Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F03212g30530015180.0
Sklu_2334.231930112471e-174
YJR095W (SFC1)32230511981e-167
AGL311C36229811981e-166
CAGL0M09020g34832311551e-160
Kwal_47.1821633332711411e-158
Scas_691.433431111201e-155
YBR291C (CTP1)2993033643e-41
CAGL0L02079g2973023471e-38
KLLA0E18810g3773003502e-38
Sklu_1149.22962983443e-38
Kwal_26.79672973013427e-38
Scas_489.42973053341e-36
Scas_640.253063023165e-34
YPR021C (AGC1)9022952971e-29
CAGL0J04114g3032952808e-29
CAGL0K02365g9192932891e-28
ACR109W2993012744e-28
Scas_589.103163012684e-27
ADL049W9122922775e-27
YOR222W (ODC2)3072972659e-27
AGL064W2963012641e-26
Scas_602.88852982713e-26
Kwal_47.173218812892678e-26
Sklu_2359.69022952642e-25
Kwal_26.86692962842543e-25
Scas_582.73292852554e-25
KLLA0E13453g9062892581e-24
CAGL0K12210g3112972501e-24
KLLA0C11363g5173142552e-24
Scas_718.53242972502e-24
CAGL0K08250g2972912473e-24
YPL134C (ODC1)3103062457e-24
CAGL0D01606g3052932458e-24
YJL133W (MRS3)3142912441e-23
KLLA0E15532g3263052441e-23
Scas_709.93653142442e-23
YKR052C (MRS4)3042922413e-23
KLLA0D07073g2973032395e-23
Scas_379.23012912385e-23
Scas_667.223062952388e-23
ACR260W3112932379e-23
Scas_558.22892992342e-22
CAGL0L05742g3052992352e-22
Kwal_33.140503142962343e-22
CAGL0J02002g3612952354e-22
CAGL0H03839g2823002281e-21
Kwal_23.30425423142342e-21
YBR104W (YMC2)3293152292e-21
Kwal_27.125993042932282e-21
YEL006W3353072282e-21
Scas_578.3*5243102323e-21
YIL006W3733022284e-21
Sklu_2374.75133182304e-21
YNL003C (PET8)2843002244e-21
Sklu_2442.82753052227e-21
Kwal_0.2322742982211e-20
KLLA0F17864g3072962202e-20
Sklu_2398.43092942193e-20
Sklu_1926.23052952175e-20
KLLA0B08503g3032882167e-20
Kwal_56.230113032862169e-20
YNL083W5453182182e-19
Kwal_55.208683803032152e-19
Sklu_1275.13113052132e-19
YPR058W (YMC1)3072992122e-19
Scas_632.92922982104e-19
Sklu_2363.23233022106e-19
YPR011C3263122106e-19
AAL014C2712932077e-19
AER419W4933042138e-19
Sklu_2432.52882902034e-18
CAGL0J05522g5193182084e-18
Scas_697.473282942044e-18
YOR100C (CRC1)3272982045e-18
Sklu_2127.52782872016e-18
CAGL0J09790g3003032019e-18
KLLA0D04950g2742932009e-18
CAGL0K10362g3013002001e-17
Kwal_23.47313143132001e-17
CAGL0G01166g2952961982e-17
CAGL0C02013g3293301992e-17
Sklu_2431.53703351993e-17
Kwal_23.29133203051983e-17
Kwal_14.22103153051956e-17
AFR146W2812821937e-17
Scas_721.273743321967e-17
KLLA0D14036g4313301978e-17
Kwal_33.129883032921931e-16
Kwal_27.120813693351942e-16
KLLA0E23705g3683341932e-16
Kwal_55.213353172811912e-16
ADL264C3292941903e-16
CAGL0J01661g3273001904e-16
YBR192W (RIM2)3773271896e-16
ADL009W3793101897e-16
CAGL0M05225g3813331881e-15
YMR166C3683131871e-15
YLR348C (DIC1)2982921832e-15
YJR077C (MIR1)3112791833e-15
YOR130C (ORT1)2922911823e-15
KLLA0D09889g3642891843e-15
CAGL0B04543g3172961824e-15
Scas_702.103022871815e-15
Scas_716.293163051815e-15
Scas_721.1293232911799e-15
Kwal_23.35293952871801e-14
YDL198C (YHM1)3003021781e-14
AEL253W3653291791e-14
KLLA0E02772g2842881762e-14
Scas_562.123003021753e-14
AFR131C3443391754e-14
CAGL0F07711g3682361754e-14
KLLA0C13431g3282951728e-14
Sklu_2117.22982921718e-14
KLLA0F13464g3001291711e-13
Sklu_2127.43233001711e-13
KLLA0A09383g3662551711e-13
AGL047C3163051702e-13
CAGL0K11616g3202871702e-13
Kwal_55.213383232791692e-13
YBR085W (AAC3)3072981682e-13
Scas_714.183053061682e-13
AFR147C3152881692e-13
KLLA0D15015g3172921683e-13
YKL120W (OAC1)3242891683e-13
CAGL0G08910g2892891664e-13
Sklu_1119.13072801665e-13
CAGL0G03135g3073081656e-13
KLLA0B12826g3192941649e-13
Kwal_23.39653073201621e-12
Sklu_2037.23103121622e-12
KLLA0A00979g3433541622e-12
Kwal_27.116262992921602e-12
Sklu_2260.53022761602e-12
Kwal_33.155973052801603e-12
YGR096W (TPC1)3143151594e-12
CAGL0K07436g3072831594e-12
Kwal_26.76533252071594e-12
Scas_662.123083101569e-12
Scas_667.43083031551e-11
Sklu_2115.42993201551e-11
KLLA0F04697g3073061542e-11
Kwal_34.159073123061542e-11
Kwal_23.57573072781542e-11
Scas_645.93912831542e-11
Kwal_23.43543432621532e-11
Kwal_47.192282812641523e-11
Scas_673.173142801533e-11
KLLA0E09680g3072911514e-11
CAGL0K02915g3423281524e-11
CAGL0F00231g3072791515e-11
YIL134W (FLX1)3113131481e-10
KLLA0F08547g3082821471e-10
Sklu_2075.33452901471e-10
YHR002W (LEU5)3573201472e-10
CAGL0F04213g3062981452e-10
YMR241W (YHM2)3142651443e-10
AGR191W2981291444e-10
YGR257C (MTM1)3663481444e-10
Kwal_27.124813043021434e-10
Scas_718.243372951444e-10
Scas_717.203563321427e-10
CAGL0B03883g3063121401e-09
AFL196W3612841411e-09
Sklu_2194.33122851391e-09
CAGL0H10538g2973151382e-09
Kwal_33.154463053211382e-09
Scas_669.63733061383e-09
YER053C3002741363e-09
KLLA0D04290g1881911324e-09
Scas_687.15*3283291356e-09
AER366W2932421346e-09
Scas_696.93121391346e-09
AAR036W3172981346e-09
AFR253W3443241356e-09
Sklu_2433.84203241357e-09
AGL065C3353441347e-09
Scas_715.453052751338e-09
AFR542W3102411331e-08
Sklu_2430.103241791321e-08
CAGL0F08305g3742781321e-08
Kwal_27.114192983141312e-08
KLLA0E02750g3042971302e-08
KLLA0E12353g3053001302e-08
YMR056C (AAC1)3092921302e-08
ABL023W3092731293e-08
YBL030C (PET9)3182931293e-08
KLLA0B14454g3052801293e-08
AER184W3052991284e-08
Kwal_26.79723583141268e-08
CAGL0D04774g3223001241e-07
KLLA0E08877g2943111203e-07
YFR045W2851541195e-07
AGR383W2932011195e-07
AER450C3082791161e-06
Scas_705.93233001142e-06
KLLA0B11319g3552761133e-06
KLLA0E18788g3812311134e-06
Sklu_2435.23442451045e-05
ADR036C3401681028e-05
KLLA0D04312g10386941e-04
YPR128C (ANT1)328314982e-04
Scas_613.2417787953e-04
Scas_328.1227136946e-04
Kwal_55.21106328308910.002
YDL119C30785870.006
KLLA0E22880g43679830.022
Scas_611.4*29992740.22
AEL060C42982710.57
Scas_671.1*12386670.70
Kwal_55.20583190347681.8
ACL064C311647672.4
YNL122C11571623.0
YLL040C (VPS13)314451636.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F03212g
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   589   0.0  
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        484   e-174
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   466   e-167
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   466   e-166
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   449   e-160
Kwal_47.18216                                                         444   e-158
Scas_691.4                                                            436   e-155
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...   144   3e-41
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...   138   1e-38
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...   139   2e-38
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement        137   3e-38
Kwal_26.7967                                                          136   7e-38
Scas_489.4                                                            133   1e-36
Scas_640.25                                                           126   5e-34
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   119   1e-29
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   112   8e-29
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   115   1e-28
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   110   4e-28
Scas_589.10                                                           107   4e-27
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   111   5e-27
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   106   9e-27
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...   106   1e-26
Scas_602.8                                                            108   3e-26
Kwal_47.17321                                                         107   8e-26
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         106   2e-25
Kwal_26.8669                                                          102   3e-25
Scas_582.7                                                            102   4e-25
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   103   1e-24
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   100   1e-24
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...   102   2e-24
Scas_718.5                                                            100   2e-24
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...   100   3e-24
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    99   7e-24
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    99   8e-24
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    99   1e-23
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    99   1e-23
Scas_709.9                                                             99   2e-23
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    97   3e-23
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    97   5e-23
Scas_379.2                                                             96   5e-23
Scas_667.22                                                            96   8e-23
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    96   9e-23
Scas_558.2                                                             95   2e-22
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    95   2e-22
Kwal_33.14050                                                          95   3e-22
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    95   4e-22
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    92   1e-21
Kwal_23.3042                                                           95   2e-21
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    93   2e-21
Kwal_27.12599                                                          92   2e-21
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    92   2e-21
Scas_578.3*                                                            94   3e-21
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    92   4e-21
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       93   4e-21
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    91   4e-21
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          90   7e-21
Kwal_0.232                                                             90   1e-20
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    89   2e-20
Sklu_2398.4 , Contig c2398 9476-10405                                  89   3e-20
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          88   5e-20
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    88   7e-20
Kwal_56.23011                                                          88   9e-20
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    89   2e-19
Kwal_55.20868                                                          87   2e-19
Sklu_1275.1 , Contig c1275 314-1249                                    87   2e-19
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    86   2e-19
Scas_632.9                                                             86   4e-19
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          86   6e-19
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    86   6e-19
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    84   7e-19
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    87   8e-19
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       83   4e-18
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    85   4e-18
Scas_697.47                                                            83   4e-18
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    83   5e-18
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         82   6e-18
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    82   9e-18
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    82   9e-18
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    82   1e-17
Kwal_23.4731                                                           82   1e-17
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    81   2e-17
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    81   2e-17
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            81   3e-17
Kwal_23.2913                                                           81   3e-17
Kwal_14.2210                                                           80   6e-17
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    79   7e-17
Scas_721.27                                                            80   7e-17
KLLA0D14036g complement(1203522..1204817) some similarities with...    80   8e-17
Kwal_33.12988                                                          79   1e-16
Kwal_27.12081                                                          79   2e-16
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    79   2e-16
Kwal_55.21335                                                          78   2e-16
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    78   3e-16
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    78   4e-16
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    77   6e-16
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    77   7e-16
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    77   1e-15
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    77   1e-15
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    75   2e-15
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    75   3e-15
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    75   3e-15
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    75   3e-15
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    75   4e-15
Scas_702.10                                                            74   5e-15
Scas_716.29                                                            74   5e-15
Scas_721.129                                                           74   9e-15
Kwal_23.3529                                                           74   1e-14
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    73   1e-14
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    74   1e-14
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    72   2e-14
Scas_562.12                                                            72   3e-14
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    72   4e-14
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    72   4e-14
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    71   8e-14
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            70   8e-14
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    70   1e-13
Sklu_2127.4 , Contig c2127 6322-7293                                   70   1e-13
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    70   1e-13
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    70   2e-13
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    70   2e-13
Kwal_55.21338                                                          70   2e-13
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    69   2e-13
Scas_714.18                                                            69   2e-13
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    70   2e-13
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    69   3e-13
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    69   3e-13
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    69   4e-13
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             69   5e-13
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    68   6e-13
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    68   9e-13
Kwal_23.3965                                                           67   1e-12
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         67   2e-12
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    67   2e-12
Kwal_27.11626                                                          66   2e-12
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         66   2e-12
Kwal_33.15597                                                          66   3e-12
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    66   4e-12
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    66   4e-12
Kwal_26.7653                                                           66   4e-12
Scas_662.12                                                            65   9e-12
Scas_667.4                                                             64   1e-11
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            64   1e-11
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    64   2e-11
Kwal_34.15907                                                          64   2e-11
Kwal_23.5757                                                           64   2e-11
Scas_645.9                                                             64   2e-11
Kwal_23.4354                                                           64   2e-11
Kwal_47.19228                                                          63   3e-11
Scas_673.17                                                            64   3e-11
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    63   4e-11
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    63   4e-11
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    63   5e-11
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    62   1e-10
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    61   1e-10
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                61   1e-10
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    61   2e-10
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    60   2e-10
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    60   3e-10
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    60   4e-10
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    60   4e-10
Kwal_27.12481                                                          60   4e-10
Scas_718.24                                                            60   4e-10
Scas_717.20                                                            59   7e-10
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    59   1e-09
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    59   1e-09
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            58   1e-09
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    58   2e-09
Kwal_33.15446                                                          58   2e-09
Scas_669.6                                                             58   3e-09
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    57   3e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    55   4e-09
Scas_687.15*                                                           57   6e-09
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    56   6e-09
Scas_696.9                                                             56   6e-09
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    56   6e-09
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    57   6e-09
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       57   7e-09
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    56   7e-09
Scas_715.45                                                            56   8e-09
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    56   1e-08
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         55   1e-08
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    55   1e-08
Kwal_27.11419                                                          55   2e-08
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    55   2e-08
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    55   2e-08
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    55   2e-08
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    54   3e-08
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    54   3e-08
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    54   3e-08
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    54   4e-08
Kwal_26.7972                                                           53   8e-08
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    52   1e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    51   3e-07
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    50   5e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    50   5e-07
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    49   1e-06
Scas_705.9                                                             49   2e-06
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    48   3e-06
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    48   4e-06
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         45   5e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    44   8e-05
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    41   1e-04
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    42   2e-04
Scas_613.24                                                            41   3e-04
Scas_328.1                                                             41   6e-04
Kwal_55.21106                                                          40   0.002
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    38   0.006
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    37   0.022
Scas_611.4*                                                            33   0.22 
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    32   0.57 
Scas_671.1*                                                            30   0.70 
Kwal_55.20583                                                          31   1.8  
ACL064C [985] [Homologous to ScYLL040C (VPS13) - SH] (239881..24...    30   2.4  
YNL122C (YNL122C) [4473] chr14 complement(398023..398370) Protei...    28   3.0  
YLL040C (VPS13) [3381] chr12 complement(54210..63644) Protein in...    29   6.6  

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/300 (96%), Positives = 290/300 (96%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE
Sbjct: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
           IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG
Sbjct: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
           ITEA          KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA
Sbjct: 121 ITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180

Query: 181 RQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240
           RQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ
Sbjct: 181 RQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE
Sbjct: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  484 bits (1247), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/301 (78%), Positives = 254/301 (84%), Gaps = 1/301 (0%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           M+SK+KSSNPAVNLIAGG AGL E LCCHPLDTIKVRMQIY+ +   G+K PGFIKTG  
Sbjct: 1   MSSKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRN 60

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
           IY  EG LA YKGLGAVVIGI PKMAIRFSSYEFYR+ LADK+TG VSTGNTF+AGVGAG
Sbjct: 61  IYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAG 120

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGA-PKYKNAVQACYTIVKEEGFSALYRGVSLTA 179
            TEA          KIRLQAQHL+P   A P+Y+NA+QACY IVKEEG  ALYRGVSLTA
Sbjct: 121 TTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTA 180

Query: 180 ARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239
           ARQATNQGANFTVYSKLKEFLQ +H  + LPSWETS IGLISGAIGPFSNAPLDTIKTRL
Sbjct: 181 ARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRL 240

Query: 240 QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           QKDKST NMSG  RI  IGKQLI+EEGFRALYKGITPRVMRVAPGQAVTFT YEF+R+ L
Sbjct: 241 QKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

Query: 300 E 300
           E
Sbjct: 301 E 301

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  466 bits (1198), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/305 (75%), Positives = 253/305 (82%), Gaps = 5/305 (1%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVG-SGVKAPGFIKTGG 59
           M+ K+K+S+PA+NL+AGG AGL E LCCHPLDTIKVRMQIY+   G   VK PGFIKTG 
Sbjct: 1   MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGR 60

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGA 119
            IY+ EGFLA YKGLGAVVIGI PKMAIRFSSYEFYRTLL +KE+G VSTGNTF+AGVGA
Sbjct: 61  TIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGA 120

Query: 120 GITEAXXXXXXXXXXKIRLQAQHLNPVE--GAPKYKNAVQACYTIVKEEGFSALYRGVSL 177
           GITEA          KIRLQAQHL P E    PKY NA+ A YTIVKEEG SALYRGVSL
Sbjct: 121 GITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSL 180

Query: 178 TAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKT 237
           TAARQATNQGANFTVYSKLKEFLQ YH  ++LPSWETS IGLISGAIGPFSNAPLDTIKT
Sbjct: 181 TAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKT 240

Query: 238 RLQKDKST--KNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           RLQKDKS   +  SG+K+I  IG QL++EEGFRALYKGITPRVMRVAPGQAVTFT YE++
Sbjct: 241 RLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV 300

Query: 296 RKELE 300
           R+ LE
Sbjct: 301 REHLE 305

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  466 bits (1198), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 228/298 (76%), Positives = 249/298 (83%), Gaps = 1/298 (0%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           S +KS+NPAVNL+AGG AGL E LCCHPLDTIKVRMQIY+ A   G K PGF++TG  IY
Sbjct: 50  SSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRA-NEGTKPPGFLRTGANIY 108

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122
             EG LAFYKGLGAVVIGI PKMAIRFSSYEFYRTLLAD++TG VSTGNTF+AGVGAG+T
Sbjct: 109 SGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVT 168

Query: 123 EAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQ 182
           EA          KIRLQAQHL+      KY+NA+QA Y IVKEEG  ALYRGVSLTAARQ
Sbjct: 169 EAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228

Query: 183 ATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242
           ATNQGANFTVYSKL E LQ YH  + LPSWETSLIGL+SGAIGPFSNAPLDTIKTRLQKD
Sbjct: 229 ATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKD 288

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           KST+N+S   RIT IG+QL+QEEGFRALYKGITPRVMRVAPGQAVTFT YEF+R+ LE
Sbjct: 289 KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 79/192 (41%), Gaps = 6/192 (3%)

Query: 14  LIAGGGAGLMEG-LCCHPLDTIKVRMQI-YKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
            +AG GAG+ E  L  +P++ +K+R+Q  + +      K    I+    I + EG  A Y
Sbjct: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKE-TGKVSTGNTFIAGVGAGITEAXXXXXX 130
           +G+              F+ Y      L +   +  + +  T + G+ +G   A      
Sbjct: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSG---AIGPFSN 275

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
                I+ + Q          +         +V+EEGF ALY+G++    R A  Q   F
Sbjct: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335

Query: 191 TVYSKLKEFLQG 202
           TVY  ++  L+G
Sbjct: 336 TVYEFVRRHLEG 347

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  449 bits (1155), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 232/323 (71%), Positives = 244/323 (75%), Gaps = 31/323 (9%)

Query: 9   NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA------------------------ 44
           NP VNL+AGG AGL E LCCHPLDTIKVRMQIYK                          
Sbjct: 10  NPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVG 69

Query: 45  ---VGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD 101
                + +K PGFI+TG  IY  EGFLA YKGLGAVVIGI PKMAIRFSSYEFYRTLLAD
Sbjct: 70  GGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD 129

Query: 102 KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVE--GAPKYKNAVQAC 159
           K+TG VST NTFIAGVGAG+TEA          KIRLQAQHLNP      PKY NAVQA 
Sbjct: 130 KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAG 189

Query: 160 YTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGL 219
           YTI+KEEG SALYRGVSLTAARQATNQGANFTVYSKL+EFLQ YH  E LPSWETS IGL
Sbjct: 190 YTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGL 249

Query: 220 ISGAIGPFSNAPLDTIKTRLQKDKST--KNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
           ISGAIGPFSNAPLDTIKTRLQKDKST  K  SG KRI  IG QL++EEGFRALYKGITPR
Sbjct: 250 ISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPR 309

Query: 278 VMRVAPGQAVTFTAYEFIRKELE 300
           VMRVAPGQAVTFT YEF+R+ LE
Sbjct: 310 VMRVAPGQAVTFTVYEFVRRHLE 332

>Kwal_47.18216
          Length = 333

 Score =  444 bits (1141), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 224/327 (68%), Positives = 246/327 (75%), Gaps = 27/327 (8%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           M++++ SS+PA+NL+AGG AGL E LCCHPLDTIKVRMQIY  A   G +A GFI T  +
Sbjct: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
           I   EGFLA YKGLGAVVIGI PKMAIRF+SYEF+RTLLAD++TG VSTGNTF+AGVGAG
Sbjct: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120

Query: 121 ITEAXXXXXXXXXXKIRLQAQHL---------------------------NPVEGAPKYK 153
           ITEA          KIRLQAQH+                             V   PKY+
Sbjct: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYR 180

Query: 154 NAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWE 213
           NA+QA Y IVKEEG  ALYRGVSLTAARQATNQGANFTVYS LK  LQ YH  +MLPSWE
Sbjct: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240

Query: 214 TSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKG 273
           TSLIGLISGA+GPFSNAPLDTIKTRLQKDKST   SG  RI  IG+QLI+EEGFRALYKG
Sbjct: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300

Query: 274 ITPRVMRVAPGQAVTFTAYEFIRKELE 300
           ITPRVMRVAPGQAVTFT YE IRK+LE
Sbjct: 301 ITPRVMRVAPGQAVTFTVYELIRKKLE 327

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 84/220 (38%), Gaps = 33/220 (15%)

Query: 13  NLIAGGGAGLMEG-LCCHPLDTIKVRMQ----------------------------IYKN 43
             +AG GAG+ E  +  +P++ +K+R+Q                                
Sbjct: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATE 171

Query: 44  AVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD-K 102
            V +  K    I+    I + EG  A Y+G+              F+ Y   ++ L +  
Sbjct: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231

Query: 103 ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTI 162
           +T  + +  T + G+   I+ A           I+ + Q          +   +     +
Sbjct: 232 QTDMLPSWETSLIGL---ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288

Query: 163 VKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG 202
           ++EEGF ALY+G++    R A  Q   FTVY  +++ L+G
Sbjct: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328

>Scas_691.4
          Length = 334

 Score =  436 bits (1120), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 223/311 (71%), Positives = 240/311 (77%), Gaps = 17/311 (5%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN 64
            K S+P +NL+AGG AGL E LCCHPLDTIKVRMQI K     G++  GFI TG  IY +
Sbjct: 8   DKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRT--EGMRPHGFITTGRNIYSH 65

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124
           EGFLA YKGLGAVVIGI PKMAIRFSSYEFYR  L DKET  ++TGNTF+AGVGAGITEA
Sbjct: 66  EGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAGVGAGITEA 125

Query: 125 XXXXXXXXXXKIRLQAQHLNP-------VEGA--------PKYKNAVQACYTIVKEEGFS 169
                     KIRLQAQHLN        V  A        PKY NA+ A YTIVKEEG  
Sbjct: 126 VLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAG 185

Query: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSN 229
           ALYRGVSLTAARQATNQGANFTVYS LK++LQ YHN+E LPSWETS IGLISGAIGPFSN
Sbjct: 186 ALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSN 245

Query: 230 APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
           APLDTIKTRLQKDKS  + S  K+I IIG QLI+EEGFRALYKGITPRVMRVAPGQAVTF
Sbjct: 246 APLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTF 305

Query: 290 TAYEFIRKELE 300
           T YEF+RK LE
Sbjct: 306 TVYEFVRKHLE 316

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score =  144 bits (364), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 149/303 (49%), Gaps = 21/303 (6%)

Query: 1   MASKQKSSN--PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI-KT 57
           M+SK   S+  P  + +AG  AG  E    +P +  K R+Q+   A  +       I KT
Sbjct: 1   MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKT 60

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGV 117
                + +G  + Y G  A +IG T K  IRF  ++  + +L D ETG++S     IAG+
Sbjct: 61  A----KTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGL 116

Query: 118 GAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKN----AVQACYTIVKEEGFSALYR 173
           GAG+ E+          K  L     +     PKY N     V+   ++V+++GFS LYR
Sbjct: 117 GAGLLESVAAVTPFEAIKTALIDDKQS---ATPKYHNNGRGVVRNYSSLVRDKGFSGLYR 173

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHN---QEMLPSWETSLIGLISGAIGPFSNA 230
           GV   + RQA NQ      Y+K+K  +Q Y +    + L S  T L+G  SG +  +S  
Sbjct: 174 GVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTM 233

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFT 290
           PLDT+KTR+Q   STK  S +     I     +EEG +  +KG TPR+ R+     + FT
Sbjct: 234 PLDTVKTRMQSLDSTKYSSTMNCFATI----FKEEGLKTFWKGATPRLGRLVLSGGIVFT 289

