++GI   +++                                   + 
Sbjct: 673 TGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIAR 732

Query: 798 VTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVIL 856
            +P+ K  ++  L     +     GDG+NDSP+L  A++GI++  +G+D++ EA+DIV+ 
Sbjct: 733 CSPQTKVRMIEALHRR-KKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 857 DSD 859
           D +
Sbjct: 792 DDN 794

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 130/284 (45%), Gaps = 46/284 (16%)

Query: 382 LGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIP 441
           +G + E KA    +  M+ L +L+ S  + V+ +G +  I+ + + P DI  V  G  IP
Sbjct: 107 IGLVQEYKA----TKTMNSLKNLS-SPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIP 161

Query: 442 ADGVVIRNET-EVDESLITGESMLVEK----IVGSQ---VIGGSVN--------GPGHFY 485
           AD  +I  +  + DESL+TGES+ V K    + G +    +G  +N          G   
Sbjct: 162 ADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAK 221

Query: 486 FRAIRVGEDTKLANIIATMK--KAQLSKAPIQKY-------ADKMAGIFV------PFVI 530
              I+   ++++  I  +++     +S+ P + +         K+ G F+      P   
Sbjct: 222 GIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR 281

Query: 531 SLSAIT-FITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVAC---PCALGLAAPT 586
            LS +   + W+ V + +    ++  S+  KF +  +++I  I VA    P +L +    
Sbjct: 282 KLSKLAVLLFWIAVLFAI----IVMASQ--KFDVDKRVAIYAICVALSMIPSSLVVVLTI 335

Query: 587 AIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630
            + VG  V  S  V+++  D LE   A+     DKTGTLT G+M
Sbjct: 336 TMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 81/183 (44%), Gaps = 39/183 (21%)

Query: 715 KLFPDESLSDIASSTLTESYVSIDGSLV--GKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           K F  + ++D     +T +  + +  LV  G   I D  + +    V+     GI   M+
Sbjct: 613 KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHML 672

Query: 773 TGDAHQSALKVAQQLGISANDVF-----------------------------------SE 797
           TGD   +A  +AQ++GI   +++                                   + 
Sbjct: 673 TGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIAR 732

Query: 798 VTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVIL 856
            +P+ K  ++  L     +  A  GDG+NDSP+L  A++GI++  +G+D++ EA+DIV+ 
Sbjct: 733 CSPQTKVRMIEALHRR-KKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 857 DSD 859
           D +
Sbjct: 792 DDN 794

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 83/182 (45%), Gaps = 36/182 (19%)

Query: 714 KKLFPDESLSDIASSTLTES-YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           KK F +   +      L E  +V    + +G   I D  ++++   V+     GI   M+
Sbjct: 602 KKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHML 661

Query: 773 TGDAHQSALKVAQQLGISANDVFS---------------------------EVTP----- 800
           TGD   +A  +AQ++GI  ++++                             V P     
Sbjct: 662 TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIAR 721

Query: 801 --EQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVILD 857
              Q +  +I+  +  ++  A  GDG+NDSP+L  A++GI++  +G+D+A +A+DIV+ D
Sbjct: 722 CAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSD 781

Query: 858 SD 859
            +
Sbjct: 782 DN 783

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 111/270 (41%), Gaps = 42/270 (15%)

Query: 395 STAMSKLISL-TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN-ETE 452
           S  M+ L SL TPS+   V+ DG+   I  + L P DI  +  G  +PAD  ++ +   E
Sbjct: 118 SKTMNSLKSLSTPSAH--VIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLE 175

Query: 453 VDESLITGESMLVEK----------IVGSQV---IGGSVNGPGHFYFRAIRVGEDTKLAN 499
            DE+L+TGES+ V K           VG ++      S    G      I+   +T++  
Sbjct: 176 TDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGK 235

Query: 500 IIATMKKAQ--LSKAPIQKYADKM-------------AGIFVPFVISLSAITFI----TW 540
           I  ++K     +SK   + +   +               +  P    LS +  +      
Sbjct: 236 IAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAV 295

Query: 541 MLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGV 600
           +     M T     N +   + +C+ +S+       P +L +     +  G  V A+  V
Sbjct: 296 IFAIVVMGTQKYRVNKQVAIYAICVAISM------IPSSLVVVLTITMSAGAKVMATRNV 349

Query: 601 LIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630
           +++  D LE   A+     DKTGTLT G+M
Sbjct: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKM 379

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 106/261 (40%), Gaps = 45/261 (17%)

Query: 405 TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN-ETEVDESLITGESM 463
           TPS+   V+ +G    ++   + P DIV+V  G  +PAD  ++     E DE+L+TGE++
Sbjct: 131 TPSAR--VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEAL 188

Query: 464 LVEK----------IVGSQV---IGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQ-- 508
            V K           VG ++      S    G      +R G  +++  I  +++  Q  
Sbjct: 189 PVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSL 248

