Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F04840g63655719260.0
Scas_106.14231095659e-66
Kwal_26.81765921085602e-63
ABR055C6781095601e-62
YMR016C (SOK2)7851185562e-61
Scas_709.527251085331e-58
CAGL0L01771g4351095161e-58
Scas_625.85211065142e-57
YKL043W (PHD1)3661065022e-57
CAGL0M07634g2571123671e-39
Scas_510.21043801194e-06
Sklu_1824.2179991045e-05
KLLA0E05357g754771061e-04
YER111C (SWI4)1093801061e-04
Kwal_27.10756922871033e-04
Scas_683.37820771024e-04
AGL297C970871016e-04
KLLA0E20867g933115960.002
CAGL0A04565g104178960.002
AFR600C81577940.004
Scas_721.911235119750.67
KLLA0C11209g62726667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F04840g
         (626 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   746   0.0  
Scas_106.1                                                            222   9e-66
Kwal_26.8176                                                          220   2e-63
ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   220   1e-62
YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   218   2e-61
Scas_709.52                                                           209   1e-58
CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   203   1e-58
Scas_625.8                                                            202   2e-57
YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   197   2e-57
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   145   1e-39
Scas_510.2                                                             50   4e-06
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         45   5e-05
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    45   1e-04
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    45   1e-04
Kwal_27.10756                                                          44   3e-04
Scas_683.37                                                            44   4e-04
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    44   6e-04
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    42   0.002
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    42   0.002
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    41   0.004
Scas_721.91                                                            33   0.67 
KLLA0C11209g 962988..964871 no similarity, hypothetical start          30   7.3  

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/557 (70%), Positives = 393/557 (70%)

Query: 70  AQVSQLGGQPRQQQPNEDSTSGILQRLNPQNQYLGYAXXXXXXXXXXXXXXXXXXXXXXX 129
           AQVSQLGGQPRQQQPNEDSTSGILQRLNPQNQYLGYA                       
Sbjct: 70  AQVSQLGGQPRQQQPNEDSTSGILQRLNPQNQYLGYAQQQPIPQLQQQPQPQPQPQQQQQ 129

Query: 130 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDKGLPQLQPMSTNTQQMXXXXXXXXX 189
                                            YDKGLPQLQPMSTNTQQM         
Sbjct: 130 QQQQQQQQQPQQQAQQSPRQPQPQVQQQQQPQQYDKGLPQLQPMSTNTQQMMYYPYSGYS 189

Query: 190 XXXXXXXXXXXXXXXXXXXXXXXXXEEDSELKSXXXXXXXXXXXXXXXXXXAPPIISSAV 249
                                    EEDSELKS                  APPIISSAV
Sbjct: 190 HYYPYSGYSYYQQQVPQQMPQIVSQEEDSELKSQQPQQQQLQQQQTQQQPLAPPIISSAV 249

Query: 250 NSHPAGYTQSPSSRYYQLPPTSTYQYPRFQQYGLPMIQQQSQASISTPKXXXXXXXXXXX 309
           NSHPAGYTQSPSSRYYQLPPTSTYQYPRFQQYGLPMIQQQSQASISTPK           
Sbjct: 250 NSHPAGYTQSPSSRYYQLPPTSTYQYPRFQQYGLPMIQQQSQASISTPKSTNRNSSGSST 309

Query: 310 XXXQFGTNSPLDSFSNASPNPKEFPLKRRKSNKKSHLTPTQPNTTTFSQQGQRSKVTTTM 369
              QFGTNSPLDSFSNASPNPKEFPLKRRKSNKKSHLTPTQPNTTTFSQQGQRSKVTTTM
Sbjct: 310 NISQFGTNSPLDSFSNASPNPKEFPLKRRKSNKKSHLTPTQPNTTTFSQQGQRSKVTTTM 369

Query: 370 WEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHVVKIGS 429
           WEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHVVKIGS
Sbjct: 370 WEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHVVKIGS 429

Query: 430 MHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQESNGKYXXXXXXXXXXPLMS 489
           MHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQESNGKY          PLMS
Sbjct: 430 MHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQESNGKYQQQTQQHQHHPLMS 489

Query: 490 LPQQNPVPYANHQDDSSNHLMVLTQAGVAMQQQGNYNPNPQIPHSNINESSDNNSHXXXX 549
           LPQQNPVPYANHQDDSSNHLMVLTQAGVAMQQQGNYNPNPQIPHSNINESSDNNSH    
Sbjct: 490 LPQQNPVPYANHQDDSSNHLMVLTQAGVAMQQQGNYNPNPQIPHSNINESSDNNSHQQQQ 549

Query: 550 XXXXXXXXXXXXXXXXXXXXXXXXXXXXSLRPASVDNNQEKLHHPAGQLTEADQKRNDST 609
                                       SLRPASVDNNQEKLHHPAGQLTEADQKRNDST
Sbjct: 550 QQQQQQQQQQFATQSQVQQQPQQLQTDQSLRPASVDNNQEKLHHPAGQLTEADQKRNDST 609