Query: 291 AYE 293
            YE
Sbjct: 290 IYE 292

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 83/190 (43%), Gaps = 14/190 (7%)

Query: 14  LIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGV--KAPGFIKTGGEIYRNEGFLAF 70
           +IAG GAGL+E +    P + IK  +   K +          G ++    + R++GF   
Sbjct: 112 VIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGL 171

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGNTFIAGVGAGITEAXX 126
           Y+G+  V +      A+R   Y   +TL+ D     +   +S+G TF+ G  +GI     
Sbjct: 172 YRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYS 231

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   K R+Q+        + KY + +    TI KEEG    ++G +    R   + 
Sbjct: 232 TMPLDTV-KTRMQSLD------STKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSG 284

Query: 187 GANFTVYSKL 196
           G  FT+Y K+
Sbjct: 285 GIVFTIYEKV 294

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 83/198 (41%), Gaps = 18/198 (9%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPK-YKNAVQACYTIVKEEGFS 169
           ++F+AG  AG  EA          K RLQ      ++ A K  +N +   Y   K +G  
Sbjct: 14  HSFLAGSLAGAAEACITYPFEFA-KTRLQL-----IDKASKASRNPLVLIYKTAKTQGIG 67

Query: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSN 229
           ++Y G            G  F  +  +K+ L+     E L      + GL +G +   + 
Sbjct: 68  SIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGE-LSGTRGVIAGLGAGLLESVAA 126

Query: 230 A-PLDTIKTRLQKDKST------KNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVA 282
             P + IKT L  DK +       N  G+ R       L++++GF  LY+G+ P  MR A
Sbjct: 127 VTPFEAIKTALIDDKQSATPKYHNNGRGVVRNY---SSLVRDKGFSGLYRGVLPVSMRQA 183

Query: 283 PGQAVTFTAYEFIRKELE 300
             QAV    Y  I+  ++
Sbjct: 184 ANQAVRLGCYNKIKTLIQ 201

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score =  138 bits (347), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 146/302 (48%), Gaps = 21/302 (6%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           M+   K  +P  + +AG  AG +E    +P +  K R+Q+   +  +       I     
Sbjct: 1   MSKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTA- 59

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
             + +G  A Y G  A ++G T K A RF  Y+  R LL DK+TG++S     +AG+GAG
Sbjct: 60  --KTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAG 117

Query: 121 ITEAXXXXXXXXXXKIRL--QAQHLNPVEGAPKYKN----AVQACYTIVKEEGFSALYRG 174
           + E+          K  L    Q +      PKY+N      +   ++VK+EGF  LY G
Sbjct: 118 LLESVVAVTPFEAIKTVLIDDKQSVR-----PKYQNNGRSMARNYISLVKDEGFRGLYGG 172

Query: 175 VSLTAARQATNQGANFTVYSKLKEFLQGYH---NQEMLPSWETSLIGLISGAIGPFSNAP 231
           V   + RQA NQ      Y+K+K  +Q Y      + L S  T ++G  SG +  ++  P
Sbjct: 173 VLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMP 232

Query: 232 LDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTA 291
           +DT+KTR+Q   ++K  S L   T I K    EEG +  +KG TPR+ R+     + FT 
Sbjct: 233 IDTVKTRMQSLTASKYSSTLNCFTTIYK----EEGLKTFWKGATPRLGRLILSGGIVFTI 288

Query: 292 YE 293
           YE
Sbjct: 289 YE 290

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 81/202 (40%), Gaps = 16/202 (7%)

Query: 102 KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYT 161
           K++ KV    +F+AG  AG  EA          K RLQ       + +   +N +   Y 
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFA-KTRLQLID----KSSKASRNPLVLIYN 57

Query: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLIS 221
             K +G  A+Y G               F  Y  ++  L+     E L      L GL +
Sbjct: 58  TAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGE-LSGPRGVLAGLGA 116

Query: 222 GAI-GPFSNAPLDTIKTRLQKDKST------KNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           G +    +  P + IKT L  DK +       N   + R  I    L+++EGFR LY G+
Sbjct: 117 GLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYI---SLVKDEGFRGLYGGV 173

Query: 275 TPRVMRVAPGQAVTFTAYEFIR 296
            P  MR A  QAV    Y  I+
Sbjct: 174 LPVSMRQAANQAVRLGCYNKIK 195

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 83/200 (41%), Gaps = 24/200 (12%)

Query: 14  LIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN-------E 65
           ++AG GAGL+E +    P + IK  +   K +V      P +   G  + RN       E
Sbjct: 110 VLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSV-----RPKYQNNGRSMARNYISLVKDE 164

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGNTFIAGVGAGI 121
           GF   Y G+  V +      A+R   Y   + L+ D     +   +++G TFI G  +G+
Sbjct: 165 GFRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGV 224

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
                        K R+Q+        A KY + +    TI KEEG    ++G +    R
Sbjct: 225 VTVYATMPIDTV-KTRMQSLT------ASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGR 277

Query: 182 QATNQGANFTVYSKLKEFLQ 201
              + G  FT+Y  +  +L 
Sbjct: 278 LILSGGIVFTIYENVLLYLS 297

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score =  139 bits (350), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 147/300 (49%), Gaps = 17/300 (5%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           M+S + + +P  + +AG  AG +E    +P +  K R+Q+   A  +       I   G 
Sbjct: 81  MSSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTG- 139

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
             +N G  + Y G  A ++G T K  IRF  ++  + LL DK+TG++S     +AG+GAG
Sbjct: 140 --KNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAG 197

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKN----AVQACYTIVKEEGFSALYRGVS 176
           + E+          K  L       V   PKY+N     V     ++ ++GFS LYRGV 
Sbjct: 198 LLESVVAVTPFEAIKTALIDDKQAAV---PKYQNNGKGMVSNYAKLLSDQGFSGLYRGVL 254

Query: 177 LTAARQATNQGANFTVYSKLKEFLQGYHN---QEMLPSWETSLIGLISGAIGPFSNAPLD 233
             + RQA NQ      Y+K+K  +Q Y N    + L S  T ++G  SG +  ++  P+D
Sbjct: 255 PVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPID 314

Query: 234 TIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           T+KTR+Q   + +  S +     I K    EEG +  +KG TPR+ R+     + FT YE
Sbjct: 315 TVKTRMQSLNAGQYSSTINCFATIFK----EEGLKTFWKGATPRLGRLILSGGIVFTIYE 370

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 14/194 (7%)

Query: 14  LIAGGGAGLMEGLC-CHPLDTIKVRMQIYKNAVGSGVK--APGFIKTGGEIYRNEGFLAF 70
           ++AG GAGL+E +    P + IK  +   K A     +    G +    ++  ++GF   
Sbjct: 190 VVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGL 249

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGNTFIAGVGAGITEAXX 126
           Y+G+  V +      A+R   Y   +TL+ D     +   +S+G TFI G  +GI     
Sbjct: 250 YRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYT 309

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                    ++ + Q LN    A +Y + +    TI KEEG    ++G +    R   + 
Sbjct: 310 TMPIDT---VKTRMQSLN----AGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSG 362

Query: 187 GANFTVYSKLKEFL 200
           G  FT+Y K+   L
Sbjct: 363 GIVFTIYEKVLTVL 376

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 81/195 (41%), Gaps = 12/195 (6%)

Query: 107 VSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPK-YKNAVQACYTIVKE 165
           V   ++F+AG  AG  EA          K RLQ      V+ A K  +N +   Y   K 
Sbjct: 88  VDPFHSFLAGSIAGAIEASITYPFEFA-KTRLQL-----VDKASKASRNPLVLIYNTGKN 141

Query: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAI- 224
            G S++Y G            G  F  +  +K  L+     E L  +   + GL +G + 
Sbjct: 142 YGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGE-LSGFRGVVAGLGAGLLE 200

Query: 225 GPFSNAPLDTIKTRLQKDKST---KNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRV 281
              +  P + IKT L  DK     K  +  K +     +L+ ++GF  LY+G+ P  MR 
Sbjct: 201 SVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQ 260

Query: 282 APGQAVTFTAYEFIR 296
           A  QAV    Y  I+
Sbjct: 261 AANQAVRLGCYNKIK 275

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score =  137 bits (344), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/298 (31%), Positives = 147/298 (49%), Gaps = 17/298 (5%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           S+ K  +P+ + IAG  AG +E    +P +  K R+Q+   A  +       I       
Sbjct: 2   SQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTA--- 58

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122
           + +G  + Y G  A ++G T K  +RF  ++  + LL D +TG++S     IAG+GAG+ 
Sbjct: 59  KTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLL 118

Query: 123 EAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKN---AVQACYT-IVKEEGFSALYRGVSLT 178
           E+          K  L     +     PKY N    +   YT +V+++G S LYRGV   
Sbjct: 119 ESVVAVTPFEAIKTALIDDKQS---ATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPV 175

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHN---QEMLPSWETSLIGLISGAIGPFSNAPLDTI 235
           + RQA NQ      Y+K+K  +Q Y N    + L S  T ++G  SG +  ++  P+DT+
Sbjct: 176 SMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTV 235

Query: 236 KTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           KTR+Q   S +  S +   T I     +EEG +A +KG TPR+ R+     + FT YE
Sbjct: 236 KTRMQSLDSKRYSSTINCFTTI----FKEEGLKAFWKGATPRLGRLFLSGGIVFTVYE 289

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 82/194 (42%), Gaps = 14/194 (7%)

Query: 14  LIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGV--KAPGFIKTGGEIYRNEGFLAF 70
           +IAG GAGL+E +    P + IK  +   K +          G ++    + R +G    
Sbjct: 109 VIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGL 168

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGNTFIAGVGAGITEAXX 126
           Y+G+  V +      A+R   Y   + ++ D     +   +S+G TF+ G  +GI     
Sbjct: 169 YRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYT 228

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   K R+Q+        + +Y + +    TI KEEG  A ++G +    R   + 
Sbjct: 229 TMPIDTV-KTRMQSLD------SKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSG 281

Query: 187 GANFTVYSKLKEFL 200
           G  FTVY K+   L
Sbjct: 282 GIVFTVYEKVLTVL 295

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 80/201 (39%), Gaps = 16/201 (7%)

Query: 103 ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTI 162
           ++ +V    +FIAG  AG  EA          K RLQ       + +   +N +   Y  
Sbjct: 3   QSKQVDPSKSFIAGCLAGAVEASVTYPFEFA-KTRLQLLD----KASKASRNPLVLIYNT 57

Query: 163 VKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISG 222
            K +G  ++Y G            G  F  +  +K  L+     E L      + GL +G
Sbjct: 58  AKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGE-LSGPRGVIAGLGAG 116

Query: 223 AI-GPFSNAPLDTIKTRLQKDKST------KNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
            +    +  P + IKT L  DK +       N  G+ R       L++++G   LY+G+ 
Sbjct: 117 LLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYT---ALVRKQGLSGLYRGVL 173

Query: 276 PRVMRVAPGQAVTFTAYEFIR 296
           P  MR A  QAV    Y  I+
Sbjct: 174 PVSMRQAANQAVRLGCYNKIK 194

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 19/105 (18%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI 61
           A K K  +  +  + G  +G++      P+DT+K RMQ   +   S       I     I
Sbjct: 203 APKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRYSST-----INCFTTI 257

Query: 62  YRNEGFLAFYKGLGAVVIGITPKM-------AIRFSSYEFYRTLL 99
           ++ EG  AF+K       G TP++        I F+ YE   T+L
Sbjct: 258 FKEEGLKAFWK-------GATPRLGRLFLSGGIVFTVYEKVLTVL 295

>Kwal_26.7967
          Length = 297

 Score =  136 bits (342), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 150/301 (49%), Gaps = 23/301 (7%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           S++K  +P  + +AG  AG +E    +P +  K R+Q+   +  +  + P  +     IY
Sbjct: 2   SQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKS-STASRNPLTL-----IY 55

Query: 63  RN---EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGA 119
           R    +G  A Y G  A ++G T K  +RF  ++  + +L D  TG++S     +AG+GA
Sbjct: 56  RTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGA 115

Query: 120 GITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKN----AVQACYTIVKEEGFSALYRGV 175
           G+ E+          K  L     +    +PKY N     ++   ++V ++GFS LYRGV
Sbjct: 116 GLLESVVAVTPFEAIKTALIDDKQS---ASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGV 172

Query: 176 SLTAARQATNQGANFTVYSKLKEFLQGYHN---QEMLPSWETSLIGLISGAIGPFSNAPL 232
              + RQA NQ      Y+K+K  +Q Y N    + L S  T ++G  SG +  ++  P+
Sbjct: 173 LPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPI 232

Query: 233 DTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
           DT+KTR+Q   S+K  S +     +     +EEG +  +KG TPR+ R+     + FT Y
Sbjct: 233 DTVKTRMQSLDSSKYSSTINCFATV----FREEGLKTFWKGATPRLGRLILSGGIVFTIY 288

Query: 293 E 293
           E
Sbjct: 289 E 289

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 83/195 (42%), Gaps = 24/195 (12%)

Query: 14  LIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++AG GAGL+E +    P + IK  +   K +      +P +   G  + RN   L + K
Sbjct: 109 IVAGLGAGLLESVVAVTPFEAIKTALIDDKQSA-----SPKYHNNGRGMLRNYSSLVYDK 163

Query: 73  GLGAVVIGITP-------KMAIRFSSYEFYRTLLAD----KETGKVSTGNTFIAGVGAGI 121
           G   +  G+ P         A+R   Y   +T++ D     +   +S+G TF+ G  +GI
Sbjct: 164 GFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGI 223

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
                        K R+Q+        + KY + +    T+ +EEG    ++G +    R
Sbjct: 224 VTVYTTMPIDTV-KTRMQSLD------SSKYSSTINCFATVFREEGLKTFWKGATPRLGR 276

Query: 182 QATNQGANFTVYSKL 196
              + G  FT+Y K+
Sbjct: 277 LILSGGIVFTIYEKV 291

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 81/202 (40%), Gaps = 16/202 (7%)

Query: 106 KVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE 165
           +V   ++F+AG  AG  EA          K RLQ       + +   +N +   Y   K 
Sbjct: 6   QVDPLHSFLAGSLAGAVEASITYPFEFA-KTRLQLVD----KSSTASRNPLTLIYRTAKV 60

Query: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAI- 224
           +G  A+Y G            G  F  +  +K  L+     E L      + GL +G + 
Sbjct: 61  QGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGE-LSGPRGIVAGLGAGLLE 119

Query: 225 GPFSNAPLDTIKTRLQKDKST------KNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
              +  P + IKT L  DK +       N  G+ R       L+ ++GF  LY+G+ P  
Sbjct: 120 SVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNY---SSLVYDKGFSGLYRGVLPVS 176

Query: 279 MRVAPGQAVTFTAYEFIRKELE 300
           MR A  QAV    Y  I+  ++
Sbjct: 177 MRQAANQAVRLGCYNKIKTMIQ 198

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI 61
           ++K K  +  +  + G  +G++      P+DT+K RMQ   ++     K    I     +
Sbjct: 203 SAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSS-----KYSSTINCFATV 257

Query: 62  YRNEGFLAFYKG 73
           +R EG   F+KG
Sbjct: 258 FREEGLKTFWKG 269

>Scas_489.4
          Length = 297

 Score =  133 bits (334), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 151/305 (49%), Gaps = 27/305 (8%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           M+ ++K  +P  + IAG  AG +E    +P +  K R+Q+  +   +  + P  +     
Sbjct: 1   MSQEKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLI-DKTSTASRNPLVL----- 54

Query: 61  IY---RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGV 117
           IY   + +G  A Y G  A ++G T K  IRF  ++  + +L D  TG++S     +AG+
Sbjct: 55  IYNTAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGL 114

Query: 118 GAGITEAXXXXXXXXXXKIRL--QAQHLNPVEGAPKYKN----AVQACYTIVKEEGFSAL 171
           GAG+ E+          K  L    Q L      PKY+N     ++   ++V+++G   L
Sbjct: 115 GAGLLESVVAVTPFEAIKTALIDDKQALK-----PKYQNNGRGMLRNYGSLVRDQGIMGL 169

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKEFLQGYHN---QEMLPSWETSLIGLISGAIGPFS 228
           YRGV   + RQA NQ      Y+K+K  +Q Y N      L S  T ++G  SG +  ++
Sbjct: 170 YRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYT 229

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVT 288
             P+DT+KTR+Q   +TK  S +        ++ +EEG +  +KG TPR+ R+     + 
Sbjct: 230 TMPIDTVKTRMQSLDATKYTSTVNCFA----KIFKEEGLKTFWKGATPRLGRLILSGGIV 285

Query: 289 FTAYE 293
           FT YE
Sbjct: 286 FTIYE 290

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 14/194 (7%)

Query: 14  LIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGVK--APGFIKTGGEIYRNEGFLAF 70
           ++AG GAGL+E +    P + IK  +   K A+    +    G ++  G + R++G +  
Sbjct: 110 VVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGL 169

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK----VSTGNTFIAGVGAGITEAXX 126
           Y+G+  V +      A+R   Y   +T++ D         +S+G TFI G  +G+     
Sbjct: 170 YRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYT 229

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   K R+Q+        A KY + V     I KEEG    ++G +    R   + 
Sbjct: 230 TMPIDTV-KTRMQSLD------ATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSG 282

Query: 187 GANFTVYSKLKEFL 200
           G  FT+Y  +  FL
Sbjct: 283 GIVFTIYENVLVFL 296

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 81/206 (39%), Gaps = 16/206 (7%)

Query: 102 KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYT 161
           +E   V   ++FIAG  AG  EA          K RLQ       + +   +N +   Y 
Sbjct: 3   QEKKPVDPLHSFIAGALAGAIEASITYPFEFA-KTRLQLID----KTSTASRNPLVLIYN 57

Query: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLIS 221
             K +G  A+Y G            G  F  +  +K  L+     E L      + GL +
Sbjct: 58  TAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGE-LSGPRGVVAGLGA 116

Query: 222 GAI-GPFSNAPLDTIKTRLQKDKST------KNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           G +    +  P + IKT L  DK         N  G+ R       L++++G   LY+G+
Sbjct: 117 GLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNY---GSLVRDQGIMGLYRGV 173

Query: 275 TPRVMRVAPGQAVTFTAYEFIRKELE 300
            P  MR A  QAV    Y  I+  ++
Sbjct: 174 LPVSMRQAANQAVRLGCYNKIKTMVQ 199

>Scas_640.25
          Length = 306

 Score =  126 bits (316), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 148/302 (49%), Gaps = 20/302 (6%)

Query: 1   MASKQKSSNPA---VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA---PGF 54
           M+S   +  P       +AG  AG+ E +  +PLD +K RMQ+  +   +G  A    G 
Sbjct: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60

Query: 55  IKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSY-EFYRTLLADKETGKVSTGNTF 113
           I    +I + EG +  YKG+ + ++   PK A++F+S  EF +   +   T +++   + 
Sbjct: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120

Query: 114 IAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYR 173
           ++G  AGITEA          KIRLQ       +   K+K  V+    I+K++G   LY 
Sbjct: 121 LSGASAGITEALVIVPFELV-KIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYS 172

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLD 233
           GV  T  R A      F V  +++E L    +++   +      G + G  G   N P D
Sbjct: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-KTRNDLCAGFVGGTFGVMFNTPFD 231

Query: 234 TIKTRLQKDKSTKNMSGLKRITIIGKQLIQ---EEGFRALYKGITPRVMRVAPGQAVTFT 290
            +K+R+Q D   + ++G+++       +++   EEGFRALYKG  P+V+R+ PG AV   
Sbjct: 232 VVKSRIQSD-GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290

Query: 291 AY 292
            +
Sbjct: 291 VF 292

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 76/193 (39%), Gaps = 7/193 (3%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           +++++G  AG+ E L   P + +K+R+Q     V S  K P  ++    I + +G    Y
Sbjct: 118 ISVLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGP--VEVLKHIIKQDGLKGLY 171

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
            G+ + V       A  F      R LL   ++ +  T N   AG   G T         
Sbjct: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTPF 230

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
              K R+Q+     + G  KY     +   I  EEGF ALY+G      R          
Sbjct: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290

Query: 192 VYSKLKEFLQGYH 204
           V++ +    + +H
Sbjct: 291 VFTNVMNVFREFH 303

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 204 HN-QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKST----KNMSGLKRITIIG 258
           HN Q  LP     + G I+G        PLD +KTR+Q   ST     + +  K +    
Sbjct: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL 64

Query: 259 KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY-EFIR 296
            Q++++EG   +YKGI+  ++  AP +AV F +  EFI+
Sbjct: 65  SQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK 103

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  119 bits (297), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 93/295 (31%), Positives = 128/295 (43%), Gaps = 27/295 (9%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI------YKNAVGSGVKAPGFIKTGGEIYRNEG 66
           N   G  AG +     +P+D IK RMQ       YKN++   +K          I   EG
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLK----------IISREG 582

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
               Y GLG  +IG+ P+ AI+ +  +F R  L DK  GK+S     I+G  AG  +   
Sbjct: 583 IKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDK-NGKLSLFPEIISGASAGACQV-I 640

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   KIRLQ Q     E     + A +    IVK+ G   LY GV+    R     
Sbjct: 641 FTNPLEIVKIRLQVQSDYVGE---NIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFS 697

Query: 187 GANFTVYSKLKEFLQGYH-----NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
              F  Y+ LK+ L  +       +  L +WE    G I+G    F   P D IKTRLQ 
Sbjct: 698 AIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQI 757

Query: 242 DKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
           D   K  +    I    + +++EE FR+ +KG   RV+R +P    T  AYE  +
Sbjct: 758 DPR-KGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFK 811

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 87/199 (43%), Gaps = 12/199 (6%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           +I+G  AG  + +  +PL+ +K+R+Q+  + VG  ++     +T  +I +  G    Y G
Sbjct: 628 IISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQAN--ETATQIVKKLGLRGLYNG 685

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLAD------KETGKVSTGNTFIAGVGAGITEAXXX 127
           + A ++   P  AI F +Y   +  L D       +  ++ T     AG  AG+  A   
Sbjct: 686 VAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMP-AAFL 744

Query: 128 XXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQG 187
                  K RLQ   ++P +G  KY     A  TI+KEE F + ++G      R +   G
Sbjct: 745 TTPFDVIKTRLQ---IDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFG 801

Query: 188 ANFTVYSKLKEFLQGYHNQ 206
                Y   K F+    N+
Sbjct: 802 FTLAAYELFKGFIPSPDNK 820

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 8/165 (4%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K R+QAQ         +YKN++     I+  EG   LY G+       A  +    TV  
Sbjct: 555 KTRMQAQ-----RSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVND 609

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254
            ++  L   + +  L  +   + G  +GA       PL+ +K RLQ  +S      +++ 
Sbjct: 610 FMRNRLTDKNGK--LSLFPEIISGASAGACQVIFTNPLEIVKIRLQV-QSDYVGENIQQA 666

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
                Q++++ G R LY G+   +MR  P  A+ F  Y  ++K+L
Sbjct: 667 NETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDL 711

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276
           +G I+G IG     P+D IKTR+Q  +S   ++  K       ++I  EG + LY G+ P
Sbjct: 536 LGSIAGCIGATVVYPIDFIKTRMQAQRS---LAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 277 RVMRVAPGQAVTFTAYEFIRKEL 299
           +++ VAP +A+  T  +F+R  L
Sbjct: 593 QLIGVAPEKAIKLTVNDFMRNRL 615

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  112 bits (280), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 138/295 (46%), Gaps = 33/295 (11%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQI-YKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
            ++G  AG+ E L  +PLD +K RMQ+   +  GSGV   G I   G+I + EGF   YK
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKE-TGKVSTGNTFIAGVGAGITEAXXXXXXX 131
           G+ + ++   PK A +F+  + Y+ +  D     K++   + ++G  AG+TEA       
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEA-CVIVPF 130

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
              KIRLQ  +        K+   ++  +  ++E G  +LY G+  T  R A   G  F 
Sbjct: 131 ELVKIRLQDVN-------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183

Query: 192 VYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFS-----NAPLDTIKTRLQKDKSTK 246
           V  +++  L            E +   LI+G IG +      +  L  +K+R+Q   +T 
Sbjct: 184 VIFQIRALLPKAKTNT-----EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238

Query: 247 NMSGLKRITIIGK---------QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
              G    T++ K         ++  EEGF ALYKG  P+++R+ PG  +    +
Sbjct: 239 LADG----TVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 75/193 (38%), Gaps = 9/193 (4%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           +++++G  AG+ E     P + +K+R+Q     V S    P  ++   +  R  G L+ Y
Sbjct: 111 ISILSGSLAGVTEACVIVPFELVKIRLQ----DVNSKFNGP--MEVVFKTIRETGILSLY 164

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
            GL + +          F      R LL   +T    T N  IAG   G           
Sbjct: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTIL 224

Query: 132 XXXKIRLQAQHLNPVEG---APKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188
              K R+Q+     +      PKY     + + I  EEGF+ALY+G      R     G 
Sbjct: 225 SVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGI 284

Query: 189 NFTVYSKLKEFLQ 201
              V++ +  F Q
Sbjct: 285 MLVVFNGMMAFFQ 297