Query: 509 ---------------LSKAPIQKYADKMAGIFVPFVISLSAITFITW----MLVSYTMKT 549
                            KA +  +     G   P    L+ +  I +    +     M T
Sbjct: 249 ISRDENKSGLQNTVLTVKASVGSFLGTNVG--TPLHRKLAKLALILFAIAVLFALIVMAT 306

Query: 550 PPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLE 609
              I N E   + +C+ +S+       P +L +     +  G  V ++  V+++  D LE
Sbjct: 307 QKFIVNREVAIYAICVALSM------IPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLE 360

Query: 610 KCSALQTFLFDKTGTLTTGRM 630
              A+     DKTGTLT G+M
Sbjct: 361 ALGAVNDICSDKTGTLTQGKM 381

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 37/202 (18%)

Query: 694 ISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKE 753
           I  N+   +   +  +    K +  +E+ S     T    +V  D    G   I D  + 
Sbjct: 589 IQKNVDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRV 648

Query: 754 DAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVF------------------ 795
           +    V+     GI   M+TGD   +A  +AQ++GI  ++++                  
Sbjct: 649 ETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFD 708

Query: 796 -----------------SEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGI 838
                            +   P+ K  ++  L     +  A  GDG+NDSP+L +A++GI
Sbjct: 709 SLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVGI 767

Query: 839 SIS-SGTDIAIEAADIVILDSD 859
           ++  +G+D+A +A+DIV+ D +
Sbjct: 768 AMGINGSDVAKDASDIVLSDDN 789

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 80/183 (43%), Gaps = 38/183 (20%)

Query: 714 KKLFPDESLSDIASSTLTES-YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772
           KK F +   +      L E  +V  + + +G   I D  + ++   V+     GI   M+
Sbjct: 602 KKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHML 661

Query: 773 TGDAHQSALKVAQQLGISANDVF-----------------------------------SE 797
           TGD   +A  +AQ++GI  ++++                                   + 
Sbjct: 662 TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIAR 721

Query: 798 VTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVIL 856
             P+ K  ++  L        A  GDG+NDSP+L  A++GI++  +G+D+A +A+DIV+ 
Sbjct: 722 CAPQTKVRMIEALHRR-NRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 857 DSD 859
           D +
Sbjct: 781 DDN 783

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 109/269 (40%), Gaps = 40/269 (14%)

Query: 395 STAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN-ETEV 453
           S  M+ L SL+  S  ++   G+   I  + L P DI  +  G  +PAD  +      E 
Sbjct: 118 SKTMNSLKSLSTPSAHVIRA-GNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLET 176

Query: 454 DESLITGESMLVEKIVGS-----QVIGGSVN--------GPGHFYFRAIRVGEDTKLANI 500
           DE+L+TGES+ V K  G        +G  +N          G      I+   +T++  I
Sbjct: 177 DEALLTGESLPVAKSHGEVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKI 236

Query: 501 IATMKK--AQLSKAPIQKYADKM-------AGIFV------PFVISLSAITFI----TWM 541
             ++K   + +S+   + +   +        G F+      P    LS +  +      +
Sbjct: 237 AKSLKSEASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVI 296

Query: 542 LVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVL 601
                M T     N +   + +C+ +S+       P +L +     +  G  V A+  V+
Sbjct: 297 FAIVVMGTQKFKVNKQVAIYAICVALSM------IPSSLVVVLTITMSAGAKVMATRHVI 350

Query: 602 IKGGDVLEKCSALQTFLFDKTGTLTTGRM 630
           I+  D LE   A+     DKTGTLT G+M
Sbjct: 351 IRKLDSLEALGAVNDICSDKTGTLTQGKM 379

>Scas_569.0d
          Length = 468

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 18/83 (21%)

Query: 795 FSEVTPEQKRDI-----------------VIQLQNNGTERVAFVGDGINDSPALVEADLG 837
           F E+TPEQ  ++                 +I+  +   +  A  GDG+NDSP+L  A++G
Sbjct: 87  FDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSLKMANVG 146

Query: 838 ISIS-SGTDIAIEAADIVILDSD 859
           I++  +G+D+A +A+DIV+ D +
Sbjct: 147 IAMGINGSDVAKDASDIVLSDDN 169

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)

Query: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843
            +++ ++P++K ++V +LQ+ G + V F GDG ND  AL  AD+GIS+S  
Sbjct: 1136 IYARMSPDEKHELVERLQSIGYQ-VGFCGDGANDCGALKAADIGISLSEA 1184

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 123/303 (40%), Gaps = 66/303 (21%)

Query: 370 FDTAVMLLTFIS-LGKLLENKAKSETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQ 427
           + T + +++ +S +  L+E K  SE  + +S+        C + V  DG   ++    L 
Sbjct: 505 YATCIFIISVLSVIDTLVETKQSSERLSELSQFY------CDVRVYRDGFWSQVPSSDLV 558