Query: 610 TSQLGASSKQHDEGNSN 626
           TSQLGASSKQHDEGNSN
Sbjct: 610 TSQLGASSKQHDEGNSN 626

>Scas_106.1
          Length = 423

 Score =  222 bits (565), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 98/109 (89%), Positives = 103/109 (94%)

Query: 361 QRSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK 420
            R +VTTTMWEDE TLCYQVEA GVSVVRRADNDMINGTKLLNVT+MTRGRRDGILKAEK
Sbjct: 152 HRPRVTTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEK 211

Query: 421 IRHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469
           IRHVVKIGSMHLKGVWIPF+RAL MAQREKIVDLL+ LFVRDIQS+IQQ
Sbjct: 212 IRHVVKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQ 260

>Kwal_26.8176
          Length = 592

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 97/108 (89%), Positives = 104/108 (96%)

Query: 365 VTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHV 424
           VTTTMWEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV +MTRGRRDGILKAEKIRHV
Sbjct: 217 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV 276

Query: 425 VKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQESN 472
           VKIGSMHLKGVWIPF+RAL MAQREKIVDLL+ LFVRDIQS+IQQ ++
Sbjct: 277 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAS 324

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  220 bits (560), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 104/109 (95%)

Query: 364 KVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRH 423
           +VTTTMWEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV +MTRGRRDGILKAEK+RH
Sbjct: 330 RVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRH 389

Query: 424 VVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQESN 472
           VVKIGSMHLKGVWIPFERAL +AQREKIVD+L+ LFVRDIQS+IQQ S 
Sbjct: 390 VVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTST 438

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  218 bits (556), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (89%)

Query: 352 NTTTFSQQGQRSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGR 411
           NT+  S    R +VTTTMWEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNVT+MTRGR
Sbjct: 402 NTSGTSASIIRPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGR 461

Query: 412 RDGILKAEKIRHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469
           RDGILKAEKIRHVVKIGSMHLKGVWIPFERAL +AQREKI D LY LF+RDIQS+++Q
Sbjct: 462 RDGILKAEKIRHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQ 519

>Scas_709.52
          Length = 725

 Score =  209 bits (533), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%)

Query: 362 RSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKI 421
           + +VTTTMWEDE T+CYQVEANGVSVVRRADNDMINGTKLLNVT+MTRGRRDGILK+EKI
Sbjct: 383 KPRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKI 442

Query: 422 RHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469
           RHVVKIGSMHLKGVW+PFERA +MA RE I+DLLY LFVRDI+S+++Q
Sbjct: 443 RHVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQ 490

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  203 bits (516), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 88/109 (80%), Positives = 101/109 (92%)

Query: 360 GQRSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAE 419
           G+  ++ TT+WEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVT+MTRG+RDGIL++E
Sbjct: 198 GKGPRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSE 257

Query: 420 KIRHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQ 468
           K R VVKIGSMHLKGVWIPFERAL +A+REKIVDLLY LFVRDI S+++
Sbjct: 258 KYRKVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306

>Scas_625.8
          Length = 521

 Score =  202 bits (514), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%)

Query: 364 KVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRH 423
           +V TTMWEDE TLCYQVE NGV+VVRRADNDMINGTKLLNVT+MTRGRRDGIL+AEK+R 
Sbjct: 209 RVITTMWEDERTLCYQVECNGVAVVRRADNDMINGTKLLNVTKMTRGRRDGILRAEKVRS 268

Query: 424 VVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469
           V+KIGSMHLKGVWIPF+RAL+MA+REKIVDLLY LFV+DI SI+ Q
Sbjct: 269 VIKIGSMHLKGVWIPFDRALMMAKREKIVDLLYPLFVKDINSILSQ 314

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  197 bits (502), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 100/106 (94%)

Query: 362 RSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKI 421
           + +V TTMWEDENT+CYQVEANG+SVVRRADN+MINGTKLLNVT+MTRGRRDGIL++EK+
Sbjct: 184 KPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKV 243

Query: 422 RHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSII 467
           R VVKIGSMHLKGVWIPFERA ++AQRE+I+D LY LFV+DI+SI+
Sbjct: 244 REVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIV 289

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  145 bits (367), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 83/112 (74%)

Query: 356 FSQQGQRSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGI 415
           + Q    S+V TT WEDE+T+C+ V  NGV+VVRRADNDM+NGTKLLNVT MTRGRRDGI
Sbjct: 113 WLQHPLLSRVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGI 172

Query: 416 LKAEKIRHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSII 467
           LK E +R VVK G M LKGVWIP +RA  +A++E I   LY LF+ D+   I
Sbjct: 173 LKNEPVRDVVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQAI 224

>Scas_510.2
          Length = 1043

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 377 CYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK---IRHVVKIGSMHLK 433
           CY        V+RR  +D IN T++  +   ++  R  +L+ E    +   V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 434 GVWIPFERALVMAQREKIVD 453
           G WIP E AL++ Q+ KI D
Sbjct: 124 GTWIPLESALMLVQKYKIND 143