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAVT 288
           PLD +KTR+Q    +   SG+    +I    Q+++ EGF  LYKGI+  ++  AP +A  
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 289 FT---AYEFIRKEL 299
           F    +Y+ + K+L
Sbjct: 88  FACNDSYQKMFKDL 101

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  115 bits (289), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 87/293 (29%), Positives = 128/293 (43%), Gaps = 27/293 (9%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI------YKNAVGSGVKAPGFIKTGGEIYRNEG 66
           N   G  AG +     +P+D +K RMQ       YKN++   +K          I   EG
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLK----------ILSREG 595

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
               Y GLG  +IG+ P+ AI+ +  ++ R  L DK  GK+   +  I+G  AG  +   
Sbjct: 596 IRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDK-NGKLGLLSEIISGASAGACQV-I 653

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   KIRLQ +     E A   +NA      I+K  G   LY+G +    R     
Sbjct: 654 FTNPLEIVKIRLQVKGEYVAENA---ENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFS 710

Query: 187 GANFTVYSKLKEFLQGY-----HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
              F  Y+ LK  L  +     + +  L +WE    G ++G    +   P D IKTRLQ 
Sbjct: 711 AIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQI 770

Query: 242 DKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
           D   K  +  K I    + +++EE F++ +KG   RV+R +P    T  AYE 
Sbjct: 771 DPK-KGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276
           +G ++G IG     P+D +KTR+Q  +S   +S  K       +++  EG R +Y G+ P
Sbjct: 549 LGSVAGCIGATIVYPIDFVKTRMQAQRS---LSQYKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 277 RVMRVAPGQAVTFTAYEFIRKELE 300
           +++ VAP +A+  T  +++R +L+
Sbjct: 606 QLIGVAPEKAIKLTVNDYMRNKLK 629

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 44/166 (26%), Positives = 74/166 (44%), Gaps = 10/166 (6%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K R+QAQ         +YKN++     I+  EG   +Y G+       A  +    TV  
Sbjct: 568 KTRMQAQ-----RSLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVND 622

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-KDKSTKNMSGLKR 253
            ++  L+  + +  L S   S  G  +GA       PL+ +K RLQ K +     +   +
Sbjct: 623 YMRNKLKDKNGKLGLLSEIIS--GASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAK 680

Query: 254 ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +T +  Q+I+  G   LYKG    ++R  P  A+ F  Y  ++++L
Sbjct: 681 LTAL--QIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDL 724

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L AG  AG+       P D IK R+QI      +  K  G I     I R E F +F+KG
Sbjct: 744 LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYK--GIIHAARTILREESFKSFFKG 801

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLL 99
             A V+  +P+     ++YE +  + 
Sbjct: 802 GAARVLRSSPQFGFTLAAYELFHNIF 827

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  110 bits (274), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 133/301 (44%), Gaps = 25/301 (8%)

Query: 1   MASKQKSSNPAV-NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGG 59
           M+S    S P +    AG  AG+ E L  +PLD +K RMQ+     G+G    G +    
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-GAGPHYTGVVDCLK 59

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-ETGKVSTGNTFIAGVG 118
           +I   EG    YKG+ + ++   PK A +F+  + ++ L        K+S   + +AG  
Sbjct: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGAS 119

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
           AG  EA          KIRLQ       + +  YK  V     IV  EG  A+Y G+  T
Sbjct: 120 AGCVEAFVVVPFELV-KIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLEST 171

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIG-LISGAIGPFSNAPLDTIKT 237
             R A   G  F +  + +  L   HN+    +    LI   I  +IG   + P D +K+
Sbjct: 172 LWRHALWNGGYFGIIFQARALLPAAHNKTQCIT--NDLISDSIGCSIGCMLSTPFDVVKS 229

Query: 238 RLQKDKSTK------NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTA 291
           R+Q            N S    +TI      +EEGFRALYKG  P+V+R+ PG  +    
Sbjct: 230 RIQNTAVIPGVVRKYNWSLPSLLTIY-----REEGFRALYKGFVPKVLRLGPGGGILLVV 284

Query: 292 Y 292
           +
Sbjct: 285 F 285

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 79/200 (39%), Gaps = 9/200 (4%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN 64
           +K S P ++++AG  AG +E     P + +K+R+Q       S  K P  +    +I   
Sbjct: 106 EKLSQP-LSMLAGASAGCVEAFVVVPFELVKIRLQ----DASSSYKGP--VDVVRKIVAR 158

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124
           EG LA Y GL + +          F      R LL           N  I+    G +  
Sbjct: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCITNDLISD-SIGCSIG 217

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     K R+Q   + P     KY  ++ +  TI +EEGF ALY+G      R   
Sbjct: 218 CMLSTPFDVVKSRIQNTAVIP-GVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

Query: 185 NQGANFTVYSKLKEFLQGYH 204
             G    V++ + +F +  H
Sbjct: 277 GGGILLVVFTGVLDFCRAIH 296

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%)

Query: 205 NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264
           + + LP       G ++G        PLD +KTR+Q             +    K+++  
Sbjct: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           EG   LYKGI+  ++  AP +A  F   +  +K
Sbjct: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97

>Scas_589.10
          Length = 316

 Score =  107 bits (268), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 140/301 (46%), Gaps = 39/301 (12%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVR--MQIYKNAVG-SGVKAP------GFIKTGGEIYR 63
             I+G  AG+ E +  +PLD +K R  +QI K A+  S V  P        +    +I +
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-ETGKVSTGNTFIAGVGAGIT 122
            EGF   YKG+   ++   PK A++F+S E ++ ++  K +  +V++  T +AG  AGIT
Sbjct: 76  EEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGIT 135

Query: 123 EAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQ 182
           E+          KIRLQ       +    Y++ ++   TI++ +G   +Y G   T  R 
Sbjct: 136 ES-LIVVPFELVKIRLQ-------DAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRN 187

Query: 183 ATNQGANFTVYSKLKEFL---------QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLD 233
                + F +  ++K+F+         QG  N          L+G I+G +  F + P D
Sbjct: 188 TIWNASYFGLIFQVKKFIPRAKSTTKFQGIRND--------FLVGAIAGCMSCFLSVPFD 239

Query: 234 TIKTRLQKDKSTKN--MSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTA 291
            +KTR+Q  K T +    G    ++    + + EG + +YKGI P + R  PG  +    
Sbjct: 240 VVKTRMQGSKKTSSGMCYGWAWQSVF--LIYRTEGIKGIYKGILPIICRYGPGGGLLLVV 297

Query: 292 Y 292
           +
Sbjct: 298 F 298

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 16/189 (8%)

Query: 101 DKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLN---------PVEGAPK 151
           DK+  K+     FI+G  AG++E           K R Q Q +N          V   P+
Sbjct: 5   DKDPVKLPFIYQFISGAVAGMSETIMMYPLDVV-KTRFQLQ-INKKALATSSVAVPKQPE 62

Query: 152 YKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS 211
           + + +     I+KEEGF  LY+G+S     +   +   F    + ++ +      + + S
Sbjct: 63  HSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTS 122

Query: 212 WETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALY 271
             T L G  +G        P + +K RLQ  +S  +     R T   + +I+ +G   +Y
Sbjct: 123 TVTLLAGTFAGITESLIVVPFELVKIRLQDAQS--DYRSPIRCT---RTIIENQGLFGIY 177

Query: 272 KGITPRVMR 280
            G    + R
Sbjct: 178 AGFESTIWR 186

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 76/200 (38%), Gaps = 11/200 (5%)

Query: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR 63
           K K     V L+AG  AG+ E L   P + +K+R+Q       S  ++P  I+    I  
Sbjct: 116 KLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQ----DAQSDYRSP--IRCTRTIIE 169

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFS-SYEFYRTLLADKETGKVS-TGNTFIAGVGAGI 121
           N+G    Y G  + +   T   A  F   ++  + +   K T K     N F+ G  AG 
Sbjct: 170 NQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGC 229

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
                        K R+Q            Y  A Q+ + I + EG   +Y+G+     R
Sbjct: 230 MSC-FLSVPFDVVKTRMQGS--KKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICR 286

Query: 182 QATNQGANFTVYSKLKEFLQ 201
                G    V++ + E  +
Sbjct: 287 YGPGGGLLLVVFNGVNELFR 306

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 219 LISGAIGPFSNA----PLDTIKTRLQ-----KDKSTKNMSGLKR-----ITIIGKQLIQE 264
            ISGA+   S      PLD +KTR Q     K  +T +++  K+     I     ++++E
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           EGF+ LYKG++P ++   P +AV F + E
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNE 105

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  111 bits (277), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 84/292 (28%), Positives = 129/292 (44%), Gaps = 28/292 (9%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI------YKNAVGSGVKAPGFIKTGGEIYRNEG 66
           N   G  AG +  +  +P+D +K RMQ       YKN++   +K          I   EG
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLK----------ILSKEG 576

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
               Y GLG  +IG+ P+ AI+ +  +  R  LA ++ GK+S     I+G  AG  +   
Sbjct: 577 VRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRD-GKLSLPCEIISGATAGACQV-V 634

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   KIRLQ +     + A    NA+    +++K  G   LYRG      R     
Sbjct: 635 FTNPLEIVKIRLQVKSDYVADAARNSVNAI----SVIKNLGLIGLYRGAGACLLRDIPFS 690

Query: 187 GANFTVYSKLKEFLQGYHNQE-----MLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
              F  Y+ +K  +  +  ++      L +W+  + G ++G    F   P D IKTRLQ 
Sbjct: 691 AIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQI 750

Query: 242 DKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           D   K  S    I    + +++EEG ++ +KG   RV+R +P    T  AYE
Sbjct: 751 DPK-KGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYE 801

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276
           +G ++G IG     P+D +KTR+Q   + ++ S  K       +++ +EG R LY G+ P
Sbjct: 530 LGSVAGCIGAMVVYPIDMVKTRMQ---AQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 277 RVMRVAPGQAVTFTAYEFIRKEL 299
           +++ VAP +A+  T  + +R  L
Sbjct: 587 QLIGVAPEKAIKLTVNDHMRATL 609

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L++GG AG+       P D IK R+QI     G  V   G       I + EG  +F+KG
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKK-GESVYN-GIWDAARTILKEEGIKSFFKG 781

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLL 99
             A V+  +P+     ++YE +  L 
Sbjct: 782 GPARVLRSSPQFGFTLAAYEIFHNLF 807

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  106 bits (265), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 86/297 (28%), Positives = 138/297 (46%), Gaps = 37/297 (12%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKN-----AVGSGV-KAPGFIKTGGEIYRNEGF 67
            I+G  AG+ E    +PLD +K R Q+        AVG  V +  G I    +I + EGF
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-ETGKVSTGNTFIAGVGAGITEAXX 126
              Y+G+ + ++   PK A +F+  + Y+ +  +   T + +   +  AG  AG+TEA  
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAV 135

Query: 127 XXXXXXXXKIRLQ---AQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                   KIR+Q   + +L P++   K           +K EG   LY+G+  T  R A
Sbjct: 136 IVPFELI-KIRMQDVKSSYLGPMDCLKK----------TIKNEGIMGLYKGIESTMWRNA 184

Query: 184 TNQGANFTVYSKLKEFL-----QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTR 238
              G  F V  +++  +     +G   +  L      + G I G +G   N P D +K+R
Sbjct: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSR 238

Query: 239 LQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
           +Q   +    S +K+       L+   +EEGFRALYKG  P+V R+APG ++    +
Sbjct: 239 IQSVDAVS--SAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 78/191 (40%), Gaps = 10/191 (5%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           +++ AG  AG+ E     P + IK+RMQ  K++        G +    +  +NEG +  Y
Sbjct: 120 ISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSY------LGPMDCLKKTIKNEGIMGLY 173

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
           KG+ + +          F      R  +   +T    T N  IAG   G T         
Sbjct: 174 KGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPF 232

Query: 132 XXXKIRLQAQHLNPVEGA-PKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
              K R+Q+  ++ V  A  KY   + +   I +EEGF ALY+G      R A       
Sbjct: 233 DVVKSRIQS--VDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290

Query: 191 TVYSKLKEFLQ 201
            V++ +  F +
Sbjct: 291 VVFTGMMNFFR 301

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 14/95 (14%)

Query: 219 LISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKR-------ITIIGKQLIQEEGF 267
            ISGA+   S      PLD +KTR Q + +T   + + +       +    K+++++EGF
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 268 RALYKGITPRVMRVAPGQAVTFTA---YEFIRKEL 299
             LY+GI+  ++  AP +A  F     Y+ I K L
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 9/99 (9%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGF-IKTGGEIYR 63
           QK+ N   +LIAG   G +  +   P D +K R+Q   +AV S VK   + + +   IYR
Sbjct: 209 QKTRN---DLIAGAIGGTVGTMLNTPFDVVKSRIQSV-DAVSSAVKKYNWCLPSLLVIYR 264

Query: 64  NEGFLAFYKGLGAVVIGITP---KMAIRFSS-YEFYRTL 98
            EGF A YKG    V  + P    M + F+    F+R L
Sbjct: 265 EEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRDL 303

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score =  106 bits (264), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 93/301 (30%), Positives = 155/301 (51%), Gaps = 20/301 (6%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           MA  ++ ++ A + +AG  AG +EG   +P +  K R+Q+ +   G   + P  +     
Sbjct: 1   MARSREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGES-RNPLVLLY--R 57

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
             R +G  A Y G  A V+G T K  +RF  ++  R  L D E G +S     +AG+GAG
Sbjct: 58  TARTQGAGALYVGCPAFVVGNTCKAGVRFLGFDALRRALQD-ERGALSGPRGMLAGLGAG 116

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGA-PKYKN----AVQACYTIVKEEGFSALYRGV 175
           + E+          K  L    ++  + A P+Y++    A +    +++E G   LY G+
Sbjct: 117 LLESVLAVTPFEAVKTAL----IDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGL 172

Query: 176 SLTAARQATNQGANFTVYSKLKEFLQGYHN---QEMLPSWETSLIGLISGAIGPFSNAPL 232
              A RQA+NQ   F  Y++LK+ +Q Y      + L S +T L+G +SG +  ++  P+
Sbjct: 173 VPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPV 232

Query: 233 DTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
           DT+KTR+Q   + +  S +       + +++EEG RAL++G TPR+ R+     + FTAY
Sbjct: 233 DTVKTRMQALDAARYGSTVGCF----RAVVREEGVRALWRGATPRLGRLVLSGGIVFTAY 288

Query: 293 E 293
           E
Sbjct: 289 E 289

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 81/202 (40%), Gaps = 30/202 (14%)

Query: 14  LIAGGGAGLMEG-LCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++AG GAGL+E  L   P + +K  +   + A       P +   G    RN   L    
Sbjct: 109 MLAGLGAGLLESVLAVTPFEAVKTALIDDRQAA-----RPRYQHNGRGAARNYALLLREL 163

Query: 73  GLGAVVIGITP-------KMAIRFSSY-------EFYRTLLADKETGKVSTGNTFIAGVG 118
           GL  +  G+ P         A+RF  Y       + Y    AD+  G   +G TF+ G  
Sbjct: 164 GLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLG---SGQTFLVGAL 220

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
           +GI             K R+QA        A +Y + V     +V+EEG  AL+RG +  
Sbjct: 221 SGIVTVYATMPVDTV-KTRMQALD------AARYGSTVGCFRAVVREEGVRALWRGATPR 273

Query: 179 AARQATNQGANFTVYSKLKEFL 200
             R   + G  FT Y KL   L
Sbjct: 274 LGRLVLSGGIVFTAYEKLLVLL 295

>Scas_602.8
          Length = 885

 Score =  108 bits (271), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 130/298 (43%), Gaps = 33/298 (11%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI------YKNAVGSGVKAPGFIKTGGEIYRNEG 66
           N   G  AG +     +P+D IK RMQ       YKN++   VK          I+  EG
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVK----------IFGKEG 550

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
               Y GLG  +IG+ P+ AI+ +  +F R  L DK+ G +  G   ++G  AG  +   
Sbjct: 551 IRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKK-GNLQLGAEVLSGATAGACQV-V 608

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   KIRLQ +        PK   +    + I+KE     LY+GV     R     
Sbjct: 609 FTNPLEIVKIRLQVKSEYTNAMIPK---SQLTAFQIIKELKLIGLYKGVGACLLRDVPFS 665

Query: 187 GANFTVYSKLKEFLQGY-----HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
              F  Y+ LK+ +  +       ++ L +WE    G ++G    F   P D IKTRLQ 
Sbjct: 666 AIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQI 725

Query: 242 DKSTKNMSGLKRITII---GKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
           +       G  R T I    + +++EE FR+ +KG   RVMR +P    T  AYE  +
Sbjct: 726 EPGV----GETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFK 779

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 10/102 (9%)

Query: 203 YHNQEMLPSWETSL---IGLISGAIGPFSNAPLDTIKTRLQKDKS-TKNMSGLK-RITII 257
           Y N    P +++     +G ++G IG     P+D IKTR+Q  +S TK  + +   + I 
Sbjct: 487 YRNYYFYPIFDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIF 546

Query: 258 GKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           GK     EG R LY G+ P+++ VAP +A+  T  +F+RK L
Sbjct: 547 GK-----EGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSL 583

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 71/165 (43%), Gaps = 8/165 (4%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K R+QAQ         KYKN++     I  +EG   LY G+       A  +    TV  
Sbjct: 523 KTRMQAQ-----RSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIKLTVND 577

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254
            +++ L        L +    L G  +GA       PL+ +K RLQ  KS    + + + 
Sbjct: 578 FMRKSLVDKKGNLQLGA--EVLSGATAGACQVVFTNPLEIVKIRLQV-KSEYTNAMIPKS 634

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            +   Q+I+E     LYKG+   ++R  P  A+ F  Y  ++K +
Sbjct: 635 QLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNV 679

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 82/202 (40%), Gaps = 32/202 (15%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L AG  AG+       P D IK R+QI +  VG   +  G +     I + E F +F+KG
Sbjct: 699 LTAGALAGVPAAFLTTPFDVIKTRLQI-EPGVGE-TRYTGILHAVRTILKEESFRSFFKG 756

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLL---ADKE-TGKVSTGNTFIAGVGAGITEAXXXXX 129
             A V+  +P+     ++YE ++ +     DK+ T    +   +   VG G         
Sbjct: 757 GAARVMRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTEDYNDSVGTGYP------- 809

Query: 130 XXXXXKIRLQAQHLNPVEGAPKYKNAVQAC-YTIVKEEGFSALYRGVSLTAARQA----- 183
                     +   + ++  P Y  + Q   Y   + + F++ Y      + + A     
Sbjct: 810 ----------SSFFSSMKYTPSYSYSNQPTEYFSPRIDPFTSNYLDYYFKSCQVAKTFID 859

Query: 184 -TNQGANF--TVYSKLKEFLQG 202
             N  +NF  +VYSK +++L  
Sbjct: 860 LDNNFSNFDYSVYSKFRDYLNS 881

>Kwal_47.17321
          Length = 881

 Score =  107 bits (267), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 126/289 (43%), Gaps = 22/289 (7%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           N + G  AG +     +P+D +K RMQ  +N          F+K    I+  EG    Y 
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVK----IFSREGIRGIYS 558

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           GLG  ++G+ P+ AI+ +  ++ R LL D E  +++     I+G  AG  +         
Sbjct: 559 GLGPQLVGVAPEKAIKLTVNDYVRKLLMD-ENNRLTLPLEIISGAAAGACQV-IFTNPLE 616

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             KIRLQ +     E A     +      +VK  G   LY+G+     R        F  
Sbjct: 617 IVKIRLQVRS----EYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 193 YSKLKEFLQGYHNQE-----MLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKN 247
           Y+ LK  +  Y  Q+      L +WE    G ++G    +   P D IKTRLQ D     
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPR--- 729

Query: 248 MSGLKRITII---GKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
             G  R T I    + +++EE F++ +KG   RV+R +P    T  AYE
Sbjct: 730 -KGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYE 777

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQI---YKNAV-GSGVKAPGFIKTGGEIYRNEGF 67
           + +I+G  AG  + +  +PL+ +K+R+Q+   Y +++  S + A G +K+ G        
Sbjct: 596 LEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLG-------L 648

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSY-----EFYRTLLADK-ETGKVSTGNTFIAGVGAGI 121
              YKGL A ++   P  AI F +Y     + +     DK +  ++ T     AG  AG+
Sbjct: 649 RGLYKGLVACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGM 708

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
             A          K RLQ   ++P +G  +Y   + A  TI+KEE F + ++G      R
Sbjct: 709 P-AAYLTTPFDVIKTRLQ---IDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLR 764

Query: 182 QATNQGANFTVYSKLKEF--LQGYHNQEMLPSWETSLIGLISGAIGPF 227
            +   G     Y   +    LQ   N E   S ET+   +++G    F
Sbjct: 765 SSPQFGFTLAAYEIFQNMFPLQHSENNE---SRETNDTPIVTGMFSNF 809

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 78/170 (45%), Gaps = 19/170 (11%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K R+QAQ         +YKN++     I   EG   +Y G+       A  +    TV  
Sbjct: 525 KTRMQAQ-----RNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIKLTVND 579

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIG-----PFSNAPLDTIKTRLQKDKSTKNMS 249
            +++ L   +N+  LP      + +ISGA        F+N PL+ +K RLQ      +  
Sbjct: 580 YVRKLLMDENNRLTLP------LEIISGAAAGACQVIFTN-PLEIVKIRLQVRSEYADSL 632

Query: 250 GLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
              ++T +G  +++  G R LYKG+   +MR  P  A+ F  Y  +++++
Sbjct: 633 PKSQLTALG--VVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKRDI 680

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 6/100 (6%)

Query: 203 YHNQEMLPSWET---SLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
           Y N    P +++    L+G ++G IG  +  P+D +KTR+Q   + +N S  K       
Sbjct: 489 YTNFYFFPIFDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQ---AQRNFSQYKNSIDCFV 545

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           ++   EG R +Y G+ P+++ VAP +A+  T  +++RK L
Sbjct: 546 KIFSREGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLL 585

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  106 bits (264), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 80/295 (27%), Positives = 128/295 (43%), Gaps = 28/295 (9%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI------YKNAVGSGVKAPGFIKTGGEIYRNEG 66
           N   G  AG +     +P+D +K RMQ       YKN++    K          I+  EG
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAK----------IFSREG 570

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
               Y GLG  +IG+ P+ AI+ +  ++ R  L DK    +      ++G  AG  +   
Sbjct: 571 IRGIYSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKH-ANLKWYFEILSGACAGACQV-V 628

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   KIRLQ +     E A     +      ++K+ G   LY+G++    R     
Sbjct: 629 FTNPLEVVKIRLQVRS----EYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFS 684

Query: 187 GANFTVYSKLKEFLQGY-----HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
              F  Y+ LK+ +  Y       +  L +WE  + G ++G    +   P D IKTRLQ 
Sbjct: 685 AIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQI 744

Query: 242 DKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
           D   K  +  + I    + +++EE F++ +KG + RV+R +P    T  AYE  +
Sbjct: 745 DPR-KGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQ 798

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 71/165 (43%), Gaps = 9/165 (5%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K R+QAQ         +YKN++     I   EG   +Y G+       A  +    TV  
Sbjct: 543 KTRMQAQ-----RSFSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIKLTVND 597

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254
            ++  L   H    L  +   L G  +GA       PL+ +K RLQ            ++
Sbjct: 598 YMRGRLMDKHAN--LKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQV 655

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           T +G  +I++ G + LYKGI   +MR  P  A+ F  Y  ++K++
Sbjct: 656 TALG--VIKQLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDV 698

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 3/83 (3%)

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276
           +G I+G IG     P+D +KTR+Q  +S    S  K       ++   EG R +Y G+ P
Sbjct: 524 LGSIAGCIGATVVYPIDLVKTRMQAQRS---FSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 277 RVMRVAPGQAVTFTAYEFIRKEL 299
           +++ VAP +A+  T  +++R  L
Sbjct: 581 QLIGVAPEKAIKLTVNDYMRGRL 603

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L+AGG AG+       P D IK R+QI  +      +  G       I + E F +F+KG
Sbjct: 718 LVAGGLAGMPAAYLTTPFDVIKTRLQI--DPRKGETRYEGIFHAARTILKEESFKSFFKG 775

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADK 102
             A V+  +P+     ++YE ++ +   K
Sbjct: 776 GSARVLRSSPQFGFTLAAYEIFQNMFPLK 804

>Kwal_26.8669
          Length = 296

 Score =  102 bits (254), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 127/284 (44%), Gaps = 22/284 (7%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           AG  AG+ E L  +PLD +K RMQ+  +  G G +  G +    +I   EG    YKG+ 
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSG-GLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73

Query: 76  AVVIGITPKMAIRFS-SYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXX 134
           + V+   PK A +F+ + EF +    +    K++   + ++G  AG  EA          
Sbjct: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV- 132

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           KIRLQ       + +  YK  +     I+ +EG  A+Y G+  T  R        F +  
Sbjct: 133 KIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK------NM 248
           +++  L    ++    +    + G I G IG   + P D +K+R+Q            N 
Sbjct: 186 QVRALLPEAKSKSQ-QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244

Query: 249 SGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
           S     TI      +EEGFRALYKG  P+V+R+ PG  +    +
Sbjct: 245 SWPSIFTIY-----KEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 82/194 (42%), Gaps = 8/194 (4%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           ++++++G  AG  E     P + +K+R+Q     V S  K P  I    +I   EG LA 
Sbjct: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQ----DVSSSYKGP--IDVVRKIIAQEGVLAM 162