Query: 428 PNDIVEVV-PGMKI-PADGVVIRNETEVDESLITGESMLVEKIVG--------------- 470
           P DI E+  P + + P D ++I  +  V+ES++TGES+ V K+                 
Sbjct: 559 PGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDT 618

Query: 471 --SQVIGGS--VNGPGHFYFRAI-----------RVGEDTKLANIIATMKKAQLSKAPIQ 515
             S  +  S   NG      RA            R G  T   +++ +M   + +    +
Sbjct: 619 QLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTG--FK 676

Query: 516 KYADKMAGIFVPFVISL--SAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVII 573
            Y D    I    +I+L   A++FI ++ +    +T             M ++ ++ +I 
Sbjct: 677 FYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRT-------------MILR-ALDIIT 722

Query: 574 VACPCALGLAAPTAIMVGTGVGASH----GVLIKGGDVLEKCSALQTFLFDKTGTLTTGR 629
           V  P AL    P ++ +GTG   +     G+       +     +    FDKTGTLT   
Sbjct: 723 VVVPPAL----PASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDG 778

Query: 630 MSV 632
           + V
Sbjct: 779 LDV 781

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
           cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 114/301 (37%), Gaps = 70/301 (23%)

Query: 374 VMLLTFIS-LGKLLENKAKSETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDI 431
           + L++ +S L  L+E K  S T   MS        +C + VL +G    I    L P DI
Sbjct: 509 IFLISLLSILDTLIETKKISRTLAEMSHF------NCEVRVLREGFWSSIHSSELVPGDI 562

Query: 432 VEVV-PGMKI-PADGVVIRNETEVDESLITGESMLVEKIVGSQ----------------- 472
            E+  P + + P D +++  +  V+ES++TGES+ V K   S+                 
Sbjct: 563 YEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQIST 622

Query: 473 ------VIGGSV-------NGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAPIQ---- 515
                 +  G+        NG       A+R G  T   ++I +M   + S         
Sbjct: 623 FLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSF 682

Query: 516 KYADKMAGIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVA 575
           KY   MA I   F  S+S I FI   L   TM                 +  ++ +I + 
Sbjct: 683 KYIGFMA-IIAFFGFSISCINFIKLGLDKRTM-----------------ILRALDIITIV 724

Query: 576 CPCALGLAAPTAIMVGTGVGASH----GVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMS 631
            P AL    P  + +GT    +     G+       +     +    FDKTGTLT   + 
Sbjct: 725 VPPAL----PATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLD 780

Query: 632 V 632
           V
Sbjct: 781 V 781

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843
            +F+ ++P++K ++V QLQ      V F GDG ND  AL  AD+GIS+S  
Sbjct: 1139 IFARMSPDEKHELVEQLQKMDYT-VGFCGDGANDCGALKAADVGISLSEA 1187

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 81/211 (38%), Gaps = 73/211 (34%)

Query: 703 TSKIHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEI 747
           T  + T+ IG KKL           + + SL+    ++    +   ++  D  L+G   +
Sbjct: 686 TEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGV 745

Query: 748 SDRVKEDAHFVVEYLQNLGIKCCMVTGDA------------------------------- 776
            D++++D    +E L+N GIK  M+TGD                                
Sbjct: 746 EDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEG 805

Query: 777 ---HQSALKVAQQ---------LGISAN---DVFSEV------------TPEQKRDIVIQ 809
              H   L+V Q          LG+      D F ++            TP+QK D+ + 
Sbjct: 806 ALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVF 865

Query: 810 LQNNGTERVAFVGDGINDSPALVEADLGISI 840
           ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 866 IRQATGKRVCCIGDGGNDVSMIQCADVGVGI 896

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843
            +++ ++P++K +++IQLQ      V F GDG ND  AL  AD+GIS+S  
Sbjct: 1159 IYARMSPDEKHELMIQLQKLDYT-VGFCGDGANDCGALKAADVGISLSEA 1207

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 112/305 (36%), Gaps = 70/305 (22%)

Query: 370 FDTAVMLLTFISL-GKLLENKAKSETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQ 427
           +   + L++ +S+   L E K  S     MS         C + VL D     IS   L 
Sbjct: 517 YAACIFLISVLSIFDSLNEQKKVSRNLAEMSHF------HCDVRVLRDKFWTTISSSELV 570

Query: 428 PNDIVEVV-PGMKI-PADGVVIRNETEVDESLITGESMLVEKIV---------------- 469
           P DI EV  P + I P D +++ ++  V+ES++TGES+ V K                  
Sbjct: 571 PGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQST 630

Query: 470 -------------GSQVIGGSVNGPGHFYFRA--IRVGEDTKLANIIATMKKAQLSKAPI 514
                        G+ +I   +  PG     A  +R G  T   +++ +M   + +    
Sbjct: 631 QISSFVSKSFLYNGTNIIRARI-APGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKF 689

