Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F04862g31631113530.0
Kwal_26.81903241422712e-27
ABR054C3142592405e-23
CAGL0L01793g359801739e-14
Scas_625.7d3021381418e-10
YKL042W (SPC42)363611303e-08
Scas_711.45335551045e-05
ABR180W259694653.7
YJR049C (UTR1)53025654.1
YLR045C (STU2)88880627.9
AFR637W129680629.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F04862g
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...   525   0.0  
Kwal_26.8190                                                          108   2e-27
ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...    97   5e-23
CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...    71   9e-14
Scas_625.7d                                                            59   8e-10
YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...    55   3e-08
Scas_711.45                                                            45   5e-05
ABR180W [773] [Homologous to ScYLR454W - SH] complement(742456.....    30   3.7  
YJR049C (UTR1) [2943] chr10 complement(526798..528390) NAD kinas...    30   4.1  
YLR045C (STU2) [3462] chr12 complement(235038..237704) Component...    28   7.9  
AFR637W [3829] [Homologous to ScYNL250W (RAD50) - SH] complement...    28   9.3  

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/311 (85%), Positives = 266/311 (85%)

Query: 1   MIHNGSTPRRFVFGNNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV 60
           MIHNGSTPRRFVFGNNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV
Sbjct: 1   MIHNGSTPRRFVFGNNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV 60

Query: 61  LIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEY 120
           LIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEY
Sbjct: 61  LIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEY 120

Query: 121 LQIKKNNRHDENKIDDIYQKLELLTNLVNDAIHKQNNGEQREPSNFNSRIVXXXXXXXXX 180
           LQIKKNNRHDENKIDDIYQKLELLTNLVNDAIHKQNNGEQREPSNFNSRIV         
Sbjct: 121 LQIKKNNRHDENKIDDIYQKLELLTNLVNDAIHKQNNGEQREPSNFNSRIVSDDDIIISE 180

Query: 181 XQEFXXXXXXXXXXXXXXXXXXXXXXXXXSLNKELADLMDELSMNSSPSANQNIDPYSEL 240
            QEF                         SLNKELADLMDELSMNSSPSANQNIDPYSEL
Sbjct: 181 SQEFKQLQDQIDLLKRKLLIKKENELRKLSLNKELADLMDELSMNSSPSANQNIDPYSEL 240

Query: 241 SSRPKSGQQRRTNEDQQSLHCEHCHLKSHTQSHPSEPRFVNLKESLEXXXXXXXXXXRKL 300
           SSRPKSGQQRRTNEDQQSLHCEHCHLKSHTQSHPSEPRFVNLKESLE          RKL
Sbjct: 241 SSRPKSGQQRRTNEDQQSLHCEHCHLKSHTQSHPSEPRFVNLKESLETPTPTPTQTPRKL 300

Query: 301 KREKDTNVADK 311
           KREKDTNVADK
Sbjct: 301 KREKDTNVADK 311

>Kwal_26.8190
          Length = 324

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 83/142 (58%), Gaps = 37/142 (26%)

Query: 19  NERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKK 78
           ++RIVPEEY+ NS MIN+LIKQNK+L  Q+  KQ+EIDRLNVL+GS R KLIKYTELNKK
Sbjct: 37  SDRIVPEEYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKK 96

Query: 79  MQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEYLQIKKN------------ 126
           +            Q+    PR+         SP     D + LQ+ KN            
Sbjct: 97  L-----------GQTSTHPPRF---------SP-----DEDVLQVNKNRQPRESREPDTR 131

Query: 127 NRHDENKIDDIYQKLELLTNLV 148
           +   EN+I DIY KLE LTNL+
Sbjct: 132 DSQLENRIGDIYSKLEALTNLM 153

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 33/63 (52%), Gaps = 14/63 (22%)

Query: 210 SLNKELADLMDELSMNSSPSANQNIDPYSELSSRPKSGQQRRTNEDQQSLHCEHCHLKSH 269
           SLNKEL DLMD+L + S PS     +P S     P S           + HC+HCH KS 
Sbjct: 229 SLNKELLDLMDKLDV-SKPSP----EPASTSPPAPVSA--------NTTPHCDHCH-KSA 274

Query: 270 TQS 272
           +QS
Sbjct: 275 SQS 277

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score = 97.1 bits (240), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 110/259 (42%), Gaps = 42/259 (16%)

Query: 20  ERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKKM 79
           +RIVP+EYK NS+MI+ LIKQNKDL  ++ EK  E+++LNVL+GS R KLIKYTELNKK+
Sbjct: 41  DRIVPDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKL 100

Query: 80  QRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEYLQIKKNNRHDEN--KIDDI 137
           Q   Q                 A   S          D  YLQ+ +     EN  KI ++
Sbjct: 101 QAQAQA----------------ARVPSPPEPAAEPAAD--YLQLPRRAPAAENDKKIGEL 142

Query: 138 YQKLELLTNLV-----NDAIHKQNNGEQREPSNFNSRIVXXXXXXXXXXQEFXXXXXXXX 192
           Y KLE LT +V     +D              +     V           E         
Sbjct: 143 YDKLEQLTKVVHQQHLHDPPAPARPRSPARSRSPARTAVSDDDIMISESSELKRLEEQVD 202