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXX 130
           Y GL + +       A  F      R LL + ++    T N  IAG   G T        
Sbjct: 163 YNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGG-TIGSLMSTP 221

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
               K R+Q   +    GA KY  +  + +TI KEEGF ALY+G      R     G   
Sbjct: 222 FDVVKSRIQNTAVV-AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILL 280

Query: 191 TVYSKLKEFLQGYH 204
            V++   +F +  H
Sbjct: 281 VVFTGCMDFFRTLH 294

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 73/170 (42%), Gaps = 12/170 (7%)

Query: 113 FIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGA--PKYKNAVQACYTIVKEEGFSA 170
           F AG  AGI+E           K R+Q Q    V G   P+YK  V     IV +EG S 
Sbjct: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCIKQIVAKEGASR 67

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
           LY+G+S     +A  +   F    + ++  +     E L    + L G  +G    F   
Sbjct: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280
           P + +K RLQ   S+      K    + +++I +EG  A+Y G+   + R
Sbjct: 128 PFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 44/100 (44%), Gaps = 4/100 (4%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           +K KS     +LIAG   G +  L   P D +K R+Q      G   K      +   IY
Sbjct: 194 AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY 253

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSY----EFYRTL 98
           + EGF A YKG    V+ + P   I    +    +F+RTL
Sbjct: 254 KEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%)

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFT 290
           PLD +KTR+Q   S       K +    KQ++ +EG   LYKGI+  V+  AP +A  F 
Sbjct: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88

Query: 291 AYEFIRK 297
             +  +K
Sbjct: 89  CNDEFQK 95

>Scas_582.7
          Length = 329

 Score =  102 bits (255), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 128/285 (44%), Gaps = 17/285 (5%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L+AG  AG+ME     P+D +K R+Q      G+   +   IK   +I   EG LA +KG
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQ-STTTKGTEQTSTSIIKQISKISTMEGSLALWKG 98

Query: 74  LGAVVIGITPKMAIRFSSYEFYRT-LLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           + +V++G  P  A+ F++YEF +  L+ D +          ++G  A +  +        
Sbjct: 99  VQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVA-SDFFMNPFD 157

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             K R+Q   L       K  N  +  Y +   EG SA Y     T A        NF +
Sbjct: 158 TIKQRMQISDLK----KEKVYNVAKKIYNL---EGLSAFYYSYPTTIAMNIPFAAFNFMI 210

Query: 193 YSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-KDKSTKNMSGL 251
           Y    +F    H+   L      L G ISGAI      PLD IKT +Q +  S  ++  +
Sbjct: 211 YESASKFFNPLHHYNPLIH---CLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVM 267

Query: 252 KRITIIGK---QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           K+     K    ++   G++  ++G+ PR++   P  A+++TAYE
Sbjct: 268 KKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 76/205 (37%), Gaps = 21/205 (10%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           S++++  P    ++G  A +      +P DTIK RMQI      S +K         +IY
Sbjct: 128 SQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQI------SDLKKEKVYNVAKKIY 181

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122
             EG  AFY      +      M I F+++ F     A K    +   N  I  +  GI+
Sbjct: 182 NLEGLSAFYYSYPTTI-----AMNIPFAAFNFMIYESASKFFNPLHHYNPLIHCLCGGIS 236

Query: 123 EAXXXXXXXXXXKIRLQAQ-------HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGV 175
            A           I+   Q        L  ++ A  +K A  A   +   +GF   +RG+
Sbjct: 237 GAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGF---WRGL 293

Query: 176 SLTAARQATNQGANFTVYSKLKEFL 200
                        ++T Y   K FL
Sbjct: 294 QPRILANMPATAISWTAYECAKHFL 318

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 216 LIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNMSGLKRITIIGKQLIQEEGFRALY 271
           L G  +G +   +  P+D +KTR+Q    K     + S +K+I+ I       EG  AL+
Sbjct: 41  LAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTM----EGSLALW 96

Query: 272 KGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           KG+   ++   P  AV F  YEF +  L
Sbjct: 97  KGVQSVILGAGPAHAVYFATYEFTKAHL 124

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 68/193 (35%), Gaps = 26/193 (13%)

Query: 110 GNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE---- 165
            +  +AG  AGI E           K R+Q+      E         Q   +I+K+    
Sbjct: 37  SHQLLAGAFAGIME-HSTMFPIDALKTRIQSTTTKGTE---------QTSTSIIKQISKI 86

Query: 166 ---EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISG 222
              EG  AL++GV              F  Y   K  L     +E     + ++ G  + 
Sbjct: 87  STMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATAT 146

Query: 223 AIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITI--IGKQLIQEEGFRALYKGITPRVMR 280
               F   P DTIK R+Q       +S LK+  +  + K++   EG  A Y      +  
Sbjct: 147 VASDFFMNPFDTIKQRMQ-------ISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAM 199

Query: 281 VAPGQAVTFTAYE 293
             P  A  F  YE
Sbjct: 200 NIPFAAFNFMIYE 212

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  103 bits (258), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 77/289 (26%), Positives = 127/289 (43%), Gaps = 16/289 (5%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           N   G  AG +     +P+D +K RMQ  +N+V         +K    I++ +G    Y 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVK----IFQTKGIRGLYS 562

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           GLG  +IG+ P+ AI+ +  +F R    +K +  +      ++G  AG  +         
Sbjct: 563 GLGPQLIGVAPEKAIKLTVNDFMRQYFMNK-SRTIKWYQEILSGATAGACQV-VFTNPLE 620

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             KIRLQ +     E A     AV     I+++ G   LY+G +    R        F  
Sbjct: 621 IVKIRLQMRSDYVGENARPQLGAV----GIIRQLGLRGLYKGAAACLLRDVPFSAIYFPT 676

Query: 193 YSKLKEFLQGY-----HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKN 247
           Y+ LK+ +  +     + +  L +WE  L G I+G    +   P D IKTRLQ D   K 
Sbjct: 677 YAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPR-KG 735

Query: 248 MSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
            +    +    + +++EE  ++ +KG   RV+R +P    T  A+E  +
Sbjct: 736 ETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQ 784

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 76/166 (45%), Gaps = 11/166 (6%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K R+QAQ  N V+    YKN++     I + +G   LY G+       A  +    TV  
Sbjct: 529 KTRMQAQR-NSVQ----YKNSIDCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAIKLTVND 583

Query: 195 KLKEFLQGYHNQEMLPSWETSLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR 253
            ++++   + N+     W   ++ G  +GA       PL+ +K RLQ        +   +
Sbjct: 584 FMRQY---FMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQ 640

Query: 254 ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +  +G  +I++ G R LYKG    ++R  P  A+ F  Y  ++K++
Sbjct: 641 LGAVG--IIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDV 684

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 3/81 (3%)

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276
           +G I+G IG     P+D +KTR+Q  +++          +   ++ Q +G R LY G+ P
Sbjct: 510 LGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVV---KIFQTKGIRGLYSGLGP 566

Query: 277 RVMRVAPGQAVTFTAYEFIRK 297
           +++ VAP +A+  T  +F+R+
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQ 587

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 131/297 (44%), Gaps = 25/297 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++ AG   G+ + L   P DT KVR+Q  K  +G        I+    + RNEG LAFYK
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIG-------VIEVVQNLLRNEGALAFYK 81

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVST--------GNTFIAGVGAGITEA 124
           G+   ++G+   ++++F   E  +   A     +V             ++ G+  G+  +
Sbjct: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     +IRLQ Q     E   ++K        + K +   AL RG+  T  R   
Sbjct: 142 FLAAPIEHV-RIRLQTQTSQGNER--QFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGH 195

Query: 185 NQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242
             G  F  Y  L  KEF +G    + +P+W+    G +SG I   +  P+D +K+ LQ D
Sbjct: 196 GLGTYFAAYEALVVKEFEKGTPRNQ-IPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTD 254

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            S +N      I    + L ++ G  A +KG  P ++R AP  A TF ++E   + L
Sbjct: 255 -SIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score =  102 bits (255), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 143/314 (45%), Gaps = 34/314 (10%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKV----RMQIYK--------------NAVGSGVKAPGFI 55
            IAGG +G++   C  P D IKV    R  +                NA  S +K+P  I
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSP-LI 261

Query: 56  KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGN 111
           K    +YR  G  AFY G G  V+ + P+ AI+F S+E  + ++A     K+T ++S  +
Sbjct: 262 KAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLS 321

Query: 112 TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSAL 171
           T+IAG G G   A          K R+Q   LN      K    +Q    + ++ G    
Sbjct: 322 TYIAG-GLGGVAAQFSVYPIDTLKYRIQCAPLNT--NLKKSSILLQTAKEMYQQGGIRLF 378

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
           YRGV +           +   +S LK+ +++    +  LP  E  +  LI   +G FS  
Sbjct: 379 YRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGT 438

Query: 231 -------PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAP 283
                  P++ ++TRLQ   +  +       + + K+ IQ EG++ L+KG+ P + +V P
Sbjct: 439 VGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCP 498

Query: 284 GQAVTFTAYEFIRK 297
             ++++  YE +++
Sbjct: 499 AVSISYLCYENLKR 512

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 82/198 (41%), Gaps = 17/198 (8%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPG-FIKTGGEIYRNEGFLAFYKG 73
           IAGG  G+      +P+DT+K R+Q     + + +K     ++T  E+Y+  G   FY+G
Sbjct: 324 IAGGLGGVAAQFSVYPIDTLKYRIQC--APLNTNLKKSSILLQTAKEMYQQGGIRLFYRG 381

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGK-------VSTGNTFIAGVGA-GITEAX 125
           +   V+GI P  A+   ++   +     KE  K       V   N  +  +GA   T   
Sbjct: 382 VHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGA 441

Query: 126 XXXXXXXXXKIRLQAQ--HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                    + RLQAQ  + +P      Y          ++ EG+  L++G+    A+  
Sbjct: 442 TLVYPINLLRTRLQAQGTYAHP----HTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVC 497

Query: 184 TNQGANFTVYSKLKEFLQ 201
                ++  Y  LK  ++
Sbjct: 498 PAVSISYLCYENLKRLMK 515

>Scas_718.5
          Length = 324

 Score =  100 bits (250), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 136/297 (45%), Gaps = 25/297 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +++AG   G+ + +   P DT KVRMQ    +VG    A   I+   ++ +NEG  AFYK
Sbjct: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG----ALDIIR---KLVKNEGVWAFYK 94

Query: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKET----GKVSTGNTFIAGVGAGITEA 124
           G    ++G+   ++++F   E    F+R     + T    G +  G  +I G+  G+  +
Sbjct: 95  GSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     +IRLQ Q  N  E   ++K  +     +VKE+   +L RG+     R   
Sbjct: 155 FLASPIEHV-RIRLQTQTGNGNE--REFKGPLDCIRKLVKEK---SLMRGLRPMMLRAGH 208

Query: 185 NQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242
             G  F  Y  L   E  +G    E + SW+    G +SG +   +  PLD +K+ +Q D
Sbjct: 209 GLGCYFLTYEALIANEIKKGKDRSE-IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD 267

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            + +N      +  +   L +E+G  A +KG  P ++R AP    TF  +E + + L
Sbjct: 268 -TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 99.8 bits (247), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 129/291 (44%), Gaps = 22/291 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L+AG  AG+ME     P+D IK R+Q    +  SG    G IK   +I   EG LA +KG
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQ----SSSSGAATQGLIKQISKITTAEGSLALWKG 75

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAXXXXXXXX 132
           + +V++G  P  A+ F++YEF ++ L D +         T I+G+ A  T A        
Sbjct: 76  VQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGM-AATTVADALMNPFD 134

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             K R+Q   LN  E      +       I  +EGF+A Y     T          NF +
Sbjct: 135 VIKQRMQ---LNTRE------SVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAI 185

Query: 193 YSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNM 248
           Y    +F+    + E  P +   + G +SGA       PLD IKT LQ    +  S + M
Sbjct: 186 YESATKFMNP--SNEYNP-FIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIM 242

Query: 249 SGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
                       + +  G++   +G+ PRV+   P  A+++T+YE  +  L
Sbjct: 243 KQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 9   NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGFIKTGGEIYRNE 65
           NP ++ I+GG +G        PLD IK  +Q+  +   S     +A  F +    IY+  
Sbjct: 200 NPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIH 259

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD 101
           G+  F +GL   VI   P  AI ++SYE  +  L +
Sbjct: 260 GWKGFLRGLKPRVIANMPATAISWTSYECAKHFLVN 295

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 71/204 (34%), Gaps = 27/204 (13%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI-YKNAVGSGVKAPGFIKTGGEIYRN 64
            +  P    I+G  A  +     +P D IK RMQ+  + +V    K          IY  
Sbjct: 108 HTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRESVWHVTK---------NIYHK 158

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124
           EGF AFY      ++   P  A  F+ YE      A K     +  N FI  +  G++ A
Sbjct: 159 EGFAAFYYSYPTTLVMNIPFAAFNFAIYE-----SATKFMNPSNEYNPFIHCISGGLSGA 213

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAV--------QACYTIVKEEGFSALYRGVS 176
                      I+   Q    V G+    N +        +A   I K  G+    RG+ 
Sbjct: 214 TCAAITTPLDCIKTVLQ----VRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLK 269

Query: 177 LTAARQATNQGANFTVYSKLKEFL 200
                       ++T Y   K FL
Sbjct: 270 PRVIANMPATAISWTSYECAKHFL 293

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 99.0 bits (245), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 135/306 (44%), Gaps = 43/306 (14%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA---------PGFIKTGGEIYRNEG 66
           AG  AG+ E L  +PLD +K RMQ+     G               G +    +I + EG
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEG 76

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTL---LADKETGKVSTGNTFIAGVGAGITE 123
           F   YKG+ + ++   PK AI+FS  + ++T    +     G+++      +G  AG  E
Sbjct: 77  FSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVE 136

Query: 124 AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
           A          KIRLQ       +   ++K  ++     V + G  +L+ G+  T  R  
Sbjct: 137 AFVVAPFELV-KIRLQ-------DVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHV 188

Query: 184 TNQGANFTVYSKLKEFLQGYHNQEMLPSWETS--------LIGLISGAIGPFSNAPLDTI 235
                 F +  ++++         +LP+ +TS        + G I G +G   N P D +
Sbjct: 189 LWNAGYFGIIFQIRK---------LLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVV 239

Query: 236 KTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY--- 292
           K+R+Q+             +++   + +EEGF+ALYKG  P+VMR+APG  +    +   
Sbjct: 240 KSRIQRSSGPLRKYNWSLPSVL--LVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNV 297

Query: 293 -EFIRK 297
            +F R+
Sbjct: 298 MDFFRE 303

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 79/194 (40%), Gaps = 19/194 (9%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNE----GF 67
           + + +G  AG +E     P + +K+R+Q     V S  K P       E+ +N     G 
Sbjct: 124 IAIYSGASAGAVEAFVVAPFELVKIRLQ----DVNSQFKTPI------EVVKNSVVKGGV 173

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXX 127
           L+ + GL A +       A  F      R LL   +T    T N  IAG   G T     
Sbjct: 174 LSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGG-TVGCLL 232

Query: 128 XXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQG 187
                  K R+Q     P+    KY  ++ +   + +EEGF ALY+G +    R A   G
Sbjct: 233 NTPFDVVKSRIQRSS-GPLR---KYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGG 288

Query: 188 ANFTVYSKLKEFLQ 201
               V++ + +F +
Sbjct: 289 LLLVVFTNVMDFFR 302

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           S +K+ N   +LIAG   G +  L   P D +K R+Q    + G   K    + +   +Y
Sbjct: 211 STEKTRN---DLIAGAIGGTVGCLLNTPFDVVKSRIQ---RSSGPLRKYNWSLPSVLLVY 264

Query: 63  RNEGFLAFYKGLGAVVIGITP 83
           R EGF A YKG    V+ + P
Sbjct: 265 REEGFKALYKGFAPKVMRLAP 285

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 99.0 bits (245), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 129/293 (44%), Gaps = 22/293 (7%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG   G+ + L   P DT KVR+Q  K    +       +K       NEG   FYK
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAEVVKNLLK-------NEGPKGFYK 80

Query: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXX 128
           G    ++G+   ++I+F   E    F+     D     +S    ++ G+  G+T +    
Sbjct: 81  GTLTPLVGVGACVSIQFGVNEAMKRFFHARNVD-HNATLSLSQYYLCGLTGGMTNSFLAS 139

Query: 129 XXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188
                 +IRLQ Q  +  +   ++K  +     +  ++G   L RG+  T  R+    G 
Sbjct: 140 PIEHV-RIRLQTQTGSGAQA--EFKGPIDCIKKLRSQKG---LMRGLIPTMLREGHGCGT 193

Query: 189 NFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
            F VY  L  K+  QG    E +P W+  L G +SG        P+D +K+ +Q D   K
Sbjct: 194 YFLVYEALVSKQINQGLKRTE-IPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNK 252

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
             +G K +  + + L   EG +A +KG  P ++R AP    TF  +E   + L
Sbjct: 253 PQNG-KNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 98.6 bits (244), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 129/291 (44%), Gaps = 21/291 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           LIAG  AG+ME     P+D +K R+Q   +A    + A   +     I  +EG LA +KG
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQ---SANAKSLSAKNMLSQISHISTSEGTLALWKG 93

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLAD-KETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           + +V++G  P  A+ F +YEF +  L D  +T       T I+G  A  T +        
Sbjct: 94  VQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACA-TTASDALMNPFD 152

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             K R+Q   LN    A  ++   Q    I + EG +A Y     T          NF +
Sbjct: 153 TIKQRIQ---LN--TSASVWQTTKQ----IYQSEGLAAFYYSYPTTLVMNIPFAAFNFVI 203

Query: 193 YSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-KDKSTKNMSGL 251
           Y    +FL   +    L      L G ISG+       PLD IKT LQ +   T ++  +
Sbjct: 204 YESSTKFLNPSNEYNPLIH---CLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIM 260

Query: 252 KRITIIGK---QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           ++     K    + Q  G++  ++G  PR++   P  A+++TAYE  +  L
Sbjct: 261 RKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFL 311

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 77/209 (36%), Gaps = 23/209 (11%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI 61
           +S  ++ +P    I+G  A        +P DTIK R+Q+  +A           +T  +I
Sbjct: 122 SSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSA--------SVWQTTKQI 173

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGI 121
           Y++EG  AFY      ++     M I F+++ F     + K     +  N  I  +   I
Sbjct: 174 YQSEGLAAFYYSYPTTLV-----MNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCLCGSI 228

Query: 122 TEAXXXXXXXXXXKIRL-------QAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
           + +           I+        Q   L  +  A  +  A  A Y +   +GF   +RG
Sbjct: 229 SGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGF---WRG 285

Query: 175 VSLTAARQATNQGANFTVYSKLKEFLQGY 203
                         ++T Y   K FL  Y
Sbjct: 286 WKPRIVANMPATAISWTAYECAKHFLMTY 314

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 98.6 bits (244), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 131/305 (42%), Gaps = 29/305 (9%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKN--------------AVGSGVKAPGFIKTGG 59
           LIAG  AG+ME     P+D +K RMQ                  A   G  A   ++   
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD-KETGKVSTGNTFIAGVG 118
            I   EG LA ++G+ ++V+G  P  A+ F++YEF +  L D K+        T ++GV 
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSGVA 143

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
           A +  A          K RLQ Q  +    +  ++ A    + I K EG  A +     T
Sbjct: 144 ATVA-ADALMNPFDTIKQRLQLQ--SKSSDSSMWRMA----FNIYKNEGPMAFFYSYPTT 196

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTR 238
            A        NF +Y    +F   ++       W   L G I+GA       PLD IKT 
Sbjct: 197 LAMNIPFAALNFVIYESSTKF---FNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIKTV 253

Query: 239 LQ-KDKSTKNMSGLKRITIIGK---QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
           LQ +   T ++   K      K    + Q  G++  ++G+ PRV+   P  A+++T+YEF
Sbjct: 254 LQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSYEF 313

Query: 295 IRKEL 299
            +  L
Sbjct: 314 AKHLL 318

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 9   NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA---VGSGVKAPGFIKTGGEIYRNE 65
           NP ++ + GG AG        PLD IK  +QI  +    V S   A  F K    I+++ 
Sbjct: 225 NPWIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSY 284

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKE 103
           G+  F++GL   VI   P  AI ++SYEF + LL  K+
Sbjct: 285 GWKGFWRGLQPRVISNIPATAISWTSYEFAKHLLFTKQ 322

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 74/201 (36%), Gaps = 20/201 (9%)

Query: 7   SSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEG 66
           +  P    ++G  A +      +P DTIK R+Q+   +  S +    F      IY+NEG
Sbjct: 131 THQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAF-----NIYKNEG 185

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
            +AF+      +    P  A+ F  YE      + K     +  N +I  +  GI  A  
Sbjct: 186 PMAFFYSYPTTLAMNIPFAALNFVIYE-----SSTKFFNPTNAYNPWIHCLCGGIAGATC 240

Query: 127 XXXXXXXXKIRLQAQ-------HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTA 179
                    I+   Q       H+   + A  +K A QA   I +  G+   +RG+    
Sbjct: 241 AAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQA---IWQSYGWKGFWRGLQPRV 297

Query: 180 ARQATNQGANFTVYSKLKEFL 200
                    ++T Y   K  L
Sbjct: 298 ISNIPATAISWTSYEFAKHLL 318

>Scas_709.9
          Length = 365

 Score = 98.6 bits (244), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 137/314 (43%), Gaps = 28/314 (8%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVG-SGVKAP---GFIK 56
           + SK   S+P +  ++G  AG + G+   PLD  K R+Q    A G   ++ P   G + 
Sbjct: 55  IQSKLHLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQ----AQGIQSIENPYYRGVLG 110

Query: 57  TGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAG 116
           T   I  +EG    YKGL  +++G  P   I FS YEF + L       +V   + FI+ 
Sbjct: 111 TMSTIVVDEGVRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYP-----RVLPNSDFISH 165

Query: 117 VGAGIT---EAXXXXXXXXXXKIRLQAQHLNPV-EGAPKYKNAVQACYTIVKEEGFSALY 172
             + IT    +          K RL  Q   P+ E    Y+  + A   I+ +EG   LY
Sbjct: 166 SCSAITAGAASTVLTNPIWVVKTRLMLQ--TPLGESRTHYRGTIDAFKKIITQEGVRTLY 223

Query: 173 RGVSLTAARQATNQGANFTVYSKLKEFLQ-----GYHNQEMLPSWETSLIGLISGA--IG 225
            G+ + +     +   +F VY KLK  L      G HN +      T LI   S +  + 
Sbjct: 224 TGL-VPSMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLA 282

Query: 226 PFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
                P + ++TR+Q  KS K +    ++  + K+  + EG    Y G    ++R  P  
Sbjct: 283 SILTYPHEILRTRMQL-KSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPAS 341

Query: 286 AVTFTAYEFIRKEL 299
           A+T  ++E+ R  L
Sbjct: 342 AITLVSFEYFRNAL 355

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 132/292 (45%), Gaps = 23/292 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVG-SGVKAPGFIKTGGEIYRNEGFLAFYK 72
           L+AG  AG+ME     P+D +K R+Q    A G +   + G I    +I   EG +A +K
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQ----AAGLNKAASTGMISQISKISTMEGSMALWK 82

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAXXXXXXX 131
           G+ +V++G  P  A+ F +YEF +  L   E  +      T ++G  A I  A       
Sbjct: 83  GVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIA-ADALMNPF 141

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
              K RLQ      ++   +  N  +  Y   + EGF+A Y     T A        NF 
Sbjct: 142 DTVKQRLQ------LDTNLRVWNVTKQIY---QNEGFAAFYYSYPTTLAMNIPFAAFNFM 192

Query: 192 VYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-KDKSTKNMSG 250
           +Y    +F    ++   L      L G ISGA       PLD IKT LQ +   T ++  
Sbjct: 193 IYESASKFFNPQNSYNPLIH---CLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEI 249

Query: 251 LKRITIIG---KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +K     G   + +++  G++  ++G+ PR++   P  A+++TAYE  +  L
Sbjct: 250 MKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 3/98 (3%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGS---GVKAPGFIKTGGEI 61
           Q S NP ++ + GG +G        PLD IK  +Q+  +   S      A  F +    I
Sbjct: 204 QNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAI 263

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
               G+  F++GL   ++   P  AI +++YE  +  L
Sbjct: 264 LEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 77/202 (38%), Gaps = 23/202 (11%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNE 65
           ++  P    ++G  A +      +P DT+K R+Q+  N     V          +IY+NE
Sbjct: 116 QTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVT--------KQIYQNE 167

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAX 125
           GF AFY          T  M I F+++ F     A K     ++ N  I  +  GI+ A 
Sbjct: 168 GFAAFYYSYPT-----TLAMNIPFAAFNFMIYESASKFFNPQNSYNPLIHCLCGGISGAT 222

Query: 126 XXXXXXXXXKIRLQAQ-------HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
                     I+   Q        +  ++ A  +  A +A   I++  G+   +RG+   
Sbjct: 223 CAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRA---ILEVHGWKGFWRGLKPR 279