Query: 515 QKYADKMAG---IFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISV 571
            + + K  G   +   F   +S + FI   L   TM                 +  ++ +
Sbjct: 690 YRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTM-----------------ILRALDI 732

Query: 572 IIVACPCALGLAAPTAIMVGTGVGASH----GVLIKGGDVLEKCSALQTFLFDKTGTLTT 627
           I +  P AL    P  + +GT    S     G+       L     +    FDKTGTLT 
Sbjct: 733 ITIVVPPAL----PATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTE 788

Query: 628 GRMSV 632
             + V
Sbjct: 789 DGLDV 793

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 15/90 (16%)

Query: 706 IHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750
           + T+ IG KKL           + D SLS    D   S +   Y+  D  L+G   + D+
Sbjct: 692 LRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDK 751

Query: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780
           +++D    +E L+N GIK  M+TGD  ++A
Sbjct: 752 LQKDVKSSIELLRNAGIKIWMLTGDKVETA 781

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 753 EDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQ----LGISANDVFS-EVTPEQKRDIV 807
           E A   +EYL+     C ++ G++    LK  +Q    + +    V +   TP+QK D+ 
Sbjct: 807 EGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVA 866

Query: 808 IQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
           + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 867 LVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGI 899

>Kwal_26.9207
          Length = 1469

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 10/78 (12%)

Query: 772  VTGDAHQSALKVAQQLGIS-------ANDVFSEVTPEQKRDIVIQLQNNGTERV-AFVGD 823
            VTGD  +   K  + L  S        + +++ ++P++K ++V QLQ  G + V  F GD
Sbjct: 1127 VTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ--GLDYVVGFCGD 1184

Query: 824  GINDSPALVEADLGISIS 841
            G ND  AL  AD+G+S+S
Sbjct: 1185 GANDCGALKAADVGVSLS 1202

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 393 ETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMK-IPADGVVIRN 449
           ET     +L  ++ S C + V  DG   ++S   L P D+ E+  P +   P D +++  
Sbjct: 541 ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSG 600

Query: 450 ETEVDESLITGESMLVEKIVGS 471
           +  V+ES++TGES+ V KI  S
Sbjct: 601 DCIVNESMLTGESVPVSKIPAS 622

>Scas_665.30
          Length = 1439

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 794 VFSEVTPEQKRDIVIQLQN-NGTERVAFVGDGINDSPALVEADLGISISSG 843
           +++ ++P++K +++ QLQ  N T  V F GDG ND  AL  AD+GIS+S  
Sbjct: 929 IYARMSPDEKHELMEQLQRLNYT--VGFCGDGANDCGALKAADVGISLSEA 977

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 105/281 (37%), Gaps = 63/281 (22%)

Query: 393 ETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRN 449
           ET      L  ++  +C + V  D     ++   L P DI E+  P + + P D +++  
Sbjct: 311 ETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSG 370

Query: 450 ETEVDESLITGESMLVEKIVG-----------------SQVIGGSVNGPGHFYFRA-IRV 491
           +  V+ES++TGES+ V K                    S  +  S    G    RA I  
Sbjct: 371 DCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPY 430

Query: 492 GEDTKLANIIAT---MKKAQLSKAPI-------------QKYADKMAGIFVPFVISLSAI 535
           G+   LA ++ T     K  L ++ +              KY   MA I + F  S+S I
Sbjct: 431 GQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL-FGFSISCI 489

Query: 536 TFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVG 595
            FI   L   TM                 +  ++ +I +  P AL    P  + +GTG  
Sbjct: 490 QFIKIGLDKRTM-----------------ILRALDIITIVVPPAL----PATLTIGTGFA 528

Query: 596 ASH----GVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV 632
            S     G+       +     +    FDKTGTLT   + V
Sbjct: 529 LSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDV 569

>Scas_704.38
          Length = 1161

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 15/90 (16%)

Query: 706 IHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750
           + T+ +G KKL           + D SLS    D   + +   Y+  D  L+G   + D+
Sbjct: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761

Query: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780
           ++ D    +E L+N GIK  M+TGD  ++A
Sbjct: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETA 791

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 799 TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
           TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 868 TPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGI 909

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843
            +++ ++P++K ++V QLQ      V F GDG ND  AL  A++GIS+S  
Sbjct: 1126 IYARMSPDEKHELVEQLQKLDYN-VGFCGDGANDCGALKAANIGISLSEA 1174

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 393 ETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRN 449
           ET     KL  ++  +C + V  D    +++   L P D+ E+  P + + P D V+I  
Sbjct: 522 ETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISG 581

Query: 450 ETEVDESLITGESMLVEKIVGSQ 472
           +  V+ES++TGES+ V K   ++
Sbjct: 582 DCIVNESMLTGESVPVSKYAATE 604

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 794 VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTD 845
           +++ V+P QK  I+I L++ G + +   GDG ND  AL +A +GI++ +GT+
Sbjct: 786 IYARVSPSQKEFILITLKDMGYQTL-MCGDGTNDVGALKQAHVGIALLNGTE 836