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 377 CYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK--IRH-VVKIGSMHLK 433
           CY        V+RR  ++ +N T++  +   ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKIQGGYGRFQ 87

Query: 434 GVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQESN 472
           G WIP E A  +  + K+ D++    V+ I S I   SN
Sbjct: 88  GTWIPLENARYLVSKYKVDDII----VKTILSFIPDPSN 122

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 386 SVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 442
           S+++R  ++ +N T +L   +  + +R  IL+ E I      V+ G    +G WIP E A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 443 LVMAQREKIVDLLYALF 459
             +A++ +++D L  LF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 377 CYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK--IRH-VVKIGSMHLK 433
           CY        V+RR  +D IN T++  + + ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 50  CYIRGFETKIVMRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQ 109

Query: 434 GVWIPFERALVMAQREKIVD 453
           G WIP + A  +  + +I+D
Sbjct: 110 GTWIPLDSAKFLVNKYEIID 129

>Kwal_27.10756
          Length = 922

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 377 CYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK--IRH-VVKIGSMHLK 433
           CY        V+RR  +D +N T++  +   ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQ 105

Query: 434 GVWIPFERALVMAQREKIVDLLYALFV 460
           G WIP E A  + Q+  + D++ +  +
Sbjct: 106 GTWIPLENAHYLVQKYSVSDVVVSTIL 132

>Scas_683.37
          Length = 820

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 386 SVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKI--RH-VVKIGSMHLKGVWIPFERA 442
           SV++R  +D +N T +L      + +R  IL  E +  +H  V+ G    +G W+P E A
Sbjct: 24  SVMKRKKDDWVNATHILKAANFAKAKRTRILDKEVMGRKHEKVQGGFGKYQGTWVPLEIA 83

Query: 443 LVMAQREKIVDLLYALF 459
             +A +  + + L ALF
Sbjct: 84  TELAMKFDVYEELRALF 100

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 377 CYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK--IRH-VVKIGSMHLK 433
           CY        V+RR  +D +N T++  V   ++ +R  IL+ E   I H  ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 434 GVWIPFERALVMAQREKIVDLLYALFV 460
           G WIP + A  +  + +I D++    +
Sbjct: 93  GTWIPLDSAKGLVAKYEITDIVVLTVI 119

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 3/115 (2%)

Query: 340 SNKKSHLTPTQPNTTTFSQQGQRSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGT 399
           S KK    PT   T+ +  + +      T    +   CY  +     ++RR +++ +N T
Sbjct: 72  SLKKISEEPTMAETSGYDSESETFIEVATYAGVDVYECYTKDKPPCLIMRRCNDNWLNIT 131

Query: 400 KLLNVTRMTRGRRDGILKAE--KIRH-VVKIGSMHLKGVWIPFERALVMAQREKI 451
           ++      T+ +R  IL+ E  +I+H  ++ G    +G WIP+E    + ++  I
Sbjct: 132 QVFKAGSFTKAQRTKILEKEANEIKHEKIQGGYGRFQGTWIPWESTKYLVEKYNI 186

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 377 CYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEK--IRH-VVKIGSMHLK 433
           CY        V+RR  +D +N T++  + + ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 52  CYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEKVQGGYGRFQ 111

Query: 434 GVWIPFERALVMAQREKI 451
           G W+P E A  M  +  I
Sbjct: 112 GTWVPLEAAKFMTTKYNI 129

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 386 SVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFERA 442
           S+++R  +D +N T +L   +  + +R  IL+ E I+     V+ G    +G W+P + A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 443 LVMAQREKIVDLLYALF 459
             +AQ+ ++++ L  LF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>Scas_721.91
          Length = 1235

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 24/119 (20%)

Query: 344  SHLTPTQPNTTTFSQQGQRSK----------VTTTMWEDENTLCYQVEANGVSVVRRADN 393
            S +TPTQ + T F     R +          V T+++E+++ LC  +EA G  V+    +
Sbjct: 917  SIMTPTQKSLTNFPSSATRDQGYKIFDKCLFVLTSIFENKDELCSTIEARGGKVLTLGFS 976

Query: 394  DMINGTKLLNVTRMTRGRRDGILKAEKIRHVVKIGSMHL----KGVWIPFERALVMAQR 448
             + +  +   V+ M  G  + I        ++K  S+HL      ++  ++ A ++ +R
Sbjct: 977  SLFDCCRA--VSTMPVGEDEDI--------ILKESSLHLTWKRDCIFKDYKFACLLTRR 1025

>KLLA0C11209g 962988..964871 no similarity, hypothetical start
          Length = 627

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 2/26 (7%)

Query: 253 PAGYTQSPS-SRYYQLPPTSTY-QYP 276
           P+ Y Q+P+ SRYYQ+P TS Y Q+P
Sbjct: 266 PSRYNQAPAPSRYYQVPATSRYSQFP 291

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,589,149
Number of extensions: 481582
Number of successful extensions: 1440
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1464
Number of HSP's successfully gapped: 25
Length of query: 626
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 518
Effective length of database: 12,857,365
Effective search space: 6660115070
Effective search space used: 6660115070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)