Query: 179 AARQATNQGANFTVYSKLKEFL 200
                     ++T Y   K FL
Sbjct: 280 IVANIPATAISWTAYECAKHFL 301

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 96.7 bits (239), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 137/303 (45%), Gaps = 22/303 (7%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           S QK        +AG  AG+ E L  +PLD +K  MQ+  +  GSG +  G      +I 
Sbjct: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSG-GSGPQYKGVFDCLKQIA 60

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETG-KVSTGNTFIAGVGAGI 121
             EG    YKG+ + ++   PK A +F+  + ++ +  D     K++   + ++G  AGI
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
            E+          KIRLQ       + + K+ + +     IV++EG  A+Y G+  T  R
Sbjct: 121 CESFVVVPFELV-KIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172

Query: 182 QATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
                   F +  +++  L     +    +    L G + G +    + P D +K+R+Q 
Sbjct: 173 HGIWNAGYFGIIFQVRALLPKASTKSE-QTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQ- 230

Query: 242 DKSTKNMSGLKRITIIG----KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY----E 293
             +T  + G+ R           + +EEGF+ALYKG  P+V+R+ PG  +    +    +
Sbjct: 231 --NTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMD 288

Query: 294 FIR 296
           F R
Sbjct: 289 FFR 291

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 87/204 (42%), Gaps = 11/204 (5%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN 64
           +K + P +++++G  AG+ E     P + +K+R+Q     V S   +P  I     I   
Sbjct: 104 EKLTQP-LSILSGASAGICESFVVVPFELVKIRLQ----DVSSKFTSP--IAVVKNIVEK 156

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124
           EG LA Y GL + +       A  F      R LL    T    T N  +AG   G T +
Sbjct: 157 EGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGG-TLS 215

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAP-KYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                     K R+Q   + P  G P KY  +  A  TI KEEGF ALY+G      R  
Sbjct: 216 SLLSTPFDVVKSRVQNTAVIP--GVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLG 273

Query: 184 TNQGANFTVYSKLKEFLQGYHNQE 207
              G    V++ + +F +  H ++
Sbjct: 274 PGGGILLVVFTGVMDFFRTVHEKK 297

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%)

Query: 205 NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264
           +Q+ LP     + G ++G        PLD +KT +Q   S  +    K +    KQ+  +
Sbjct: 3   DQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAK 62

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           EG   LYKGI+  ++  AP +A  F   +  +K
Sbjct: 63  EGPSRLYKGISSPILMEAPKRATKFACNDEFQK 95

>Scas_379.2
          Length = 301

 Score = 96.3 bits (238), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 121/291 (41%), Gaps = 23/291 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L+AG  AG+ME     P+D +K R+Q       S       +    +I   EG LA +KG
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQ-----STSAKSTSNMLSQMAKISTAEGSLALWKG 81

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAXXXXXXXX 132
           + +V++G  P  A+ F++YE+ +  L D++  +      T ++G  A I  A        
Sbjct: 82  VQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIA-ADALMNPFD 140

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             K R+Q      V    K          I K EGFSA Y     T A        NF +
Sbjct: 141 TLKQRMQLNTNTTVWNVTK---------QIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMI 191

Query: 193 YSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNM 248
           Y    +F    ++   L      L G +SGA       PLD IKT LQ    +  S + M
Sbjct: 192 YESATKFFNPTNDYNPLVH---CLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVM 248

Query: 249 SGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
                     K + Q  G +  ++G+ PRV    P  A+ +TAYE  +  L
Sbjct: 249 KEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 77/204 (37%), Gaps = 23/204 (11%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNE 65
           ++  P    ++G  A +      +P DT+K RMQ+  N     V          +IY+NE
Sbjct: 114 QTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTTVWNVT--------KQIYKNE 165

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAX 125
           GF AFY      +      M I F+++ F     A K     +  N  +  +  G++ A 
Sbjct: 166 GFSAFYYSYPTTL-----AMNIPFAAFNFMIYESATKFFNPTNDYNPLVHCLSGGLSGAT 220

Query: 126 XXXXXXXXXKIRLQAQ-------HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
                     I+   Q        L  ++ A  ++ A +A Y +   +GF   +RG+   
Sbjct: 221 CAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGF---WRGLQPR 277

Query: 179 AARQATNQGANFTVYSKLKEFLQG 202
                      +T Y   K FL G
Sbjct: 278 VFANMPATAIAWTAYECAKHFLLG 301

>Scas_667.22
          Length = 306

 Score = 96.3 bits (238), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 130/295 (44%), Gaps = 25/295 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG   G+ + L   P DT KVR+Q       +       ++   ++ +NEG   FYK
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVIRKLLKNEGPKGFYK 80

Query: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXX 128
           G    +IG+   ++++F   E    F+ +   D  +  +S    +I G+  GIT +    
Sbjct: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS 140

Query: 129 XXXXXXKIRLQAQHLNPVEGAP--KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                 +IRLQ Q        P  ++K  +     +  + GF    RG++ T  R+    
Sbjct: 141 PIEHV-RIRLQTQ----TGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGC 192

Query: 187 GANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
           G  F VY  +   E  +G+   E +P+W+  L G +SG        PLD IK+ +Q D  
Sbjct: 193 GTYFLVYEAMVANEINKGFKRTE-VPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
                G   I+ + K L  + G  A +KG  P ++R AP    TF  +E   + L
Sbjct: 252 KSPKYG-NSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMRLL 305

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 95.9 bits (237), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 129/293 (44%), Gaps = 20/293 (6%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQ-IYKNAVGSGVKAPG-FIKTGGEIYRNEGFLAFY 71
           L AG  AG+ME     P+D IK RMQ +      +  + P   +    +I   EG LA +
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAXXXXXX 130
           KG+ +VV+G  P  A+ F++YE  ++ L D E  +      T ++G  A +  A      
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVA-ADALMNP 139

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
               K RLQ   L+P +     K AV+    + + EG +A +     T A        NF
Sbjct: 140 FDTIKQRLQ---LHPSDS--MTKCAVR----MYQREGIAAFFYSYPTTIAMNIPFAALNF 190

Query: 191 TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSG 250
            +Y    +     +N      W   L G ISGA       PLD +KT LQ   +    S 
Sbjct: 191 VIYESSTKIFNPSNNYN---PWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQ 247

Query: 251 L-KRITIIGK---QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           L K      K    + +  G+   ++G+ PR++   P  A+++T+YEF +  L
Sbjct: 248 LFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 9   NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIY-KNAVGSGV--KAPGFIKTGGEIYRNE 65
           NP ++ + GG +G        PLD +K  +QI   ++V S +  +A  F K    I++  
Sbjct: 207 NPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTY 266

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
           G+  F++GL   +I   P  AI ++SYEF + LL
Sbjct: 267 GWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 76/204 (37%), Gaps = 23/204 (11%)

Query: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR 63
            +++  P    ++G  A +      +P DTIK R+Q++ +            K    +Y+
Sbjct: 113 DRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSD--------SMTKCAVRMYQ 164

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITE 123
            EG  AF+      +    P  A+ F  YE      + K     +  N +I  +  GI+ 
Sbjct: 165 REGIAAFFYSYPTTIAMNIPFAALNFVIYE-----SSTKIFNPSNNYNPWIHCLCGGISG 219

Query: 124 AXXXXXXXXXXKIR--LQAQHLNPVEG-----APKYKNAVQACYTIVKEEGFSALYRGVS 176
           A           ++  LQ +  + V+      A  ++ A  A   I K  G+S  +RG+ 
Sbjct: 220 ATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASA---IHKTYGWSGFFRGLK 276

Query: 177 LTAARQATNQGANFTVYSKLKEFL 200
                       ++T Y   K  L
Sbjct: 277 PRIISNMPATAISWTSYEFAKHLL 300

>Scas_558.2
          Length = 289

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 128/299 (42%), Gaps = 32/299 (10%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
            ++L++G  AG    L   P+DT+K R+Q                   G  ++N G+   
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQ-----------------AKGGFFQNGGYHGI 49

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-ETGKVSTGNTFIAGVGAGITEAXXXXX 129
           Y+GLG+ V+   P  ++ F +Y+  +  +    E    S+G      V   +        
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMG 109

Query: 130 XXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEG----FSALYRGVSLTAARQATN 185
                 +R+ A+ +          ++ Q   TI+K E        LYRG S T  R+   
Sbjct: 110 ELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPF 169

Query: 186 QGANFTVYSKLKEFLQGYHNQE-MLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
               F +Y  +K+    Y N+   L  W+ ++ G I+G I   +  PLD +KTRL  +K 
Sbjct: 170 TCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKD 229

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE---FIRKELE 300
           +  +  L R       + +EEGF+  + GI PR M ++ G A+    YE   F+ + LE
Sbjct: 230 SIPIKSLIR------NIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVYETMHFMLQSLE 282

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 17/100 (17%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69
           P    I G  AG +      PLD +K R+ + K+++         I+    IY+ EGF  
Sbjct: 196 PWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSI----PIKSLIR---NIYKEEGFKI 248

Query: 70  FYKGL----------GAVVIGITPKMAIRFSSYEFYRTLL 99
           F+ G+          GA+ +G+   M     S E  +T+L
Sbjct: 249 FFSGIYPRTMWISAGGAIFLGVYETMHFMLQSLEETKTIL 288

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 127/299 (42%), Gaps = 25/299 (8%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQ-IYKNAVGSGVKAPG-FIKTGGEIYRNEGFL 68
           A  L+AG  AG+ E     PLD +K R+Q ++  +   G   P   ++    I   EG +
Sbjct: 19  AHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSM 78

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK--ETGKVSTGNTFIAGVGAGITEAXX 126
             +KG+ +V++G  P  A+ F++YE  ++ L D+   T K     T  +G  A I  A  
Sbjct: 79  VLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIA-ADA 137

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   K R+Q      V    K          I  +EGF A Y     T A      
Sbjct: 138 LMNPFDVIKQRIQLNTNISVWDTAK---------RIYSKEGFQAFYSSYPTTLAINIPFA 188

Query: 187 GANFTVYSKLKEFLQ--GYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
             NF +Y     +    G +N  +       L G ISGA       PLD IKT LQ   S
Sbjct: 189 AFNFGIYDTATRYFNPSGVYNPFI-----HCLCGGISGAACAGLTTPLDCIKTALQVRGS 243

Query: 245 TK-NMSGLKRITIIGK---QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            K +M   K+     K    + Q  G+R  + G+ PR++   P  A+++TAYEF +  L
Sbjct: 244 EKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKHFL 302

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 9   NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIY---KNAVGSGVKAPGFIKTGGEIYRNE 65
           NP ++ + GG +G        PLD IK  +Q+    K ++    +A  F K    IY+  
Sbjct: 209 NPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVY 268

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
           G+  F+ G+   ++   P  AI +++YEF +  L
Sbjct: 269 GWRGFWSGVKPRILANMPATAISWTAYEFAKHFL 302

>Kwal_33.14050
          Length = 314

 Score = 94.7 bits (234), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 128/296 (43%), Gaps = 22/296 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG---VKAPG-FIKTGGEIYRNEGFLA 69
           L AG  AG+ME     P+D IK RMQ     +GS     K P   ++    I   EG +A
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAXXXX 128
            +KG+ +V++G  P  A+ F++YE  ++ L D +  +      T  +G+ A +  A    
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA-ADLLM 138

Query: 129 XXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQG 187
                 K R+Q +  +        K+ + +  + I + EG +A +     T A       
Sbjct: 139 NPFDTIKQRMQLRTFS--------KDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAA 190

Query: 188 ANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKN 247
            NF +Y    +F    +    L      L G ISGA       PLD IKT LQ   S   
Sbjct: 191 FNFAIYESATKFFNPENTYNPLIH---CLCGGISGATCAAITTPLDCIKTVLQVRGSESV 247

Query: 248 MSGLKR----ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +  L R     +     + +  G+   ++G+ PR++   P  A+++TAYE  +  L
Sbjct: 248 VDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYECAKHTL 303

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 77/209 (36%), Gaps = 29/209 (13%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI---YKNAVGSGVKAPGFIKTGGEIY 62
           ++  P     +G  A +   L  +P DTIK RMQ+    K+ + S             IY
Sbjct: 116 QTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWS---------VASRIY 166

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122
           RNEG  AF+      +    P  A  F+ YE      A K     +T N  I  +  GI+
Sbjct: 167 RNEGLAAFFYSYPTTIAMNIPFAAFNFAIYE-----SATKFFNPENTYNPLIHCLCGGIS 221

Query: 123 EAXXXXXXXXXXKIRLQAQHLNPVEGA-----PKYKNA---VQACYTIVKEEGFSALYRG 174
            A           I+   Q    V G+     P ++ A    +A   I K  G+S  +RG
Sbjct: 222 GATCAAITTPLDCIKTVLQ----VRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRG 277

Query: 175 VSLTAARQATNQGANFTVYSKLKEFLQGY 203
           +             ++T Y   K  L  Y
Sbjct: 278 LKPRIISNMPATAISWTAYECAKHTLFNY 306

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIY-KNAVGSGV--KAPGFIKTGGEI 61
           + + NP ++ + GG +G        PLD IK  +Q+    +V   +  +A  F +    I
Sbjct: 206 ENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAI 265

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93
            +  G+  F++GL   +I   P  AI +++YE
Sbjct: 266 SKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 95.1 bits (235), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 124/295 (42%), Gaps = 13/295 (4%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQI--YKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69
           +N I+G  AGL+ G+   PLD  K R+Q    +      +   G I T   I R+EG   
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXX 129
            YKGL  +++G  P   I FS YEF +  L    +      ++F A     ++       
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTNPI 189

Query: 130 XXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGAN 189
                ++ LQ  H+        Y+    A   I+ +EG  ALY G+ + +     +   +
Sbjct: 190 WVVKTRLMLQT-HIG--SNTTHYQGTYDAFKKIINQEGVKALYAGL-VPSLLGLLHVAIH 245

Query: 190 FTVYSKLKEFLQGYHNQEMLPSWETSLIGLI-----SGAIGPFSNAPLDTIKTRLQKDKS 244
           F VY +LK   + Y   E     + +L  LI     S  +    + P + ++TRLQ    
Sbjct: 246 FPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSD 305

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
               S  +R+  + K    +EG    Y G    + R  P  A+T  ++E++R  L
Sbjct: 306 LP--SHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFL 358

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 124/300 (41%), Gaps = 47/300 (15%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           ++L++G  AG    L   P+DT+K R+Q                   G  +RN G+   Y
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQ-----------------AKGGFFRNGGYRGVY 49

Query: 72  KGLGAVVIGITPKMAIRFSSYE--------FYRTLLADKETGKVSTGNTFIAGVGAGITE 123
           +GLG+ V+   P  ++ F +Y+        F+R LL       V T + F + +G     
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVT-HMFSSSMG----- 103

Query: 124 AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA----LYRGVSLTA 179
                       +R+ A+ +          ++ +    I+K E        LYRG S T 
Sbjct: 104 ------EIAACMVRVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTI 157

Query: 180 ARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239
            R+       F +Y  +K+        + +  W+ ++ G I+G I   +  PLD +KTRL
Sbjct: 158 MREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRL 217

Query: 240 QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
              K +  +  L         + +EEGF+  + G+ PR M ++ G A+    YE +   L
Sbjct: 218 MLCKKSIPLGTLV------STIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLL 271

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69
           P    + G  AG +      PLD +K R+ + K ++  G      + T   IY+ EGF  
Sbjct: 189 PWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGT----LVST---IYKEEGFKV 241

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
           F+ G+G   + I+   AI    YE   +LL+
Sbjct: 242 FFSGVGPRTMWISAGGAIFLGIYETVHSLLS 272

>Kwal_23.3042
          Length = 542

 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 140/314 (44%), Gaps = 34/314 (10%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRM------------------QIYKNAVGSGVKAPGFI 55
            IAGG +G++   C  P D IKV +                  +   NA  S +K+P  +
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSP-LV 286

Query: 56  KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGN 111
           K    +YR  G  AFY G G   + + P+ AI+F S+E  + L+A     ++T  +S  +
Sbjct: 287 KAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFS 346

Query: 112 TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSAL 171
           T++AG G G   A          K R+Q   LN      +    +     + KE G    
Sbjct: 347 TYLAG-GLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL--LISTAKDMYKEGGLRIF 403

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKEF-------LQGY-HNQEMLPSWETSLIGLISGA 223
           YRG+++           +   +S LK++       L G   +Q  + +    L+G  SG 
Sbjct: 404 YRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGT 463

Query: 224 IGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAP 283
           +G  +  P++ ++TRLQ   +  +         +  + +Q EG++ L+KG+ P + +V P
Sbjct: 464 VGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCP 523

Query: 284 GQAVTFTAYEFIRK 297
             ++++  YE +++
Sbjct: 524 AVSISYLCYENLKR 537

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 136/315 (43%), Gaps = 34/315 (10%)

Query: 4   KQKSSNPAV-NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           ++ SSN  + ++ AG   G+ + L   P DT KVR+Q       +       ++    + 
Sbjct: 27  RELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-------LEVLRNLV 79

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETG------KVSTGNT 112
           +NEG  AFYKG    ++G+   ++++F   E    F++   A K          +S  NT
Sbjct: 80  KNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139

Query: 113 ------FIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE 166
                 ++ G+  G+  +          +IRLQ Q  N   G  +       C   +K +
Sbjct: 140 LPLSQYYVCGLTGGVVNSFLASPIEQI-RIRLQTQTSN---GGDREFKGPWDCIKKLKAQ 195

Query: 167 GFSALYRGVSLTAARQATNQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAI 224
           G   L RG+  T  R     G  F VY  L  +E   G    E +P W+  L G  SG +
Sbjct: 196 G--GLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE-IPPWKLCLFGAFSGTM 252

Query: 225 GPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPG 284
              +  PLD +K+ +Q D   K       I+ + K +  +EG RA +KG  P ++R AP 
Sbjct: 253 LWLTVYPLDVVKSIIQNDDLRKPKYK-NSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311

Query: 285 QAVTFTAYEFIRKEL 299
              TF  +E + + L
Sbjct: 312 NGATFLTFELVMRFL 326

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 16/95 (16%)

Query: 15  IAGGGAGLMEGLCCHPLDTIK-------VRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGF 67
           + G  +G M  L  +PLD +K       +R   YKN++    K          IY  EG 
Sbjct: 244 LFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKT---------IYAKEGI 294

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK 102
            AF+KG G  ++   P     F ++E     L ++
Sbjct: 295 RAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE 329

>Kwal_27.12599
          Length = 304

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 131/293 (44%), Gaps = 22/293 (7%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG   G+ + L   P DT KVR+Q       +       ++   ++ +NEG   FYK
Sbjct: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-------VEVVKKLVKNEGLRGFYK 79

Query: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXX 128
           G    ++G+   ++ +F   E    F+R   AD     ++    +I G   G+  +    
Sbjct: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLAS 138

Query: 129 XXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188
                 +IRLQ Q  +      ++K  +  C   ++  G  AL RG+S T  R+A     
Sbjct: 139 PIEHV-RIRLQTQTASGT--VAEFKGPLD-CINKLRANG--ALMRGLSPTILREAQGCAT 192

Query: 189 NFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
            F  Y  L   +  +G    ++ P+W+  L G +SG     +  PLD IK+ +Q D    
Sbjct: 193 YFLTYEALVANQIGKGIARSDV-PAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKN 251

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            + G K I  + + +  + G+++ +KG  P ++R AP    TF  +E   + L
Sbjct: 252 PVRG-KNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRFL 303

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 129/307 (42%), Gaps = 21/307 (6%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI--YKNAVGSGVKAPGFIKTGGEIY 62
           +K+++P V  I+G  +G +  +   P D  K R+Q    +N         GF  T   I+
Sbjct: 33  KKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIF 92

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122
           ++EG    YKGL   V+G  P + I FS Y+F R    D     +   + F++   + IT
Sbjct: 93  KDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVD-----IFPHSPFLSNASSAIT 147

Query: 123 E---AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTA 179
               +          K RL  Q     + +  YK  +     I+++EG  ALY G+ + A
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQ-TGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGL-VPA 205

Query: 180 ARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETS-------LIGLISGAIGPFSNAPL 232
                N    F +Y  LK    GY     + +  TS       L  ++S  +      P 
Sbjct: 206 LLGMLNVAIQFPLYENLKIRF-GYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPH 264

Query: 233 DTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
           + ++TR+Q      N      + +I K   ++EGF   Y G    ++R  P   VT  ++
Sbjct: 265 EILRTRMQLKSDLPNTVQRHLLPLI-KITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

Query: 293 EFIRKEL 299
           E+ +K L
Sbjct: 324 EYSKKYL 330

>Scas_578.3*
          Length = 524

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 137/310 (44%), Gaps = 36/310 (11%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGF----------------IKT 57
            IAGG +G++   C  PLD IKV + I +  + S +  P                  IK 
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFL-IARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKA 270

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA----DKETGKVSTGNTF 113
              +YR  G  AFY G G  V  I P+ +I+F ++E  + L+A    DK    +S   T+
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTY 330

Query: 114 IAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNA--VQACYTIVKEEGFSAL 171
           +AG  AG+  A          K R+Q     P+EG  K  NA  +     + KE G    
Sbjct: 331 VAGGIAGVM-AQISIYPIDTLKFRIQCA---PLEGNLK-GNALLISTAKEMYKEGGIRVF 385

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEM-LPSWETSL-------IGLISGA 223
           YRGV L A         +   +S LK++     ++++ +P  +  L       +G  SG 
Sbjct: 386 YRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGT 445

Query: 224 IGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAP 283
           +G  +  P++ ++TRLQ   +  +         +  Q ++ EG    YKG+ P +++V P
Sbjct: 446 VGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCP 505

Query: 284 GQAVTFTAYE 293
             ++ +  YE
Sbjct: 506 AVSIGYLCYE 515

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 71/166 (42%), Gaps = 6/166 (3%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K+ L+ Q LN  +       A+++ Y   ++ G  A Y G  L+  +        F  + 
Sbjct: 250 KMHLRIQGLNLAKIRSPIIKAIRSLY---RQGGLRAFYVGNGLSVFKICPESSIKFGTFE 306

Query: 195 KLKEFLQGYHNQEM---LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGL 251
             K  +      ++   L   +T + G I+G +   S  P+DT+K R+Q      N+ G 
Sbjct: 307 LAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGN 366

Query: 252 KRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
             +    K++ +E G R  Y+G+    + + P  A+    +  ++K
Sbjct: 367 ALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKK 412

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 79/196 (40%), Gaps = 21/196 (10%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQ---IYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           +AGG AG+M  +  +P+DT+K R+Q   +  N  G+ +     I T  E+Y+  G   FY
Sbjct: 331 VAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNAL----LISTAKEMYKEGGIRVFY 386

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK-------VSTGNTFIAGVGA-GITE 123
           +G+    +GI P  A+   ++   +     +++ K       V      +  +GA   T 
Sbjct: 387 RGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTV 446

Query: 124 AXXXXXXXXXXKIRLQAQ--HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
                      + RLQAQ  + +P      Y          +K EG    Y+G+  T  +
Sbjct: 447 GATAVYPINLLRTRLQAQGTYAHPYT----YTGFRDVFMQTLKREGVPGFYKGLVPTLVK 502

Query: 182 QATNQGANFTVYSKLK 197
                   +  Y K K
Sbjct: 503 VCPAVSIGYLCYEKFK 518

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L  G  +G +     +P++ ++ R+Q  +          GF     +  + EG   FYKG
Sbjct: 437 LPMGAFSGTVGATAVYPINLLRTRLQA-QGTYAHPYTYTGFRDVFMQTLKREGVPGFYKG 495

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLA 100
           L   ++ + P ++I +  YE ++  ++
Sbjct: 496 LVPTLVKVCPAVSIGYLCYEKFKAAMS 522

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 92.4 bits (228), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 128/302 (42%), Gaps = 19/302 (6%)

Query: 8   SNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP---GFIKTGGEIYRN 64
           S+  +  ++G  AG + G+   PLD  K R+Q     + +  + P   G + T   I R+
Sbjct: 75  SSTQITALSGAFAGFLSGVAVCPLDVAKTRLQ--AQGLQTRFENPYYRGIMGTLSTIVRD 132

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITE- 123
           EG    YKGL  +V+G  P   I FS YEF     + K    +     F+A   A IT  
Sbjct: 133 EGPRGLYKGLVPIVLGYFPTWMIYFSVYEF-----SKKFFHGIFPQFDFVAQSCAAITAG 187

Query: 124 --AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
             +          K RL  Q  N  E    YK    A   +  +EGF ALY G+ + +  
Sbjct: 188 AASTTLTNPIWVVKTRLMLQS-NLGEHPTHYKGTFDAFRKLFYQEGFKALYAGL-VPSLL 245

Query: 182 QATNQGANFTVYSKLKEFLQGY---HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTR 238
              +   +F +Y  LK     Y   +N   +      +   +S  I      P + ++TR
Sbjct: 246 GLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTR 305

Query: 239 LQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           +Q  KS    S  +R+  + K    +EG +  Y G T  ++R  P  A+T  ++E+ R  
Sbjct: 306 MQL-KSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNR 364

Query: 299 LE 300
           LE
Sbjct: 365 LE 366

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 7/106 (6%)