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 772 VTGDAHQSALKVAQQLG--ISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSP 829
           VTG A + ALK   QL   I    +++ V+P QK  I+  L++ G + +   GDG ND  
Sbjct: 763 VTGHALE-ALKGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTL-MCGDGTNDVG 820

Query: 830 ALVEADLGISISSGTD 845
           AL +A +G+++ +GT+
Sbjct: 821 ALKQAHVGVALLNGTE 836

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGI 789
           +K DA   ++ L     +C M+TGD   +A+ VA+++GI
Sbjct: 673 LKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 15/90 (16%)

Query: 706 IHTITIGNKKLFP-----------DESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750
           + T+ IG KKL P           D SLS    D   S++ + ++  +  L+G   + D+
Sbjct: 684 LRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDK 743

Query: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780
           ++ D    +E L+N G+K  M+TGD  ++A
Sbjct: 744 LQNDVKSSIELLRNAGVKIWMLTGDKVETA 773

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 735 VSIDGSLVGKFEISDRV-----KEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQ--- 786
           VSI   L+ + +    V      E A   +EYL+     C ++ G++    L   +Q   
Sbjct: 776 VSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFF 835

Query: 787 -LGISANDVFS-EVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
            + +    V +   TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 836 DIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGI 891

>Kwal_23.5789
          Length = 1133

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 15/90 (16%)

Query: 706 IHTITIGNKKL-----------FPDESL----SDIASSTLTESYVSIDGSLVGKFEISDR 750
           + T+ IG K+L           + D SL     ++  S +   ++  D  ++G   + D+
Sbjct: 673 LRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDK 732

Query: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780
           ++ED    +E L+N GIK  M+TGD  ++A
Sbjct: 733 LQEDVKSSIELLRNAGIKIWMLTGDKVETA 762

>Scas_583.14*
          Length = 875

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 794 VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDIAIEAADI 853
           V++ V+P QK  I+  L+  G + +   GDG ND  AL +A +G+++ +GT+ ++ A   
Sbjct: 442 VYARVSPSQKEFILNNLKEMGYQTL-MCGDGTNDVGALKQAHVGVALLNGTEESMTAMAQ 500

Query: 854 VILDSDNKNNSLK 866
              D + K+  LK
Sbjct: 501 KRRDENMKSMYLK 513

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 772 VTGDAHQSALKVAQQLG--ISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSP 829
           VTG A Q  L    QL   I    V++ V+P QK  I+  L++ G + +   GDG ND  
Sbjct: 766 VTGHALQ-LLSGHSQLNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTL-MCGDGTNDVG 823

Query: 830 ALVEADLGISISSGTD 845
           AL +A +GI++ +GT+
Sbjct: 824 ALKQAHVGIALLNGTE 839

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 18/117 (15%)

Query: 706 IHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750
           + T+ I  KKL           + D SLS    D A + + + ++  +  L+G   + D+
Sbjct: 707 LRTLVIARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDK 766

Query: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA--LKVAQQLGISANDVFSEVTPEQKRD 805
           +++D    +E L+N G+K  M+TGD  ++A  + V+ +L IS       +T   +RD
Sbjct: 767 LQKDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKL-ISRGQYVHTITKLTRRD 822

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 799 TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
           TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 873 TPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGI 914

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 108/271 (39%), Gaps = 50/271 (18%)

Query: 599 GVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSVENFINYNSDVSDLHWKMISLCESIGE 658
           G L++GG +L        FL  K  ++T         IN   +  +  ++++++CE    
Sbjct: 638 GALVEGGALLG-----YKFLIRKPNSVTI-------LIN---EEEEREYQLLNICEFNST 682

Query: 659 HPVAKAIVNYADSHVN-----KSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGN 713
                AI  + D  +        S+    LS          + ++ D  T  + T+ +  
Sbjct: 683 RKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLAT 742

Query: 714 KKLFPDE------SLSDIASSTLTESYVSIDG---------SLVGKFEISDRVKEDAHFV 758
           K +  DE         D A++TL      +D          +L+G   I D+++E     
Sbjct: 743 KDIPEDEYNAWNKKYMD-AATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDT 801

Query: 759 VEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAND----VFSEVTPEQKRDIVIQ----- 809
           +  LQ  GIK  ++TGD  ++A+ +     + + D    + SE T E  R  + +     
Sbjct: 802 IRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAAL 861

Query: 810 ----LQNNGTERVAFVGDGINDSPALVEADL 836
               L  +    +A V DG + S AL EADL
Sbjct: 862 HEHSLSEHDMNTLALVIDGHSLSFAL-EADL 891

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 794 VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTD 845
           V++ V+P QK  ++  L++ G + +   GDG ND  AL +A +GI++ +GT+
Sbjct: 788 VYARVSPSQKEFLLNTLKDMGYQTL-MCGDGTNDVGALKQAHVGIALLNGTE 838