Query: 193 XXXXXXXXXXXXXXXXXSLNKELADLMDELSMNSSPSANQNI------DPYSELSSRPKS 246
                            SLN++LADLM +L ++SS  A+  +       P S  SS P +
Sbjct: 203 QLKRKVLIKSENELRKLSLNQQLADLMHKLGVSSSSPASSALLFDRQPSPTSAASSAPLA 262

Query: 247 GQQRRTNEDQQSLHCEHCH 265
                        HCE CH
Sbjct: 263 HA-----------HCEQCH 270

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score = 71.2 bits (173), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 57/80 (71%), Gaps = 2/80 (2%)

Query: 3   HNGSTPRRFVFG--NNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV 60
           ++G  P  +  G  +N  ++++VPEE K   ++IN+LI QNK+L   V  ++EEI+RLN+
Sbjct: 43  YSGINPPVYKNGLHSNLDDDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNI 102

Query: 61  LIGSFRAKLIKYTELNKKMQ 80
           +IG FRAKL KY+ +N+K++
Sbjct: 103 IIGQFRAKLTKYSVMNRKLE 122

>Scas_625.7d
          Length = 302

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 74/138 (53%), Gaps = 14/138 (10%)

Query: 7   TPRRFV------FGNNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNV 60
           TP+R+       +G    +E ++PEE + ++  INELI  N+ L K + ++++E+DR   
Sbjct: 20  TPQRYGTEKYARYGLRKTDE-LLPEESRLSNDAINELIDMNRQLKKTLRDREDELDRYGR 78

Query: 61  LIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEY 120
           L  S ++KLIKYT LN K++R++ E +    +  +   R   +  + S +      D +Y
Sbjct: 79  LTESLQSKLIKYTNLNNKLEREKIELELENEKLIDINERLTNDLRTTSVAG-----DLKY 133

Query: 121 LQIKKNNRHDENKIDDIY 138
            Q  K  + D+   DDI+
Sbjct: 134 SQ--KTRKGDDENTDDIF 149

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 44/61 (72%)

Query: 20  ERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKKM 79
           +++VPEEYK N+  IN+ ++QNK+L+ ++ EKQ EI  L  +  + R+KL KY ++ KK+
Sbjct: 48  DKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKL 107

Query: 80  Q 80
           +
Sbjct: 108 E 108

>Scas_711.45
          Length = 335

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 38/55 (69%)

Query: 22  IVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELN 76
           ++P++ K ++   +EL++ N+ L +++  KQ+E+++L +L  S + KLIKYT L 
Sbjct: 60  LLPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLT 114

>ABR180W [773] [Homologous to ScYLR454W - SH]
            complement(742456..750246) [7791 bp, 2596 aa]
          Length = 2596

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 11/94 (11%)

Query: 54   EIDRLNVLIGSFRAKLIKYTELNKKMQRDQQEQQHNRH---QSFESKPRYKAEFTSESSS 110
            E+D+L+ ++    +K+++  E  K +Q D++   HN     + F+   R   + ++ S S
Sbjct: 1841 ELDKLDAVL----SKVVELIEAIKNIQNDERADSHNEKTTDEGFKYSIRDFVDRSTGSVS 1896

Query: 111  PVSNERDSEYLQIKKNNRHDENKIDDIYQKLELL 144
            P  N+     +Q+K     DE+  D I++ L LL
Sbjct: 1897 PFENKFFVFCMQLK----WDEDARDVIFKYLHLL 1926

>YJR049C (UTR1) [2943] chr10 complement(526798..528390) NAD kinase,
           phosphorylates NAD [1593 bp, 530 aa]
          Length = 530

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 255 DQQSLHCEHCHLKSHTQSHPSEPRF 279
           D +S++CE C LK  +   PS+ RF
Sbjct: 504 DDESVNCEACKLKPSSVPKPSQARF 528

>YLR045C (STU2) [3462] chr12 complement(235038..237704) Component of
           the spindle pole body, localizes to microtubules and
           controls microtubule plus-end dynamics in vivo [2667 bp,
           888 aa]
          Length = 888

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 26/80 (32%)

Query: 6   STPRRFVFGNNDANERIVPEEYKY------NSSMIN-------------------ELIKQ 40
           +TP+  V  + D NE+++ EEYKY      N  MI                    E+IK+
Sbjct: 644 ATPKNVVANSTDKNEKLI-EEYKYRLQKLQNDEMIWTKERQSLLEKMNNTENYKIEMIKE 702

Query: 41  NKDLHKQVTEKQEEIDRLNV 60
           N+ L +Q+ E Q +++  N+
Sbjct: 703 NEMLREQLKEAQSKLNEKNI 722

>AFR637W [3829] [Homologous to ScYNL250W (RAD50) - SH]
           complement(1598692..1602582) [3891 bp, 1296 aa]
          Length = 1296

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 8/80 (10%)

Query: 12  VFGNNDANERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDR----LNVLIGSFRA 67
           ++G +      V EE +   + INE ++    L K+V   QEE +R     N L+   R 
Sbjct: 807 IYGGSSEGVYTV-EELQRKQTNINERLRV---LRKEVGRLQEEKERKATEFNNLVALVRE 862

Query: 68  KLIKYTELNKKMQRDQQEQQ 87
           K  K TE+ K++Q  QQ Q+
Sbjct: 863 KTFKVTEMEKQLQEKQQIQK 882

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.125    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,731,053
Number of extensions: 423376
Number of successful extensions: 3014
Number of sequences better than 10.0: 229
Number of HSP's gapped: 2952
Number of HSP's successfully gapped: 244
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)