Query: 3   SKQKSSNPAVNL----IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTG 58
           S++ ++N ++NL    +A   + ++     +P + ++ RMQ+ K+ +   ++   F    
Sbjct: 268 SRENNTN-SINLQRLIMASSVSKMIASAVTYPHEILRTRMQL-KSDIPDSIQRRLFPLIK 325

Query: 59  GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET 104
              Y  EG   FY G    ++   P  AI   S+E++R  L +  T
Sbjct: 326 AT-YAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENIST 370

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 93.2 bits (230), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 141/318 (44%), Gaps = 36/318 (11%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKV----RMQIYK--------------NAVGSGVKAPGFI 55
            IAGG +G++   C  P D IKV    R  +                NA  S +K+P  I
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSP-LI 257

Query: 56  KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKE----TGKVSTGN 111
           K    +YR  G  AFY G G  VI + P+ A++F S+E  + L+A  E    T ++S  +
Sbjct: 258 KAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFS 317

Query: 112 TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKN-AVQACYTIVKEEGFSA 170
           T+IAG G G   A          K R+Q     P++ A K     +     + ++ G   
Sbjct: 318 TYIAG-GMGGVVAQFSVYPIDTLKYRVQCA---PLDTALKGNELLISTARQMYRDGGLKL 373

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH--------NQEMLPSWETSLIGLISG 222
            YRGV++           +   +S LK++             +Q  + ++    +G  SG
Sbjct: 374 FYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSG 433

Query: 223 AIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVA 282
            +G     P++ ++TRLQ   +  +         +  + +Q EG++ L+KG+ P + +V 
Sbjct: 434 TVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVC 493

Query: 283 PGQAVTFTAYEFIRKELE 300
           P  ++++  YE  ++ ++
Sbjct: 494 PAVSISYLCYENFKRLMK 511

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 90.9 bits (224), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 129/300 (43%), Gaps = 43/300 (14%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           ++L++G  AG    L   P+DTIK R+Q                   G  + N G+   Y
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQ-----------------AKGGFFANGGYKGIY 48

Query: 72  KGLGAVVIGITPKMAIRFSSYEF-------YRTLLADKETGKVSTGNTFIAGVGAGITEA 124
           +GLG+ V+   P  ++ F SY++       Y + L  + + ++    T +     G   A
Sbjct: 49  RGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICA 108

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVK---EEGFSA-LYRGVSLTAA 180
                     K R Q    N         ++ Q   +I++   +EG    LYRG S T  
Sbjct: 109 CLVRVPAEVVKQRTQVHSTN---------SSWQTLQSILRNDNKEGLRKNLYRGWSTTIM 159

Query: 181 RQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240
           R+       F +Y  LK+     + Q  +  W+ ++ G I+G I   +  PLD +KTRL 
Sbjct: 160 REIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLM 219

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
            +K+T ++  +    II  ++ +EEG    + G+ PR M ++ G A+    YE +   L 
Sbjct: 220 LNKTTASLGSV----II--RIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKN--AVGSGVKAPGFIKTGG 59
           A+ Q    P    I G  AG +      PLD +K R+ + K   ++GS +          
Sbjct: 182 ANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVII--------- 232

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
            IYR EG   F+ G+G   + I+   AI    YE   +LL+
Sbjct: 233 RIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 90.1 bits (222), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 129/305 (42%), Gaps = 42/305 (13%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNE 65
            SS+  V+L +G  AG    L   P+DT+K R+Q                   G  + N 
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQ-----------------AKGGFFANG 44

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGI 121
           G+   Y+GLG+ VI   P  ++ F SY+    + + +++   T      +T      + I
Sbjct: 45  GYKGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSI 104

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEG----FSALYRGVSL 177
            E            +R+ A+ +       K  ++ Q    I++ E        LYRG + 
Sbjct: 105 GEVSACL-------VRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNT 157

Query: 178 TAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKT 237
           T  R+       F +Y  LK+     + Q+ +  W+ S+ G ++GAI   +  PLD +KT
Sbjct: 158 TIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKT 217

Query: 238 RLQKDKSTKNMSGLKRITI--IGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           RL        M   K I +  + K +  EEGF+  + G+ PR M ++ G A+    YE +
Sbjct: 218 RL--------MLSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETV 269

Query: 296 RKELE 300
              L 
Sbjct: 270 HSILS 274

>Kwal_0.232
          Length = 274

 Score = 89.7 bits (221), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 123/298 (41%), Gaps = 42/298 (14%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG  AG    L   P+DT+K R+Q                   G  + N G+L  Y+
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQ-----------------AAGGFFANGGYLGVYR 51

Query: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLAD--KETGKVSTGNTFIAGVGAGITEAXX 126
           GLG+ V+   P  ++ F +Y+    + R +  +    + +V+   T +    AG   A  
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA----LYRGVSLTAARQ 182
                   K R Q           K  +++Q    +++ E        LYRG S T  R+
Sbjct: 112 VRVPAEVIKQRTQTH---------KSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMRE 162

Query: 183 ATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242
                  F +Y  LK+       +E +  W+ +  G ++G I   +  PLD +KTRL   
Sbjct: 163 IPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLS 222

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
            ++  +  L R      Q+   EG++  + G+ PR + ++ G A+    YE +   L 
Sbjct: 223 HTSVPVLHLAR------QIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETVHSILS 274

 Score = 34.3 bits (77), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69
           P      G  AG +      PLD +K R+ +   +V         +    +IY  EG+  
Sbjct: 191 PWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP-------VLHLARQIYATEGWKV 243

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
           F+ G+G   + I+   AI    YE   ++L+
Sbjct: 244 FFSGVGPRTVWISAGGAIFLGVYETVHSILS 274

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 89.4 bits (220), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 124/296 (41%), Gaps = 23/296 (7%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++ +G   G+ + L   P D IKVR+Q       +       +K        EGF+ FYK
Sbjct: 27  DVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLVK-------YEGFMGFYK 79

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK------VSTGNTFIAGVGAGITEAXX 126
           G  A ++G+   ++ +F   E  +    D    +      +S G  +  G  +G   A  
Sbjct: 80  GTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALL 139

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   +IRLQ Q         +YK+ +     ++K+    +L RG + T  R +   
Sbjct: 140 ATPIEHV-RIRLQLQ--KEALANAEYKSTLDCTEKLLKQ---GSLMRGFTATLMRTSHGF 193

Query: 187 GANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
           G  F  Y  L   +   G+  ++ + +W+  + G +SGA       P D +K+ +Q DK 
Sbjct: 194 GIYFLTYETLIASQLAHGFRRED-ISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKL 252

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
                G   +  + K + +E G RA  KG  P ++R  P    TF A+E   + L+
Sbjct: 253 VNPAYG-TNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQMLK 307

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 129/294 (43%), Gaps = 22/294 (7%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++++G   G+ + L   P D  KVRMQ    + GS       +     + +NEG L FYK
Sbjct: 26  DILSGTAGGIAQVLVGQPFDITKVRMQ---TSAGSATA----VDVVTSLIKNEGILGFYK 78

Query: 73  GLGAVVIGITPKMAIRFSSYEF----YRTLLADKETGKVSTGNTFIAGVGAGITEAXXXX 128
           G  A ++G+   ++ +F   E     +R +  D  +  +S    ++ GV +G   A    
Sbjct: 79  GTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGD-PSKPLSLKQYYVCGVASGCANA-FLA 136

Query: 129 XXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188
                 +IRLQ Q  +      +Y+ ++     ++K+    AL RG + T  R     G 
Sbjct: 137 TPIEHVRIRLQLQTKSLANA--EYQGSLDCMRKLLKQ---GALMRGFTATLMRTCHGFGI 191

Query: 189 NFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
            F+ Y  L   +  +G   +++ P W+  + G  SGA       P+D +K+ +Q D+   
Sbjct: 192 YFSTYEALIANQHKKGIPRKDIAP-WKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVS 250

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
            + G   +  + K +    G RA  KG  P ++R  P    TF  +E   + LE
Sbjct: 251 PVHG-TNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLE 303

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 88.2 bits (217), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 124/295 (42%), Gaps = 24/295 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG   G+ + L   P DT KVR+Q       S V     +    ++ +NEGF  FYK
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQT------SSVPTTA-LDVVKKLVKNEGFRGFYK 78

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNT------FIAGVGAGITEAXX 126
           G    ++G+   ++++F   E  +     +  G      T      ++ G  AG T    
Sbjct: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYLCGF-AGGTANSF 136

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   +IRLQ Q      GA    +    C  I K    ++L RG++ T  R++   
Sbjct: 137 LASPIEHVRIRLQTQ---TGTGAAAQFHGPLDC--IKKLTANNSLMRGLTPTMLRESHGC 191

Query: 187 GANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
           G  F  Y  L   E  +G    E +P+W+  L G  SG        PLD IK+ +Q D  
Sbjct: 192 GVYFLTYEALIANELHKGVSRSE-IPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSL 250

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            +   G K +  + K +    G  + +KG  P ++R AP    TF  +E   + L
Sbjct: 251 LQPKQG-KNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 132/288 (45%), Gaps = 26/288 (9%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           + S   ++    +L+AG   G+ + L   P DT KVR+Q  + +  +       +K   +
Sbjct: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-------VKVIKD 66

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAG 116
           + +NEG + FYKG    ++G+   ++++F   E    F+ T   +  +  +S    +I G
Sbjct: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYICG 125

Query: 117 VGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVS 176
           V  G T +          +IRLQ Q         ++K  +  C   ++  G   L RG++
Sbjct: 126 VAGGFTNS-FLASPIEHIRIRLQTQ--TGSGATAEFKGPID-CIKKLRVNG--QLMRGLT 179

Query: 177 LTAARQATNQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDT 234
            T  R++   G  F  Y  L   +   G   ++ +P+W+  L G  SG +      PLD 
Sbjct: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD-IPAWKLCLFGAASGTLLWTMVYPLDV 238

Query: 235 IKTRLQKD--KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280
           IK+ +Q D  K+ KN +    I  +G+ +I  +G   L+KG  P ++R
Sbjct: 239 IKSVMQTDNLKTPKNGN---NILTVGRTIIARQGVSGLFKGFAPTMLR 283

>Kwal_56.23011
          Length = 303

 Score = 87.8 bits (216), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 124/286 (43%), Gaps = 20/286 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++  G   G+ + L   P D  KVR+Q           A   IK+   + +NEG LAFYK
Sbjct: 26  DVFCGTVGGVAQVLVGQPFDITKVRLQTSP----VPTTAAQVIKS---LVKNEGLLAFYK 78

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKE---TGKVSTGNTFIAGVGAGITEAXXXXX 129
           G  A + G+   ++ +F   E  +     K+      ++    +  G  +G   A     
Sbjct: 79  GTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATP 138

Query: 130 XXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGAN 189
                +IRLQ Q  +    A +Y  ++     ++K+    AL RG + T  R +   G  
Sbjct: 139 IEHV-RIRLQLQTAS--SSAAEYHGSLDCARKLLKQ---GALMRGFTATTLRTSHGFGIY 192

Query: 190 FTVYSKLKEFLQGYHN--QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKN 247
           F  Y  L    Q +H   +E +P+W+  + G  SGA       P D +K+ +Q DK    
Sbjct: 193 FLTYETLIA-NQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNP 251

Query: 248 MSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           + G   + +  K + +E G RA  KG TP ++R  P    TF A+E
Sbjct: 252 VYGRNPLAV-AKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFE 296

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 145/318 (45%), Gaps = 42/318 (13%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKV----RMQIYK--------------NAVGSGVKAPGFI 55
            IAGG +G++   C  P D +KV    R  +                NA  + + +P   
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSP-LA 289

Query: 56  KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGN 111
           K    +YR  G  AFY G G  VI + P+ +I+F S+E  + ++      ++T  +S  +
Sbjct: 290 KAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFS 349

Query: 112 TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAV-QACYTIVKEEGFSA 170
           T+IAG  AG+  A          K R+Q     P++   K  N + Q    + +E G   
Sbjct: 350 TYIAGGLAGMA-AQFSVYPIDTLKFRVQCA---PLDTKLKGNNLLFQTAKDMFREGGLRL 405

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEM-LPSWETSLIGLISGAIGPFSN 229
            YRGV++           +   +S LK++      + + LP  + +L  L+   +G FS 
Sbjct: 406 FYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSG 465

Query: 230 A-------PLDTIKTRLQKDKSTKN---MSGLKRITIIGKQLIQEEGFRALYKGITPRVM 279
                   P++ ++TRLQ   +  +    +G K + +   + ++ EG++ L+KG+ P + 
Sbjct: 466 TVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLL---KTLEREGYQGLFKGLVPTLA 522

Query: 280 RVAPGQAVTFTAYEFIRK 297
           +V P  ++++  YE ++K
Sbjct: 523 KVCPAVSISYLCYENLKK 540

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 86/198 (43%), Gaps = 17/198 (8%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI-KTGGEIYRNEGFLAFYKG 73
           IAGG AG+      +P+DT+K R+Q     + + +K    + +T  +++R  G   FY+G
Sbjct: 352 IAGGLAGMAAQFSVYPIDTLKFRVQC--APLDTKLKGNNLLFQTAKDMFREGGLRLFYRG 409

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKET-------GKVSTGNTFIAGVGA-GITEAX 125
           +   ++GI P  A+   ++   +     K+         +V+  N  +  +GA   T   
Sbjct: 410 VTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGA 469

Query: 126 XXXXXXXXXKIRLQAQ--HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                    + RLQAQ  + +P      Y          ++ EG+  L++G+  T A+  
Sbjct: 470 SVVYPINLLRTRLQAQGTYAHPYV----YNGFKDVLLKTLEREGYQGLFKGLVPTLAKVC 525

Query: 184 TNQGANFTVYSKLKEFLQ 201
                ++  Y  LK+F+ 
Sbjct: 526 PAVSISYLCYENLKKFMN 543

>Kwal_55.20868
          Length = 380

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 125/303 (41%), Gaps = 23/303 (7%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           +  ++G  AG + G+   PLD  K R+Q             G + T   I R+EG    Y
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITE---AXXXX 128
           KGL  +++G  P   I FS YE  + L       ++     FI+   + +T    +    
Sbjct: 137 KGLVPIIMGYFPTWMIYFSVYERSKKLYP-----RIFPSFDFISHSASALTAGTVSTILT 191

Query: 129 XXXXXXKIRLQAQ-HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQG 187
                 K RL  Q H+N  + +  Y +   A + +   EG    Y G+ L +     +  
Sbjct: 192 NPVWVVKTRLMLQTHVN--KNSTHYTSTFDAFHKMYTTEGLRTFYAGL-LPSLLGLFHVA 248

Query: 188 ANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLI-----SGAIGPFSNAPLDTIKTRLQ-K 241
            +F +Y KLK +L    +         +L  LI     S  +      P + ++TR+Q K
Sbjct: 249 IHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLK 308

Query: 242 DKSTKNMSGLKRITIIG-----KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
              T  ++ L++ +  G     K   + EG R  Y G T  + R  P  A+T  ++E+ R
Sbjct: 309 AYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFR 368

Query: 297 KEL 299
           K L
Sbjct: 369 KYL 371

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 129/305 (42%), Gaps = 44/305 (14%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++I+G   G+ + L   P D  KVRMQ       SG  +P  I+    + +NEG LAFYK
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQ-----TSSG--SPTAIEVIKNLVKNEGLLAFYK 78

Query: 73  GLGAVVIGITPKMAIRFSSYE-----FYR---------TLLADKETGKVS-TGNTFIAGV 117
           G    +IG+   ++ +F   E     F R         +LL     G VS + N F+A  
Sbjct: 79  GTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLA-- 136

Query: 118 GAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSL 177
                            +IRLQ Q         +Y+ ++     ++K++   AL RG + 
Sbjct: 137 -----------TPIEHVRIRLQLQ--TKALAKAEYRGSLDCMKKLLKQK---ALMRGFTA 180

Query: 178 TAARQATNQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTI 235
           T  R +   G  F  Y  L   +   G   ++ +P W+  + G  SGA       P D +
Sbjct: 181 TLMRTSHGFGVYFLTYEALIMNQNKNGVLRKD-IPPWKVCVFGAFSGAFFWAMTYPFDVV 239

Query: 236 KTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           K+ +Q D+    + G K +  + K +    G+ A  KG  P ++R  P    TF  +E  
Sbjct: 240 KSIMQADRLVSPVHG-KNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVT 298

Query: 296 RKELE 300
            + LE
Sbjct: 299 MRLLE 303

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 126/299 (42%), Gaps = 32/299 (10%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR----NEGFL 68
           +L+AG   G+ + L   P DT KVR+Q                 T  E+ R    NEG  
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-----------TAMEVVRKLLANEGPR 76

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEA 124
            FYKG    +IG+   ++++F   E    F+    AD  +  +S    +  GV  GI  +
Sbjct: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS-TLSLPQYYACGVTGGIVNS 135

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     +IRLQ Q  +      ++K  ++    I K     AL RG++ T  R+  
Sbjct: 136 FLASPIEHV-RIRLQTQTGSGTNA--EFKGPLEC---IKKLRHNKALLRGLTPTILREGH 189

Query: 185 NQGANFTVYSKL----KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240
             G  F VY  L        +G   ++ +P+W+  + G +SG        PLD IK+ +Q
Sbjct: 190 GCGTYFLVYEALIANQMNKRRGLERKD-IPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            D   K   G   I+ + K L    G  A +KG  P ++R AP    TF  +E   + L
Sbjct: 249 TDNLQKPKFG-NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

>Scas_632.9
          Length = 292

 Score = 85.5 bits (210), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 130/298 (43%), Gaps = 21/298 (7%)

Query: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR 63
           K    N   +++ G  AG    +  +P DT+KVR+Q      GS +  P         Y 
Sbjct: 11  KSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQ----TQGSHI-FPTTWSCIKYTYH 65

Query: 64  NEG-FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGIT 122
           NEG +  F++G+G+ + G   + A  F SY     +L +K T      N  ++G  AG +
Sbjct: 66  NEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVL-EKFTNVSPLSNILLSGAFAG-S 123

Query: 123 EAXXXXXXXXXXKIRLQAQHL-NPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
            A          K +LQ  +L   VEG  K+   +     +++E+G   L++G S T  R
Sbjct: 124 CASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIR 183

Query: 182 QATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
           ++    A F  Y  +K+ L+         +WE  + G  +G     S  P DT+K+ +Q 
Sbjct: 184 ESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQT 243

Query: 242 DKSTKNMSGLKRITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           +           IT+I   K+++   G    Y+G+   ++R  P  A  F  YE + K
Sbjct: 244 E----------HITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETLSK 291

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 18/173 (10%)

Query: 135 KIRLQAQ--HLNPVEGAPKYKNAVQAC--YTIVKEEGFSALYRGVSLTAARQATNQGANF 190
           K+RLQ Q  H+ P            +C  YT   E  +   ++G+       A      F
Sbjct: 42  KVRLQTQGSHIFP---------TTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLF 92

Query: 191 TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSG 250
             Y++    L+ + N   L +    L G  +G+   F   P++ IK +LQ       + G
Sbjct: 93  VSYNQCSNVLEKFTNVSPLSN--ILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEG 150

Query: 251 -LKRITIIGKQL--IQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
            +K   II   +  ++E+G   L++G +   +R + G    F  YE +++ L+
Sbjct: 151 QIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLK 203

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 85.5 bits (210), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 127/302 (42%), Gaps = 19/302 (6%)

Query: 8   SNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGF 67
           ++  V  +AGG AG +      P + +K+ +Q+  +         G ++   ++YR EG 
Sbjct: 20  NDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVR---QVYREEGT 76

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL--ADKETGKVSTGN---TFIAGVGAGIT 122
              ++G G   I I P  A++F  YE  +      D   G+    N    F   +  G +
Sbjct: 77  PGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS 136

Query: 123 EAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQA------CYTIVKEEGFSALYRGVS 176
                       ++ +Q  +L  +  +  +  +         C T  +E G   LYRGV 
Sbjct: 137 VLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVW 196

Query: 177 LTAARQATNQGANFTVYSKLKEFL-QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTI 235
            T+         NF VY + KEF+ +G  N   L ++    IG +SG +      P D +
Sbjct: 197 PTSLGVVPYVALNFAVYEQFKEFMPEGTDNT--LANFYKLSIGALSGGVAQTVTYPFDLL 254

Query: 236 KTRLQKDKSTKNMSGLKRITIIGKQLI--QEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           + R Q      N  G +  +++   +   + EGFR  YKG+T  + +V P  AV++  YE
Sbjct: 255 RRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314

Query: 294 FI 295
            +
Sbjct: 315 VV 316

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 216 LIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIG--KQLIQEEGFRALYKG 273
           L G ++GA+     +P + +K  LQ   ST   +      I+G  +Q+ +EEG   L++G
Sbjct: 27  LAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ----GIVGAVRQVYREEGTPGLFRG 82

Query: 274 ITPRVMRVAPGQAVTFTAYEFIRKEL 299
                +R+ P  AV F  YE  +K  
Sbjct: 83  NGLNCIRIFPYSAVQFVVYEACKKHF 108

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 85.5 bits (210), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 130/312 (41%), Gaps = 31/312 (9%)

Query: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR 63
           KQ S+   +  +AGG AG +      P + +K+ +Q+  +         G   +  ++Y 
Sbjct: 19  KQDSN---IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN---RGIFSSIRQVYH 72

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL--ADKETGKVSTGNT---FIAGVG 118
            EG    ++G G   I I P  A++F  YE  +  L   +   G+    NT   F   + 
Sbjct: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNP--------VEGAPKYKNAVQACYTIVKEEGFSA 170
            G +            ++ +Q  +L+         +   P     +   Y +  E G   
Sbjct: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRL--EGGLRG 190

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSL----IGLISGAIGP 226
           LYRGV  T+         NF VY +L+EF  G ++ +  PSW+++L    IG ISG +  
Sbjct: 191 LYRGVWPTSLGVVPYVALNFAVYEQLREF--GVNSSDAQPSWKSNLYKLTIGAISGGVAQ 248

Query: 227 FSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKGITPRVMRVAP 283
               P D ++ R Q      N  G  R T +   L+   + EG    YKG+   + +V P
Sbjct: 249 TITYPFDLLRRRFQVLAMGGNELGF-RYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVP 307

Query: 284 GQAVTFTAYEFI 295
             AV++  YE +
Sbjct: 308 STAVSWLVYEVV 319

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 66/151 (43%), Gaps = 17/151 (11%)

Query: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL---QGYHNQEMLPSWETSLIG 218
           +  EEG   L+RG  L   R        F VY   K+ L    G + QE L + +    G
Sbjct: 70  VYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSG 129

Query: 219 LISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITI--IGK-----QLIQEE-----G 266
            + G     +  PLD IKTRL     T N+S L R     I K     QL+ E      G
Sbjct: 130 ALCGGCSVVATYPLDLIKTRLSIQ--TANLSSLNRSKAKSISKPPGIWQLLSETYRLEGG 187

Query: 267 FRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
            R LY+G+ P  + V P  A+ F  YE +R+
Sbjct: 188 LRGLYRGVWPTSLGVVPYVALNFAVYEQLRE 218

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR 253
           + +K+FL+   N   L        G ++GA+     +P + +K  LQ   ST + +  + 
Sbjct: 12  NSIKDFLKQDSNIAFLA-------GGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RG 62

Query: 254 ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           I    +Q+  EEG + L++G     +R+ P  AV F  YE  +K+L
Sbjct: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 84.3 bits (207), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 122/293 (41%), Gaps = 47/293 (16%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L++G  AG    +   P+DT+K R+Q                   G  + N G+   Y+
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQ-----------------AKGGFFHNGGYRGIYR 50

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLL--------ADKETGKVSTGNTFIAGVGAGITEA 124
           GLG+ V+   P  ++ F +Y+  +  L        A ++  +V T    +     G   A
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLT---HMLSSSLGEMSA 107

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE---EGF-SALYRGVSLTAA 180
                     K R Q  H N         +++Q    I+++   EG    LYRG   T  
Sbjct: 108 CLVRVPAEVIKQRTQTHHTN---------SSLQTLRLILRDPTGEGVVRGLYRGWWTTIM 158

Query: 181 RQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240
           R+       F +Y  LK+    Y   E + +W+ ++ G ++G I   +  PLD +KTR+ 
Sbjct: 159 REIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMM 218

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
             +    M  L R       L +EEG R  ++GI PR M ++ G A+    YE
Sbjct: 219 LHERRVPMLHLAR------TLFREEGARVFFRGIGPRTMWISAGGAIFLGVYE 265

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 64/156 (41%), Gaps = 18/156 (11%)

Query: 153 KNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSW 212
           K  +QA        G+  +YRG+       A      F  Y  +K+ L+      ++  W
Sbjct: 30  KTRLQAKGGFFHNGGYRGIYRGLGSAVVASAPGASLFFVTYDSMKQQLR-----PVMGRW 84

Query: 213 ETS------LIGLISGAIGPFS----NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI 262
             S      L  ++S ++G  S      P + IK R Q   +    S L+ + +I +   
Sbjct: 85  TASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQTHHTN---SSLQTLRLILRDPT 141

Query: 263 QEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
            E   R LY+G    +MR  P   + F  YE+++K+
Sbjct: 142 GEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKK 177

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 20/91 (21%)

Query: 214 TSLIGLISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRA 269
           T L  L+SGA    S      P+DT+KTRLQ                         G+R 
Sbjct: 4   TFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG----------------FFHNGGYRG 47