>Scas_89.1
          Length = 271

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 799 TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
           TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 153 TPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGI 194

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 714 KKLFPDESLS----DIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKC 769
           +K + D SLS    D   S++ + ++  +  L+G   + D+++ D    +E L+N G+K 
Sbjct: 6   EKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKI 65

Query: 770 CMVTGDAHQSA 780
            M+TGD  ++A
Sbjct: 66  WMLTGDKVETA 76

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 17/91 (18%)

Query: 706 IHTITIGNKKL-------FPDESLSDIASSTLTE---------SYVSIDGSLVGKFEISD 749
           + T+ IG KKL       F  E   ++++S              Y+  D  L+G   + D
Sbjct: 685 LRTLVIGRKKLTKKIYEQFKKE-YEEVSASMYNREQEMANTISKYLEHDLELLGLTGVED 743

Query: 750 RVKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780
           ++++D    +E L+N GIK  M+TGD  ++A
Sbjct: 744 KLQKDVKSSIELLRNAGIKIWMLTGDKVETA 774

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 753 EDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQ----LGISANDVFS-EVTPEQKRDIV 807
           E A   +EYL+     C ++ G++    LK  +Q    + +    V +   TP+QK D+ 
Sbjct: 800 EGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVA 859

Query: 808 IQLQNNGTERVAFVGDGINDSPALVEADLGISI 840
           + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 860 LIIRELTGKRVCCIGDGGNDVSMIQCADVGVGI 892

>Kwal_26.7070
          Length = 1315

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 55/113 (48%), Gaps = 12/113 (10%)

Query: 720 ESLSDIASSTLTESYVSIDGS---------LVGKFEISDRVKEDAHFVVEYLQNLGIKCC 770
           + + D AS+TL +    +D +         L+G   I D++++     +  LQ+ GIK  
Sbjct: 772 KDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVW 831

Query: 771 MVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823
           ++TGD  ++A+ +     + + D+   +  E+ ++     + N TE++  + D
Sbjct: 832 VLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEAT---RKNLTEKLKAISD 881

>Scas_669.3
          Length = 1638

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 738  DGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVA 784
            D  L+G   I D+++E     +E ++  GIK  M+TGD  ++A+ + 
Sbjct: 1053 DLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIG 1099

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 56/115 (48%), Gaps = 15/115 (13%)

Query: 683  LSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE-----SLSDIASSTLTESYVSI 737
            +SNEE ++ K +  +I   +T  + T+   +K +  ++     +    A ++L+E    I
Sbjct: 951  ISNEEYVLEKTLE-DIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKI 1009

Query: 738  DG---------SLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKV 783
            D           L+G   I D+++E     +E ++  GIK  M+TGD  ++A+ +
Sbjct: 1010 DEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINI 1064

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 797  EVTPEQKRDIVIQLQNNGTERVAF-VGDGINDSPALVEADLGISISSGTDI-AIEAADIV 854
              +P QK  +V  ++N     V   +GDG ND   +  AD+G+ I+    + A  +AD  
Sbjct: 1142 RASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYS 1201

Query: 855  I---------LDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIAMGLLA 905
            I         L    + N ++   + L     TFY+    +   + Y  + +     L  
Sbjct: 1202 IGQFRFILKLLLVHGRYNYIRTAKFIL----CTFYKELTFYLTQLIYQRYTMFSGTSLYE 1257

Query: 906  PWGITLH 912
            PW ++++
Sbjct: 1258 PWSLSMY 1264

>Kwal_23.3556
          Length = 1597

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 53/126 (42%), Gaps = 15/126 (11%)

Query: 797  EVTPEQKRDIVIQLQNNGTERVAF-VGDGINDSPALVEADLGISI--------SSGTDIA 847
              +P QK  +V  ++N   + V   +GDG ND   +  AD+G+ I        S  +D +
Sbjct: 1141 RASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYS 1200

Query: 848  IEAADIV--ILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIAMGLLA 905
            I     +  +L    + N ++   + L     TFY+  L +   + Y    +     L  
Sbjct: 1201 IAQFRFLLKLLLVHGRYNYVRTTKFVL----CTFYKELLFYLTQMIYQRHTMFSGTSLYE 1256

Query: 906  PWGITL 911
            PW +++
Sbjct: 1257 PWSLSM 1262

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 741  LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVA 784
            L+G   I D+++E     ++ ++  GIK  M+TGD  ++A+ + 
Sbjct: 1021 LLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIG 1064

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 735  VSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVA 784
            +  D +L+G   I D+++E     ++ L+  GIK  M+TGD  ++A+ + 
Sbjct: 996  IERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIG 1045

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%)

Query: 734  YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKV 783
            ++  D  L+G   I D+++E     ++ ++  GIK  M+TGD  ++A+ +
Sbjct: 994  HIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINI 1043

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 797  EVTPEQKRDIV--IQLQNNGTERVAFVGDGINDSPALVEADLGISI----------SSGT 844
              +P QK  IV  I+L+N     +A +GDG ND   +  AD+G+ I          SS  
Sbjct: 1121 RASPSQKALIVTNIRLKNKDLVTLA-IGDGANDIAMIQSADIGVGITGKEGLQASRSSDY 1179

Query: 845  DIAIEAADIVILDSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIAMGLL 904
             IA     + +L    + N ++   + L     TFY+  L +   + Y    +     L 
Sbjct: 1180 SIAQFRYLLKLLFVHGRYNYVRTSKFVL----CTFYKEVLFYLTQMIYQRQTMFSGTSLY 1235

Query: 905  APWGITL 911
             PW +++
Sbjct: 1236 EPWSLSM 1242

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 706 IHTITIGNKKLFPDESLSDIASSTLTESYVSIDGS---------LVGKFEISDRVKEDAH 756
           I + TI  K+      + + AS+T+ +    +D +          +G   I D+++E   
Sbjct: 762 IASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVP 821

Query: 757 FVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDV-FSEVTPEQKRDIVIQLQN 812
             + +LQ  G+K  ++TGD  ++A+ +     + + D+    V  E K D    LQ+
Sbjct: 822 ETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQS 878

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%)

Query: 741 LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEVTP 800
           L+G   I D++++     +  LQ  GIK  ++TGD  ++A+ +     + + D+   +  
Sbjct: 803 LIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIIN 862

Query: 801 EQKRD 805
           E+ RD
Sbjct: 863 EETRD 867

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 726  ASSTLTESYVSIDGS---------LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDA 776
            A ++LT+  + +D +         L+G   I D++++     +E ++  GIK  M+TGD 
Sbjct: 1058 AKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDK 1117

Query: 777  HQSALKVA 784
             ++A+ + 
Sbjct: 1118 RETAINIG 1125

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 53/128 (41%), Gaps = 19/128 (14%)

Query: 797  EVTPEQKRDIVIQLQNNGTERVAF-VGDGINDSPALVEADLGISISSGTDIAIEAADIVI 855
              +P QK  +V  ++N     V   +GDG ND   +  AD+G+ I+      ++A+ +  
Sbjct: 1202 RASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKE--GLQASRV-- 1257

Query: 856  LDSDNKNNSLKGLVYALDIARK------------TFYRVKLNFFWAVCYNTFMIPIAMGL 903
              SD      + L+  L +  +            TFY+    +F  + Y  + +     L
Sbjct: 1258 --SDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSL 1315

Query: 904  LAPWGITL 911
              PW +++
Sbjct: 1316 YEPWSLSM 1323

>Kwal_56.23530
          Length = 1287

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 459 TGESMLVEKIVG-----SQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQLSKAP 513
           TG+ + +EK+       S+VIGG      H +F+  + GE  K+  ++  +K  + ++ P
Sbjct: 448 TGKRLRIEKLDKLHLDVSRVIGGDSRL-SHKFFKRFKAGEAVKMEKMLVCVKSTKSTRGP 506

Query: 514 IQKYAD 519
           +  ++D
Sbjct: 507 LLHFSD 512

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
           complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 14/109 (12%)

Query: 741 LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAND----VFS 796
           L+G   I D++++     +  LQ  GIK  ++TGD  ++A+ +     + + D    + +
Sbjct: 799 LLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVN 858

Query: 797 EVTPEQKRDIVI---------QLQNNGTERVAFVGDGINDSPALVEADL 836
           E T E  R+ +I         Q+       +A V DG +   AL E DL
Sbjct: 859 EDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFAL-EPDL 906

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 51/129 (39%), Gaps = 20/129 (15%)

Query: 797  EVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDI-AIEAADIVI 855
             V+P QK  +V  ++      +  +GDG ND   +  A +G+ IS    + A  +AD  +
Sbjct: 924  RVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983

Query: 856  LDSDNKNNSLKGLVYA------LDIARKTFYRVKLNF------FWAVCYNTFMIPIAMGL 903
                 +   LK L+          I++   Y    N       FW V YN F       +
Sbjct: 984  ----GQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFS---GQSI 1036

Query: 904  LAPWGITLH 912
            +  W +T +
Sbjct: 1037 MESWTLTFY 1045

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 22/166 (13%)

Query: 687  EVLIGKGISCNITDKNTSKIHTITIGNK-KLF---PDESLSDIASSTLTESYVSIDGSLV 742
            E  I  G SCN+ +     +   T G+  K F   P E +  + S  L E Y ++ GS  
Sbjct: 994  ETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKE-YFNLTGSEE 1052

Query: 743  GKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSAL---KVAQQLGISANDVFS--- 796
              FE     K+D  F        G    ++ GDA + AL    + ++  +   +  +   
Sbjct: 1053 EIFE----AKKDHEFPK------GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLC 1102

Query: 797  -EVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS 841
              V+P QK  +V  ++++       +GDG ND   +  AD+GI I+
Sbjct: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 64/142 (45%), Gaps = 16/142 (11%)