Query: 270 LYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           +Y+G+   V+  APG ++ F  Y+ ++++L 
Sbjct: 48  IYRGLGSAVVASAPGASLFFVTYDSMKQQLR 78

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           PLD +K RM +++  V         +     ++R EG   F++G+G   + I+   AI  
Sbjct: 209 PLDVLKTRMMLHERRVP-------MLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFL 261

Query: 90  SSYEFYRTLL 99
             YE   +L 
Sbjct: 262 GVYEAVHSLF 271

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 86.7 bits (213), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 132/304 (43%), Gaps = 36/304 (11%)

Query: 27  CCHPLDTIKVRM----------------QIYKN--AVGSGVKAPGFIKTGGEIYRNEGFL 68
           C  P D IKV +                 ++ N  A  + +++P  +K    +YR  G  
Sbjct: 192 CTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSP-LVKAATSLYRQGGLR 250

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGNTFIAGVGAGITEA 124
           AFY G G  VI + P+ A++F S+E  + +LA      ETG++S  +T++AG G G   A
Sbjct: 251 AFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAG-GLGGIMA 309

Query: 125 XXXXXXXXXXKIRLQAQHLNP-VEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                     K R+Q   L+    G P      +  Y   +E G    YRG+ +      
Sbjct: 310 QFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMY---REGGLRLFYRGLGVGILGVF 366

Query: 184 TNQGANFTVYSKLKEF--------LQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTI 235
                +   +S LK +        L    N+ ++ +     +G  SG +G     P++ +
Sbjct: 367 PYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLL 426

Query: 236 KTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           +TRLQ   +  +         + ++ +Q EG   LYKG+ P + +V P  A+++  YE +
Sbjct: 427 RTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENL 486

Query: 296 RKEL 299
           ++ +
Sbjct: 487 KRAM 490

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 87/198 (43%), Gaps = 17/198 (8%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYK-NAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           +AGG  G+M     +P+DT+K R+Q    +    G+  P  IKT  ++YR  G   FY+G
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGL--PLLIKTAKDMYREGGLRLFYRG 357

Query: 74  LGAVVIGITPKMAIRFSSY----EFYRTLLADK---ETGKVSTGNTFIAGVGA-GITEAX 125
           LG  ++G+ P  A+   ++     +Y T  A+       +V   N  +  +GA   T   
Sbjct: 358 LGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGA 417

Query: 126 XXXXXXXXXKIRLQAQ--HLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                    + RLQAQ  + +P     +Y          V+ EG   LY+G+  T A+  
Sbjct: 418 TVVYPINLLRTRLQAQGTYAHP----HRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVC 473

Query: 184 TNQGANFTVYSKLKEFLQ 201
                ++  Y  LK  ++
Sbjct: 474 PAVAISYLCYENLKRAMR 491

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 82.8 bits (203), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 113/290 (38%), Gaps = 28/290 (9%)

Query: 17  GGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGA 76
           GG  G++  +  HPLD  KVR+Q       +    P  ++   +I RNEG    Y GL A
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQT------APAPKPTLVRMASQILRNEGVPGLYSGLTA 68

Query: 77  VVIGITPKMAIRFSSYEFYRTLLADKETGK----VSTGNTFIAGVGAGITEAXXXXXXXX 132
            ++        RF  Y+F +     KE       +   + F   VG  I           
Sbjct: 69  AILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGGLIGNP------AD 122

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
              IR+Q     P E    YKNA    Y I   EG + L+ G      R      +    
Sbjct: 123 VVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVT 182

Query: 193 YSKLKEFL---QGYHNQEMLPSWETSLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNM 248
           Y   K +L    G         + +SL+ GL++  +     +P D IKTR+       + 
Sbjct: 183 YDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVC----SPADVIKTRVMNAHKHSHD 238

Query: 249 SGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           S ++    I    +++EG   +++G  P  +R+ P   + F   E +RK 
Sbjct: 239 SAVR----ILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRKH 284

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 138/318 (43%), Gaps = 42/318 (13%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKV----RMQIYKNAVGS--------------GVKAPGFI 55
            IAGG +G++   C  P D +KV    R  +    + S               +++P  +
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSP-LV 262

Query: 56  KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD----KETGKVSTGN 111
           K    +YR  G  +FY G G   + + P+ +I+F S+E  + L+      K+T  +S  +
Sbjct: 263 KAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLS 322

Query: 112 TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLN-PVEGAPKYKNAVQACYTIVKEEGFSA 170
           TFIAG  AG+  A          K R+Q   LN  ++G    K  +Q    +  E G   
Sbjct: 323 TFIAGGLAGVC-AQFSVYPIDTLKFRMQCAPLNAELKGR---KLMIQTAKEMYTEGGLKL 378

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEF--------LQGYHNQEMLPSWETSLIGLISG 222
            YRGV++           +   +S LK++        L        L +     +G  SG
Sbjct: 379 FYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSG 438

Query: 223 AIGPFSNAPLDTIKTRLQKDKSTKN---MSGLKRITIIGKQLIQEEGFRALYKGITPRVM 279
             G     P++ ++TRLQ   +  +     G + + +   + IQ EG+  L+KG+ P + 
Sbjct: 439 TFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLL---KTIQREGYPGLFKGLVPTLA 495

Query: 280 RVAPGQAVTFTAYEFIRK 297
           +V P  ++++  YE ++K
Sbjct: 496 KVCPAVSISYLCYENLKK 513

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 82/197 (41%), Gaps = 13/197 (6%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYK-NAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
            IAGG AG+      +P+DT+K RMQ    NA   G K    I+T  E+Y   G   FY+
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKL--MIQTAKEMYTEGGLKLFYR 381

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLL-------ADKETGKVSTGNTFIAGVGA-GITEA 124
           G+   V+GI P  A+   ++   +           +K+   V   N  +  +GA   T  
Sbjct: 382 GVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFG 441

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     + RLQAQ         +Y          ++ EG+  L++G+  T A+   
Sbjct: 442 ATVVYPINLLRTRLQAQ--GTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCP 499

Query: 185 NQGANFTVYSKLKEFLQ 201
               ++  Y  LK+ ++
Sbjct: 500 AVSISYLCYENLKKLMK 516

>Scas_697.47
          Length = 328

 Score = 83.2 bits (204), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 124/294 (42%), Gaps = 26/294 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA--- 69
           +L+AGG  G+   L  HP D IKVR Q       S + A   I            L    
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ--SGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 70  --FYKGLGAVVIGITPKMAIRFSSYEFYRTLL--ADKETGKVSTGNTFIAGVGAGITEAX 125
             FYKG+   ++G+TP  A+ F  Y+  + ++  +D  + +++ G    AG    I+   
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGF---ISAIP 153

Query: 126 XXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATN 185
                    +I++  Q      GA    + + A   IVK+ G  +L++G   T AR    
Sbjct: 154 TTLVTAPTERIKVVLQ----TAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPG 209

Query: 186 QGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGL-ISGAIGPFSNA----PLDTIKTRLQ 240
               F  Y   K+FL   +      + E ++  + ++G I   S      P+DTIKT+LQ
Sbjct: 210 SALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ 269

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
               +++M    R     +  ++  G +  + G+ P ++R  P  A TF   E 
Sbjct: 270 SSSGSQSMVAATR-----EIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 42/98 (42%), Gaps = 8/98 (8%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
           SK    N A   +AGG AG+   L   P+DTIK ++Q       S   +   +    EIY
Sbjct: 233 SKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ-------SSSGSQSMVAATREIY 285

Query: 63  -RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
            +  G   F+ GLG  ++   P  A  F   E   +L 
Sbjct: 286 VKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSLF 323

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
           G IS        AP + IK  LQ   +    S +       K ++++ G ++L+KG    
Sbjct: 147 GFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIGA----AKNIVKDGGVKSLFKGSLAT 202

Query: 278 VMRVAPGQAVTFTAYEFIRKELE 300
           + R  PG A+ F +YE  +K L 
Sbjct: 203 LARDGPGSALYFASYEISKKFLN 225

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 215 SLIGLISGAIG----PFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQL----IQEEG 266
           +L  L++G +G      +  P D IK R Q  +++  +  +K I    + +    +    
Sbjct: 36  NLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNS 95

Query: 267 FRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
            +  YKG+ P ++ V P  AV+F  Y+  +K
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKK 126

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 83.2 bits (204), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 125/298 (41%), Gaps = 36/298 (12%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI------KTGGEIYRNEG 66
           + +AGG  G+      HP D IKVR Q       S V A   I      +  G ++ N  
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQ--NGQANSTVHAITNIIKEAKTQVKGTLFTNS- 94

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA--DKETG--KVSTGNTFIAGVGAGIT 122
              FYKG+   ++G+TP  A+ F  Y+  + L+   +K+ G  +++ G    AG  + I 
Sbjct: 95  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAI- 153

Query: 123 EAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQ 182
                       K+ LQ              + +QA  TIVKE G ++L++G   T AR 
Sbjct: 154 PTTLVTAPTERVKVVLQTSSKG---------SFIQAAKTIVKEGGIASLFKGSLATLARD 204

Query: 183 ATNQGANFTVYSKLKEFL------QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIK 236
                  F  Y   K +L      Q     E +      L G I+G     +  P+DTIK
Sbjct: 205 GPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIK 264

Query: 237 TRLQKDKSTKNM-SGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           T+LQ   + +NM S  K I       +Q  G +  + G+ P ++R  P  A TF   E
Sbjct: 265 TKLQASSTRQNMLSATKEI------YLQRGGIKGFFPGLGPALLRSFPANAATFLGVE 316

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 8/99 (8%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI 61
           A K +  N     +AGG AG+   L   P+DTIK ++Q       +       +    EI
Sbjct: 231 AGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQ-------ASSTRQNMLSATKEI 283

Query: 62  YRNEGFL-AFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
           Y   G +  F+ GLG  ++   P  A  F   E   +L 
Sbjct: 284 YLQRGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLF 322

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 7/83 (8%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
           G IS        AP + +K  LQ       +   K I       ++E G  +L+KG    
Sbjct: 148 GFISAIPTTLVTAPTERVKVVLQTSSKGSFIQAAKTI-------VKEGGIASLFKGSLAT 200

Query: 278 VMRVAPGQAVTFTAYEFIRKELE 300
           + R  PG A+ F +YE  +  L 
Sbjct: 201 LARDGPGSALYFASYEISKNYLN 223

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 82.0 bits (201), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 125/287 (43%), Gaps = 24/287 (8%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI---YRNEGF 67
           A +++ G  AG +  +  +P DT+KVR+Q           A  F  T   I   Y NEG 
Sbjct: 7   AKDILYGSIAGAVGKVIEYPFDTVKVRLQTQP--------AHMFPTTWSCIKFTYDNEGL 58

Query: 68  L-AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX 126
              FY+G+G+ + G   + A+ F S+   + LL D E+       T  AG  AG   A  
Sbjct: 59  WRGFYQGIGSPLAGAALENAVLFVSFNQAKRLL-DVESLLSPLSKTVWAGAFAGAC-ASF 116

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   K +LQ  +L+  + +  +   +    +++ E GF  L++G S T  R++   
Sbjct: 117 VLTPVELIKCKLQVSNLSTTKTS--HTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGG 174

Query: 187 GANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
            A FT Y  +K +L      E   +WE    G  +G     S  P DTIK+ +Q D    
Sbjct: 175 AAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDH--I 232

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           ++S   R      ++   +G    Y+G+   ++R  P  A  F  YE
Sbjct: 233 DLSSATR------KIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 71/165 (43%), Gaps = 7/165 (4%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K+RLQ Q   P    P   + ++  +T   E  +   Y+G+    A  A      F  ++
Sbjct: 31  KVRLQTQ---PAHMFPTTWSCIK--FTYDNEGLWRGFYQGIGSPLAGAALENAVLFVSFN 85

Query: 195 KLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254
           + K  L       + P  +T   G  +GA   F   P++ IK +LQ    +   +   +I
Sbjct: 86  QAKRLLD--VESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKI 143

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
               K ++ E GF  L++G +   +R + G A  FT YE ++  L
Sbjct: 144 LPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYL 188

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 82.0 bits (201), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 90/303 (29%), Positives = 126/303 (41%), Gaps = 33/303 (10%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVK---------- 50
           MA   +  +    L+    AG++E    HP+DTI  R+      + SG +          
Sbjct: 1   MAHNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHA 60

Query: 51  APGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEF---YRTLLADKETGKV 107
           A  F K    ++   G+ A YK L  V        A  F +  F   + +   DK TGK 
Sbjct: 61  AEAFGKRVFTLFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDK-TGKA 119

Query: 108 STGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEG 167
               T  AG   GI E           KI+ Q    NP      +K   +    I+K+EG
Sbjct: 120 LRSAT--AGSLIGIGE--IVLLPLDVLKIKRQT---NP----EAFKG--RGFLKILKDEG 166

Query: 168 FSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPF 227
              LYRG   TAAR A    A F   +  KE++ G  +     +W  + I  I GA    
Sbjct: 167 IFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQ-ATWSQNFISSIVGASASL 225

Query: 228 -SNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286
             +APLD IKTR+Q        SG K    I K  ++ EGF A +KG+TP+++   P   
Sbjct: 226 IVSAPLDVIKTRIQNRNFDNPESGFK----IVKNTLKNEGFTAFFKGLTPKLLTTGPKLV 281

Query: 287 VTF 289
            +F
Sbjct: 282 FSF 284

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 12/90 (13%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP--GFIKTGGE 60
           S+   S   ++ I G  A L   +   PLD IK R+Q            P  GF K    
Sbjct: 206 SQATWSQNFISSIVGASASL---IVSAPLDVIKTRIQ------NRNFDNPESGF-KIVKN 255

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFS 90
             +NEGF AF+KGL   ++   PK+   F+
Sbjct: 256 TLKNEGFTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 12/83 (14%)

Query: 215 SLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           SLIG     IG     PLD +K + Q +       G  +I       +++EG   LY+G 
Sbjct: 127 SLIG-----IGEIVLLPLDVLKIKRQTNPEAFKGRGFLKI-------LKDEGIFNLYRGW 174

Query: 275 TPRVMRVAPGQAVTFTAYEFIRK 297
                R APG    F    F ++
Sbjct: 175 GWTAARNAPGSFALFGGNAFAKE 197

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 81.6 bits (200), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 126/293 (43%), Gaps = 39/293 (13%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L++G  AG    L   P+DT+K R+Q                   G  + N G+   Y+
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQ-----------------AKGGFFANGGYKGVYR 51

Query: 73  GLGAVVIGITPKMAIRFSSYE----FYRTLLADK-ETGKVSTGNTFIAGVGAGITEAXXX 127
           GLG+ V+   P  ++ F +Y+    + R ++      G+  T +T    V +   E    
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISAC 111

Query: 128 XXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSAL----YRGVSLTAARQA 183
                   +R+ A+ +       +  +++Q    +++ E    L    YRG S T  R+ 
Sbjct: 112 M-------VRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREI 164

Query: 184 TNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDK 243
                 F +Y  +K+       +E    W+ S+ G I+G I   +  PLD +KTR+    
Sbjct: 165 PFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHH 224

Query: 244 STKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
             K++S L     + K ++QEEG +  + G+ PR M ++ G A+    YE + 
Sbjct: 225 --KSVSALH----LAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 62/142 (43%), Gaps = 18/142 (12%)

Query: 167 GFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWET----SLIGLISG 222
           G+  +YRG+       A +    F  Y  +K + +    Q +LP  E     +L  ++S 
Sbjct: 45  GYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQ-LLPKGEDQTADTLSHMVSS 103

Query: 223 AIGPFS----NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEG---FRALYKGIT 275
           + G  S      P + IK R Q  ++  ++  L+ +      L  E G    R LY+G +
Sbjct: 104 SFGEISACMVRVPAEVIKQRTQTHRTNSSLQTLQAL------LRNENGEGLRRNLYRGWS 157

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
             +MR  P   + F  YE+++K
Sbjct: 158 TTIMREIPFTCIQFPLYEYMKK 179

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           PLD +K R+ ++  +V +       +     + + EG   F+ G+G   + I+   AI  
Sbjct: 212 PLDVLKTRIMLHHKSVSA-------LHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFL 264

Query: 90  SSYEFYRTLL 99
             YE   +L 
Sbjct: 265 GVYETVHSLF 274

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 128/300 (42%), Gaps = 30/300 (10%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFY 71
           +++ G  AG +  +  +P DT+KVR+Q     V      P         Y+NEG +  F+
Sbjct: 16  DILYGSIAGALGKVIEYPFDTVKVRLQTQGRHV-----FPDTWSCITYTYKNEGIIKGFF 70

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
           +G+ + + G   + A  F SY      L    T      N  I+G  AG + A       
Sbjct: 71  QGIASPLAGAAIENAALFLSYNQCSKFL-QHYTNVSDLTNILISGAFAG-SCASFVLTPV 128

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYT--------IVKEEGFSALYRGVSLTAARQA 183
              K +LQ  +L  +       N V   +T        ++K  GF  L++G S T  R++
Sbjct: 129 ELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRES 188

Query: 184 TNQGANFTVYSKLKEFLQGYHNQE--MLP----SWETSLIGLISGAIGPFSNAPLDTIKT 237
               A F  Y  +K++L+  HN E   LP    +WE    G  +G     S  P DT+K+
Sbjct: 189 FGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKS 248

Query: 238 RLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
            +Q +       GLK      K++  E+G R  Y+G+   ++R  P  A  F  YE + K
Sbjct: 249 MMQTEH-----LGLKTAI---KKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSK 300

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 76/184 (41%), Gaps = 33/184 (17%)

Query: 135 KIRLQAQ--HLNPVEGAPKYKNAVQAC--YTIVKEEGFSALYRGVSLTAARQATNQGANF 190
           K+RLQ Q  H+ P            +C  YT   E      ++G++   A  A    A F
Sbjct: 38  KVRLQTQGRHVFP---------DTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALF 88

Query: 191 TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSG 250
             Y++  +FLQ Y N   L +   S  G  +G+   F   P++ IK +LQ      N+  
Sbjct: 89  LSYNQCSKFLQHYTNVSDLTNILIS--GAFAGSCASFVLTPVELIKCKLQ----VSNLQS 142

Query: 251 L--------------KRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIR 296
           L               RI    + +I+  GF  L++G +   +R + G    F  YE ++
Sbjct: 143 LPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMK 202

Query: 297 KELE 300
           K L+
Sbjct: 203 KYLK 206

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 38/95 (40%), Gaps = 3/95 (3%)

Query: 206 QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEE 265
           Q +  ++   L G I+GA+G     P DT+K RLQ             IT   K    E 
Sbjct: 8   QWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYK---NEG 64

Query: 266 GFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
             +  ++GI   +   A   A  F +Y    K L+
Sbjct: 65  IIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQ 99

>Kwal_23.4731
          Length = 314

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 130/313 (41%), Gaps = 42/313 (13%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEG-----FL 68
           +IAG  AG +  +  HPLD +K+R+Q+  N   S     G+ +    I R+       F 
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHS----HGYKEVIKTIIRDSKADSNVFR 72

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLL-----------------ADKETG-KVSTG 110
             Y+GLG  +IG +    + F  Y F + ++                  DK  G  +   
Sbjct: 73  EAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLA 132

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           +  ++G+G  I             K R+ +      + + +YK        +   EGFS 
Sbjct: 133 SAALSGLGTAI-----LTNPIWVIKTRIMS---TSSQASERYKTTWDGIRKVYAHEGFSG 184

Query: 171 LYRGVSLTAARQATNQGA-NFTVYSKLKEFL---QGYHNQEMLPSWETSLIGLISGAIGP 226
            +RG  L  +     QGA  FT+Y  L+      +G    E + + E   I  +S  +  
Sbjct: 185 FWRG--LVPSLFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSV 242

Query: 227 FSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286
            +  P   +K+ LQ   + +     +   ++ K + Q+EG + LYKG++  ++R  P   
Sbjct: 243 TAVYPFQLLKSNLQSFAAVEKRDSYRFWNLV-KSIHQKEGLQGLYKGLSANLLRAIPSTC 301

Query: 287 VTFTAYEFIRKEL 299
           +TF  YE +R  L
Sbjct: 302 ITFCIYENLRHWL 314

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 90/210 (42%), Gaps = 29/210 (13%)

Query: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE--- 60
           K K+  P++ L +   +GL   +  +P+  IK R+      + +  +A    KT  +   
Sbjct: 121 KDKAMGPSLYLASAALSGLGTAILTNPIWVIKTRI------MSTSSQASERYKTTWDGIR 174

Query: 61  -IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRT-------LLADKETGKVSTGNT 112
            +Y +EGF  F++GL   + G+  + AI F+ Y+  R        +  D++ G +   N 
Sbjct: 175 KVYAHEGFSGFWRGLVPSLFGV-AQGAIYFTIYDSLRHQYFARRGITEDEKMGNLE--NI 231

Query: 113 FIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYK--NAVQACYTIVKEEGFSA 170
            I  V   ++             ++   Q    VE    Y+  N V+   +I ++EG   
Sbjct: 232 AITSVSKMLSVTAVYPFQL----LKSNLQSFAAVEKRDSYRFWNLVK---SIHQKEGLQG 284

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFL 200
           LY+G+S    R   +    F +Y  L+ +L
Sbjct: 285 LYKGLSANLLRAIPSTCITFCIYENLRHWL 314

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 80.9 bits (198), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 122/296 (41%), Gaps = 38/296 (12%)

Query: 17  GGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGA 76
           GG AG+   +  HPLD  KVR+Q       + +  P  ++    I +NEG +  Y GL A
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ------AAPIPKPTIVQMLRSILKNEGIVGLYAGLSA 66

Query: 77  VVIGITPKMAIRFSSYEFYR--TLLADKETGKVS-TGNTFIAGVGAGITEAXXXXXXXXX 133
            ++        RF  Y+  +   +  DK T      G + ++G   G+            
Sbjct: 67  SLLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLA-----GNFADL 121

Query: 134 XKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALY---------RGVSLTAARQAT 184
             IR+Q     P++    YKNA+     I K EG  +L+         RGV +TA++  T
Sbjct: 122 INIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVT 181

Query: 185 NQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRL---QK 241
                   Y   K FL   +N +   +       L++G +     +P D IKT +    K
Sbjct: 182 --------YDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHK 233

Query: 242 DKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
                + S  K    I  + I +EG   +++G  P   R+AP   + F A E ++K
Sbjct: 234 KPGHNHDSSFK----ILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKK 285

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 8/81 (9%)

Query: 222 GAIGPFS---NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
           GA G F+     PLD  K RLQ     K       I  + + +++ EG   LY G++  +
Sbjct: 14  GAAGIFAVMNTHPLDLTKVRLQAAPIPK-----PTIVQMLRSILKNEGIVGLYAGLSASL 68

Query: 279 MRVAPGQAVTFTAYEFIRKEL 299
           +R        F  Y+ +++ +
Sbjct: 69  LRQCTYTTARFGMYDALKEHV 89

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 137/330 (41%), Gaps = 58/330 (17%)

Query: 5   QKSSNPAVNLI-AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR 63
           Q   N  V LI AG  +GL      +P + +K  +Q+++N V     A  F   G ++  
Sbjct: 3   QNKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVA----AKPFEVLGYQVR- 57

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL---ADKETGKVSTGNTFIAGVGAG 120
                 ++ G  AV IG+  K ++RF +++     L   A  +   +S     +AG   G
Sbjct: 58  -----TYFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTG 112

Query: 121 ITEAX-----------------XXXXXXXXXKIRLQAQHLNPVEGA----PKYKNAVQAC 159
             E+                              +Q Q  N V+      P  +++ +A 
Sbjct: 113 TMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEAL 172

Query: 160 Y-------------TIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL-QGYHN 205
           +              + ++ G  A ++G   T  RQ  N    FT ++ LK+F  + Y N
Sbjct: 173 FPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQN 232

Query: 206 QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITI-IGKQLIQE 264
            E    +  +L+GLIS      +  PLD IKTR+Q   S      L R +I    ++  E
Sbjct: 233 NE----YFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVL----LYRNSINCAYRIFVE 284

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
           EGF  L+KG  PR+M+V    +V+F  Y++
Sbjct: 285 EGFAMLWKGWLPRLMKVGLSGSVSFGIYQY 314

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 16/78 (20%)

Query: 29  HPLDTIKVRMQ------IYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGIT 82
            PLD IK RMQ      +Y+N++    +          I+  EGF   +KG    ++ + 
Sbjct: 253 QPLDVIKTRMQAKDSVLLYRNSINCAYR----------IFVEEGFAMLWKGWLPRLMKVG 302

Query: 83  PKMAIRFSSYEFYRTLLA 100
              ++ F  Y++   ++A
Sbjct: 303 LSGSVSFGIYQYTENMIA 320

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           +L ++ G RA +KG  P +MR      V FT +  +++
Sbjct: 187 ELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ 224

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 150/335 (44%), Gaps = 54/335 (16%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQ--IYKNAVGSGVKAPG---------- 53
           K   P V+ +AGG  G+   +   P D +K R+Q  +++ A  S  K+ G          
Sbjct: 48  KEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQG 107

Query: 54  ---FIKTGG---EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSY----EFYRTLLADKE 103
              F +T G    +YRNEGF + +KGLG  ++G+ P  +I F +Y    E Y   L +  
Sbjct: 108 VRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNN-- 165