Query: 657  GEHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKL 716
            G+ P A  I   ADS +  S +     SN E ++ K  + ++    T  + T+ I  ++L
Sbjct: 861  GDEPRALLICKGADSII-YSRLSRQSGSNSEAILEK-TALHLEQYATEGLRTLCIAQREL 918

Query: 717  FPDE-----SLSDIASSTLTES-------YVSIDGSLV--GKFEISDRVKEDAHFVVEYL 762
               E        DIA+++L            SI+  L+  G   I DR+++     +E L
Sbjct: 919  SWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELL 978

Query: 763  QNLGIKCCMVTGDAHQSALKVA 784
               GIK  ++TGD  ++A+ + 
Sbjct: 979  AEAGIKLWVLTGDKVETAINIG 1000

>Sklu_2345.1 YCR020C, Contig c2345 1258-1911
          Length = 217

 Score = 31.2 bits (69), Expect = 2.9,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 195 VISIDTSLQSEEATVIHDANEIG------NRDIIDCIEEMGFQTFISNTLDNSTQLSLLS 248
           +IS  TSL  EE ++I  A +IG      N    DC++ +  +   S +L   ++ SLLS
Sbjct: 54  LISKTTSLAPEEHSLITLAKKIGFFANDENTYFQDCLKHLDGKISDSTSLQKYSKESLLS 113

Query: 249 KTKEIQFWK 257
            +K I + K
Sbjct: 114 VSKYIDYLK 122

>Scas_576.8
          Length = 1591

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 658  EHPVAKAIVNYADSHVNKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLF 717
            + P A  I   ADS +  S +   + +N E L+ K  + ++    T  + T+ I  ++L 
Sbjct: 878  DEPRALLICKGADSII-YSRLGTKNGANSENLLEK-TALHLEQYATEGLRTLCIAQRELS 935

Query: 718  PDESLS-----DIASSTLTESYVSIDG---------SLVGKFEISDRVKEDAHFVVEYLQ 763
              E L      DIA++++T     ++          +L+G   I DR+++     +  L 
Sbjct: 936  WPEYLEWNKRYDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILA 995

Query: 764  NLGIKCCMVTGDAHQSALKVAQQLGISANDV 794
              GIK  ++TGD  ++A+ +     +  ND+
Sbjct: 996  QAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1026

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 86/231 (37%), Gaps = 35/231 (15%)

Query: 687  EVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYVSIDGSLVGKFE 746
            E  I  G SCN+ + +   +   T G   L   E   ++ +S L   Y+     L G   
Sbjct: 990  ETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNS-LISKYLREKFGLSGSEM 1048

Query: 747  ISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSAL---KVAQQLGISANDVFS----EVT 799
              D  K D  F        G    ++ GDA + AL    + ++  +   +  +     V+
Sbjct: 1049 ELDNAKGDHSFPK------GDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVS 1102

Query: 800  PEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVILDSD 859
            P QK  +V  ++N        +GDG ND   +  AD+GI I+       E     ++ SD
Sbjct: 1103 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAG------EEGRQAVMCSD 1156

Query: 860  NKNNSLKGLVYAL------------DIARKTFYR---VKLNFFWAVCYNTF 895
                  + L   L            ++  + FY+     L  FW   YN F
Sbjct: 1157 YAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNF 1207

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 59/124 (47%), Gaps = 15/124 (12%)

Query: 685  NEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDE-----SLSDIASSTLT--ESYVSI 737
            N+E L+ K  + ++    T  + T+ +  ++L   E     +  DIA+++LT  E  + I
Sbjct: 884  NDETLLEK-TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEI 942

Query: 738  -------DGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGIS 790
                   D  L+G   I DR+++     +  L   GIK  ++TGD  ++A+ +     + 
Sbjct: 943  VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 1002

Query: 791  ANDV 794
             ND+
Sbjct: 1003 NNDM 1006

>KLLA0A08580g 754857..756479 similar to sp|P25578 Saccharomyces
           cerevisiae YCL004w PEL1 phosphatidylglycerophosphate
           synthase singleton, start by similarity
          Length = 540

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 161 SVPSNEKRLCLKIFGMLSESDRA---DIESKVSELKGVISIDTSLQSEEATVIHDANEI 216
           S P N+KR CL I G  + + RA   DIE+    L     + T++Q+E   ++ +  E+
Sbjct: 454 SEPGNDKRPCLTIVGSSNYTRRAYSLDIETNAIVLTKDEQLKTAMQNEIDNLLKNTKEV 512

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,631,119
Number of extensions: 1120209
Number of successful extensions: 3658
Number of sequences better than 10.0: 92
Number of HSP's gapped: 3591
Number of HSP's successfully gapped: 178
Length of query: 960
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 849
Effective length of database: 12,753,511
Effective search space: 10827730839
Effective search space used: 10827730839
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)