Query: 104 TGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIV 163
            G+ +     +A   AG   +          K RLQ   L+      KYKN+      +V
Sbjct: 166 -GQEAVWIHLMAAATAGWATS-TATNPIWLVKTRLQ---LDKAGTTKKYKNSWDCLKNVV 220

Query: 164 KEEGFSALYRGVSLTAARQATNQGA-NFTVYSKLKEFLQGYHNQ-------------EML 209
           ++EG   LY+G  L+A+   + +G   + +Y ++K  ++    +             + +
Sbjct: 221 QKEGILGLYKG--LSASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKI 278

Query: 210 PSW-ETSLIGLISGAIGPFSNAPLDTIKTRLQK---DKSTKNMSGL-KRITIIGKQLIQE 264
             W + S    ++  +      P + ++TRL++   +      +GL + I +I    I+E
Sbjct: 279 KEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVI----IKE 334

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           EG  ++Y G+TP ++R  P   + F  +E + + L
Sbjct: 335 EGLASMYGGLTPHLLRTVPNSIIMFGTWELVIRLL 369

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           + G A  +  +  +P + ++ R++      G  +K  G +++   I + EG  + Y GL 
Sbjct: 287 SAGLAKFVASIITYPHEVVRTRLRQAPLENGK-LKYTGLVQSIRVIIKEEGLASMYGGLT 345

Query: 76  AVVIGITPKMAIRFSSYEFYRTLLA 100
             ++   P   I F ++E    LL+
Sbjct: 346 PHLLRTVPNSIIMFGTWELVIRLLS 370

>Kwal_23.2913
          Length = 320

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 123/305 (40%), Gaps = 42/305 (13%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI-----KTGGEIYRNEGF 67
           +L AGG  G+   L  HP D +KVR Q   N     + A   +        G +  N+  
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLLKVRCQ--SNQASGTLDAISRVLHEAKSKSGPLPLNQ-I 87

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL------------ADKETGKVSTGNTFIA 115
             FY+G+   ++G+TP  A+ F  Y+  + L+            +  +   ++T    +A
Sbjct: 88  KGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALA 147

Query: 116 GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGV 175
           G  + I             K+ LQ        GA +         T+++E G  +L++G 
Sbjct: 148 GFFSAI-PTTLITAPTERVKVVLQTSESGSFLGAAR---------TLIREGGVRSLFQGT 197

Query: 176 SLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGA---IGPFSNAPL 232
             T AR        F  Y   K FL    + + L      + G ++G    IG F   P+
Sbjct: 198 LATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVF---PI 254

Query: 233 DTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
           DTIKT+LQ    +++M    R      ++    G R  + G+ P +MR  P  A TF   
Sbjct: 255 DTIKTKLQSSSRSQSMVQAAR------EIYTRAGLRGFFPGLGPALMRSFPANAATFLGV 308

Query: 293 EFIRK 297
           EF  +
Sbjct: 309 EFTHQ 313

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGL 74
           +AGG AG+   +   P+DTIK ++Q       S  ++   ++   EIY   G   F+ GL
Sbjct: 238 VAGGVAGMSMWIGVFPIDTIKTKLQ-------SSSRSQSMVQAAREIYTRAGLRGFFPGL 290

Query: 75  GAVVIGITPKMAIRFSSYEFYRTLL 99
           G  ++   P  A  F   EF   L 
Sbjct: 291 GPALMRSFPANAATFLGVEFTHQLF 315

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFR 268
           L + + +L G  S        AP + +K  LQ  +S   +          + LI+E G R
Sbjct: 139 LTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGA-------ARTLIREGGVR 191

Query: 269 ALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           +L++G    + R  PG A+ F +YE  ++ L 
Sbjct: 192 SLFQGTLATLARDGPGSALYFASYEVSKRFLS 223

>Kwal_14.2210
          Length = 315

 Score = 79.7 bits (195), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 128/305 (41%), Gaps = 18/305 (5%)

Query: 8   SNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGF 67
           S+  +   AGG AG +      P + +K+ +Q+  +   +     G  +   ++Y  EG 
Sbjct: 15  SDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSS---THAYNHGLFRAVKQVYLEEGV 71

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVS-TGNTFIAG-VGAGITEAX 125
               +G G   I I P  A++F  YEF +     +    V    +  ++G +  G +   
Sbjct: 72  PGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLA 131

Query: 126 XXXXXXXXXKIRLQAQHLNPVEGA--------PKYKNAVQACYTIVKEEGFSALYRGVSL 177
                    ++ +Q  +L  +  A        P     ++  YT  +E G   LYRGV  
Sbjct: 132 TYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT--QEGGIFGLYRGVWP 189

Query: 178 TAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKT 237
           T+         NF VY +L+E++    +      ++ S IG ISG +      P D ++ 
Sbjct: 190 TSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLS-IGAISGGVAQTITYPFDLLRR 248

Query: 238 RLQKDKSTKNMSGLKRITIIGKQLI--QEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           R Q     ++  G    ++    +   + EGF+  YKG+T  + +V P  AV++  YE +
Sbjct: 249 RFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETV 308

Query: 296 RKELE 300
           R  ++
Sbjct: 309 RDYMQ 313

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 79.0 bits (193), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 118/282 (41%), Gaps = 17/282 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFY 71
           +L+ GG AG +  L  +P DT+KVR+Q    A+      P         Y+ EG    FY
Sbjct: 11  DLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAAL-----FPTTWSCVSHTYKQEGLWRGFY 65

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
           +G+ + V G   + A+ F S+   + +L +  +        F   +    T         
Sbjct: 66  QGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVVFAGAIAGACTS--YVLTPV 123

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
              K +LQ  +L  V G P+Y   +     IVK+ G   L++G S T  R++      FT
Sbjct: 124 ELVKCKLQVSNLTGVSG-PRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFT 182

Query: 192 VYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGL 251
            Y  LK +L           WE    G  +GA    S  P DT+K+ +Q +       GL
Sbjct: 183 AYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEH-----LGL 237

Query: 252 KRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
                  + ++++ G    Y+G+   ++R  P  AV F  YE
Sbjct: 238 GPAV---RTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 12/168 (7%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEG-FSALYRGVSLTAARQATNQGANFTVY 193
           K+RLQ Q        P   + V   Y   K+EG +   Y+G++             F  +
Sbjct: 33  KVRLQTQSAALF---PTTWSCVSHTY---KQEGLWRGFYQGMASPVFGAFLEHAVLFVSF 86

Query: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR 253
           ++ +  L+  ++   L   +    G I+GA   +   P++ +K +LQ    T  +SG + 
Sbjct: 87  NRAQAVLENCYSCGPLE--KVVFAGAIAGACTSYVLTPVELVKCKLQVSNLT-GVSGPRY 143

Query: 254 ITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
             ++   + ++++ G   L++G +   +R + G AV FTAYE ++  L
Sbjct: 144 TAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKGWL 191

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 68/183 (37%), Gaps = 10/183 (5%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           + AG  AG        P++ +K ++Q+      SG +    + T   I +  G    ++G
Sbjct: 106 VFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQG 165

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXX 133
                I  +   A+ F++YE  +  LA +     +T    +A                  
Sbjct: 166 QSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADT 225

Query: 134 XKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVY 193
            K  +Q +HL      P       A  T++K+ G +  YRGV +T  R        F VY
Sbjct: 226 VKSTMQTEHLGL---GP-------AVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVY 275

Query: 194 SKL 196
             L
Sbjct: 276 ESL 278

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 3/85 (3%)

Query: 216 LIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           L G ++G++G     P DT+K RLQ   +    +    ++   K   QE  +R  Y+G+ 
Sbjct: 13  LYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYK---QEGLWRGFYQGMA 69

Query: 276 PRVMRVAPGQAVTFTAYEFIRKELE 300
             V       AV F ++   +  LE
Sbjct: 70  SPVFGAFLEHAVLFVSFNRAQAVLE 94

>Scas_721.27
          Length = 374

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 142/332 (42%), Gaps = 52/332 (15%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQ------IYKN------AVGSGVKAPGFIKT 57
           P V+ +AGG  G+   +   P D +K R+Q      +YK+      A  +   A   ++ 
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQA 111

Query: 58  G----------GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSY----EFYRTLLAD-K 102
           G          G +Y+ EGF + +KGLG  ++G+ P  +I F +Y    E Y     + +
Sbjct: 112 GTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQ 171

Query: 103 ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTI 162
           ET  +   +   AG                  K R+Q   L+      KYKN+     T+
Sbjct: 172 ETPLIHLMSAATAGWATS-----TATNPIWMIKTRVQ---LDKAGTTRKYKNSWDCLKTV 223

Query: 163 VKEEGFSALYRGVSLTAARQATNQG-ANFTVYSKLKEFLQ-------GYHNQ------EM 208
           +K EG   LYRG  L+A+   + +G   + +Y ++K  ++       G+  Q      E 
Sbjct: 224 LKSEGIYGLYRG--LSASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEK 281

Query: 209 LPSW-ETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGF 267
           +  W + S    ++  I      P + ++TRL++            +    + +I+EEG 
Sbjct: 282 IKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGL 341

Query: 268 RALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            ++Y G+TP +MR  P   + F  +E + + L
Sbjct: 342 ASMYSGLTPHLMRTVPNSIIMFGTWELVIRLL 373

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           + G A  +  +  +P + ++ R++      G   K  G +++   I + EG  + Y GL 
Sbjct: 291 SAGVAKFIASIVTYPHEVVRTRLRQMPMENGKP-KYTGLVQSFRVIIKEEGLASMYSGLT 349

Query: 76  AVVIGITPKMAIRFSSYEFYRTLLA 100
             ++   P   I F ++E    LL+
Sbjct: 350 PHLMRTVPNSIIMFGTWELVIRLLS 374

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 80.5 bits (197), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 131/330 (39%), Gaps = 48/330 (14%)

Query: 8   SNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP-GFIKT--GGEIY-- 62
           ++  +  ++G  AG + G+   PLD  K R+Q     +   V  P G + T  GG+ Y  
Sbjct: 101 NDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSG 160

Query: 63  ---------RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTF 113
                    R+E     YKG+  +V+G  P   I FS YE  R  L+     +    + F
Sbjct: 161 IWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYE--RCKLSYP---RYFNNSEF 215

Query: 114 IAGVGAGITEAXXXXXXXX---XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           ++   + +T               K RL  Q    ++G   YKN + A   I K EG  +
Sbjct: 216 LSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKS 275

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH----NQEMLP-----------SWETS 215
            Y G+ + +     +   +F VY KLK+ L  Y     NQE +            S    
Sbjct: 276 FYSGL-IPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQ 334

Query: 216 LIGLISGAIGPFSNA-----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRAL 270
           L  LI  + G    A     P + ++TRLQ     K       I  I +    +EG R  
Sbjct: 335 LGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMK-----PSIKSIIRTTYAKEGIRGF 389

Query: 271 YKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           Y G    + R  P  A+T  ++E+ RK  +
Sbjct: 390 YSGFLTNMFRTVPASAITLVSFEYFRKHFK 419

>Kwal_33.12988
          Length = 303

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 126/292 (43%), Gaps = 20/292 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++ AG   G+ + L   P D  KVR+Q       +       ++   ++ +NEG   FYK
Sbjct: 26  DITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA-------LRVVQDLVKNEGLRGFYK 78

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADK---ETGKVSTGNTFIAGVGAGITEAXXXXX 129
           G    +IG+   ++ +F + E  +     +   ++  +     +  G  +G   A     
Sbjct: 79  GTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATP 138

Query: 130 XXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGAN 189
                +I LQ Q  +  +   +Y+ A+     ++KE     L RG + T  R +   G  
Sbjct: 139 IEHV-RILLQVQTKSRADA--EYQGAMDCIKKLLKE---GKLMRGFTPTILRTSHGFGVY 192

Query: 190 FTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKN 247
           FT Y  +   E  +G   ++ +P+W+  L G  SG++      P D IK+ +Q DK    
Sbjct: 193 FTSYEAMICSEQRKGIARKD-IPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTP 251

Query: 248 MSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           + G   +  + K +  E G +A  KG  P ++R  P    TFTA+E   + L
Sbjct: 252 VYG-TNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRIL 302

>Kwal_27.12081
          Length = 369

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 152/335 (45%), Gaps = 46/335 (13%)

Query: 3   SKQKSS-----NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQ--IYK------------N 43
           SKQ SS      P V+ +AGG  G+   +   P D +K R+Q  +++            N
Sbjct: 40  SKQVSSVSAEVKPWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSN 99

Query: 44  AVGSGVKAPGFIKTGG---EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
            V SG++   F +T G    +Y+ EGF + +KGLG  ++G+ P  +I F +Y   + + +
Sbjct: 100 VVSSGIRH--FRETFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYS 157

Query: 101 DK-ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQAC 159
                G+ +     I+   AG   +          K RLQ   L+      +YKN+    
Sbjct: 158 RAFNNGEEAPWIHLISAATAGWATSTATNPIWLI-KTRLQ---LDKAGHTRQYKNSWDCL 213

Query: 160 YTIVKEEGFSALYRGVSLTAARQATNQGA-NFTVYSKLKEFL------------QGYHN- 205
             I+++EGF  LY+G  L+A+   + +G   + +Y ++K+ +            +G  N 
Sbjct: 214 KHIIQKEGFFGLYKG--LSASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNT 271

Query: 206 QEMLPSW-ETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264
            E +  W + S    ++  +      P + ++TRL++     +      +    + +I+E
Sbjct: 272 SEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKE 331

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           EG  ++Y G+TP ++R  P   + F  +E + K L
Sbjct: 332 EGLASMYGGLTPHLLRTVPNSIIMFGTWELVIKLL 366

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           + G A  +  +  +P + ++ R++         +K  G I++   I + EG  + Y GL 
Sbjct: 284 SAGLAKFLASIVTYPHEVVRTRLR-QAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLT 342

Query: 76  AVVIGITPKMAIRFSSYEFYRTLLAD 101
             ++   P   I F ++E    LL+D
Sbjct: 343 PHLLRTVPNSIIMFGTWELVIKLLSD 368

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 146/334 (43%), Gaps = 50/334 (14%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI------YKNAV--GSGVKAPGFIK 56
           Q +  P V+ +AGG  G+   +   P D +K R+Q       YK+A    +G     F+ 
Sbjct: 45  QPAVKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVS 104

Query: 57  TG-----------GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSY----EFY-RTLLA 100
                        G +YR EGF + +KGLG  ++G+ P  +I F +Y    + Y RTL  
Sbjct: 105 RSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTL-- 162

Query: 101 DKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY 160
               G+ +     +A   AG   +          K RLQ        G   YKN++    
Sbjct: 163 --NNGQEAPWIHLLAAATAGWATS-TVTNPIWLVKTRLQLDK----AGTKTYKNSLDCIK 215

Query: 161 TIVKEEGFSALYRGVSLTAARQATNQGA-NFTVYSKLKEFLQ-------GYHNQEM---- 208
           ++VK EG   LY+G  L+A+   + +G   + +Y ++K  ++       G+ +++     
Sbjct: 216 SVVKNEGVLGLYKG--LSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTS 273

Query: 209 --LPSW-ETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEE 265
             +  W + S    ++  +      P + ++TRL++  +         +    + +I+EE
Sbjct: 274 DKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEE 333

Query: 266 GFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           G  ++Y G+TP ++R  P   + F  +E + K L
Sbjct: 334 GLVSMYSGLTPHLLRTVPNSIIMFGTWELVIKLL 367

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           + G A  +  +  +P + ++ R++      G  +K  G +++   I + EG ++ Y GL 
Sbjct: 285 SAGLAKFVASIVTYPHEVVRTRLRQAPTENGK-LKYTGLVQSFRVIIKEEGLVSMYSGLT 343

Query: 76  AVVIGITPKMAIRFSSYEFYRTLLA 100
             ++   P   I F ++E    LL+
Sbjct: 344 PHLLRTVPNSIIMFGTWELVIKLLS 368

>Kwal_55.21335
          Length = 317

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 121/281 (43%), Gaps = 24/281 (8%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYKG 73
           IAG    ++E    +PLDTIKVR+Q     V      P         Y+ EGF+  FY+G
Sbjct: 54  IAGAAGKVIE----YPLDTIKVRLQTQPAHV-----FPTSWSCIKYTYQKEGFVKGFYQG 104

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXX 133
           + + ++G   + A+ F ++   +  L   E+       T ++G  AG   +         
Sbjct: 105 VASPLVGAALENAVLFVTFNRAQNFLQQYESVS-PLSQTVLSGAFAGACTSYVLTPVELI 163

Query: 134 XKIRLQAQHLNPVEGAP-KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
            K  LQ  +L   EGA  ++         IV+ +G   L++G S T  R+       FT 
Sbjct: 164 -KCTLQVSNL---EGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTT 219

Query: 193 YSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLK 252
           Y  LK +L    N     +WE    G  +G     S  P DTIK+  Q    T+++    
Sbjct: 220 YESLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQ----TQHLG--- 272

Query: 253 RITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
            I    K+++   G   LY+G+   ++R AP  A+ F  YE
Sbjct: 273 -IVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 72/188 (38%), Gaps = 13/188 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
            +++G  AG        P++ IK  +Q+  N  G+  +      T   I +++G    ++
Sbjct: 142 TVLSGAFAGACTSYVLTPVELIKCTLQV-SNLEGATTRHSKIWPTVKHIVQHKGIGGLWQ 200

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETG-KVSTGNTFIAGVGAGITEAXXXXXXX 131
           G  +  I      A+ F++YE  ++ LA +    +  T     +G  AG+          
Sbjct: 201 GQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGASAGVA-FNASIFPA 259

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
              K   Q QHL  V+   +          I+   G + LYRG+ +T  R A      F 
Sbjct: 260 DTIKSTAQTQHLGIVDATKR----------ILARSGPAGLYRGLGITLIRAAPANAIVFY 309

Query: 192 VYSKLKEF 199
            Y  L   
Sbjct: 310 TYETLSNL 317

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 116/294 (39%), Gaps = 32/294 (10%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA- 69
           A +L AG   G+   L  HP D +KVR Q   N     V A   I    E     G  A 
Sbjct: 48  AKSLAAGAVGGVCAVLTGHPFDLLKVRCQ--SNQASGTVDAVRKILV--EARAQSGLSAV 103

Query: 70  -----FYKGLGAVVIGITPKMAIRFSSYEFYRTLLA-DKETGKVSTGNTFIAGVGAGITE 123
                FYKG+   ++G+TP  A+ F  Y+  + L+  +  +GK++T     AG  + I  
Sbjct: 104 NMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAI-P 162

Query: 124 AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                      K+ LQ Q  + +  A K+         I+   G  +L+RG   T AR  
Sbjct: 163 TTLVMAPTERVKVVLQTQSNHSLGSAAKH---------ILATGGVRSLFRGSLATLARDG 213

Query: 184 TNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGA---IGPFSNAPLDTIKTRLQ 240
                 F  Y   K +L        L      L G ++G    +G F   P+DTIKT LQ
Sbjct: 214 PGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVF---PIDTIKTELQ 270

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
              + + M    R     K      G +  + GI P ++R  P  A TF   E 
Sbjct: 271 SSNTRQTMMEATR-----KIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQ---LIQEEGFRALYKGI 274
           G + G     +  P D +K R Q ++++  +  +++I +  +    L      R  YKG+
Sbjct: 54  GAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRGFYKGV 113

Query: 275 TPRVMRVAPGQAVTFTAYEFIRK 297
            P ++ V P  AV+F  Y+  +K
Sbjct: 114 IPPLLGVTPIFAVSFWGYDVGKK 136

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 120/300 (40%), Gaps = 22/300 (7%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           V  +AGG AG +      P + +K+ +Q+  +         G     G++Y+ E     +
Sbjct: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN---KGLFDAIGQVYKEENIKGLF 81

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKET-GKVSTGNT----FIAGVGAGITEAXX 126
           +G G   I + P  A++F  +E  +  +   +T GK    N     F   +  G +    
Sbjct: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141

Query: 127 XXXXXXXXKIRLQAQHLNPVEGA--------PKYKNAVQACYTIVKEEGFSALYRGVSLT 178
                   ++ +Q  +L+ +  +        P     +   Y   +E G   LYRGV  T
Sbjct: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYA--EEGGIMGLYRGVWPT 199

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHN--QEMLPSWETSLIGLISGAIGPFSNAPLDTIK 236
           +         NF VY +LKEF+    N    M  S     +G ISG +      P D ++
Sbjct: 200 SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLR 259

Query: 237 TRLQKDKSTKNMSGLKRITIIGKQLI--QEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
            R Q      N  G    ++    +   + EGF+  YKG+T  + +V P  AV++  YE 
Sbjct: 260 RRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 86/213 (40%), Gaps = 15/213 (7%)

Query: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRM--------QIYKNAVGSGVKAPGFI 55
           K +  N    L +G   G    +  +PLD ++ R+        ++ K+      K PG  
Sbjct: 117 KGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVW 176

Query: 56  KTGGEIYRNEG-FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTF- 113
           K   + Y  EG  +  Y+G+    +GI P +A+ F+ YE  +  +   E G  S  ++  
Sbjct: 177 KLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLY 236

Query: 114 ---IAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
              +  +  G+  A          + R Q   +   E    Y +   A  TI K EGF  
Sbjct: 237 KLSMGAISGGV--AQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGY 203
            Y+G++    +   +   ++ VY    ++++ +
Sbjct: 295 YYKGLTANLFKVVPSTAVSWLVYELTWDYMKRW 327

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 21/153 (13%)

Query: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQ-----EMLPSWETSL 216
           + KEE    L+RG  L   R        F V+   K+ +  +H       E L +W+   
Sbjct: 71  VYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI--FHVDTKGKGEQLNNWQRLF 128

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR------------ITIIGKQLIQE 264
            G + G     +  PLD ++TRL     T N+S L +              ++ K   +E
Sbjct: 129 SGALCGGCSVVATYPLDLVRTRLSVQ--TANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186

Query: 265 EGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
            G   LY+G+ P  + + P  A+ F  YE +++
Sbjct: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 11/107 (10%)

Query: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMS-GLK 252
           ++LK FL+   N   L        G I+GAI     +P + +K  LQ   ST   + GL 
Sbjct: 13  NQLKNFLKQDTNVAFLA-------GGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGL- 64

Query: 253 RITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
               IG Q+ +EE  + L++G     +RV P  AV F  +E  +K +
Sbjct: 65  -FDAIG-QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI 109

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 77.4 bits (189), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 140/327 (42%), Gaps = 47/327 (14%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQ------IYKNA---VGSGVKAPG----FIK 56
           P V+ +AGG  G+   +   P D +K R+Q       YK+    +  G   P      I+
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQ 111

Query: 57  TG----------GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK 106
            G          G +Y+ EGF + +KGLG  ++G+ P  +I F +Y   + + A      
Sbjct: 112 AGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNG 171

Query: 107 VSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE 166
             T    +                    K R+Q           +YKN+     ++++ E
Sbjct: 172 QETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKT-SVRQYKNSWDCLKSVIRNE 230

Query: 167 GFSALYRGVSLTAARQATNQGA-NFTVYSKLKEFLQ-------GYHNQ------EMLPSW 212
           GF+ LY+G  L+A+   + +G   + +Y ++K  ++       GY  +      E +  W
Sbjct: 231 GFTGLYKG--LSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEW 288

Query: 213 -ETSLIGLISGAIGPFSNAPLDTIKTRLQ---KDKSTKNMSGLKRITIIGKQLIQEEGFR 268
            + S    ++  +   +  P + ++TRL+   K+   +  +GL +     K +I+EEG  
Sbjct: 289 CQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSF---KVIIKEEGLF 345

Query: 269 ALYKGITPRVMRVAPGQAVTFTAYEFI 295
           ++Y G+TP +MR  P   + F  +E +
Sbjct: 346 SMYSGLTPHLMRTVPNSIIMFGTWEIV 372

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           + G A  +  +  +P + ++ R++      G   K  G +++   I + EG  + Y GL 
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLRQTPKENGKR-KYTGLVQSFKVIIKEEGLFSMYSGLT 352

Query: 76  AVVIGITPKMAIRFSSYEFYRTLLA 100
             ++   P   I F ++E    LL+
Sbjct: 353 PHLMRTVPNSIIMFGTWEIVIRLLS 377

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 125/310 (40%), Gaps = 30/310 (9%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA-PGFIKTGGEIYR 63
           Q   +  V  ++G  AG + G+   PLD  K R+Q      GSG +   G + T   I R
Sbjct: 79  QLLDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQ--AQGAGSGERYYRGIVGTLSAILR 136

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITE 123
           +EG    YKGL  +V+G  P   + FS YE        K+         F++   + +T 
Sbjct: 137 DEGVAGLYKGLAPIVLGYFPTWMLYFSVYE------KCKQRYPSYLPGGFVSHAASALTA 190

Query: 124 ---AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
              +          K RL  Q  +    +  Y++ + A   + + EG    Y G+ + + 
Sbjct: 191 GAISTALTNPIWVVKTRLMIQS-DVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGL-VPSL 248

Query: 181 RQATNQGANFTVYSKLKEFLQGY----------HNQEMLPSWETSLIGLISGAIGPFSNA 230
               +   +F VY KLK +L             HN+  L      +   +S  +      
Sbjct: 249 FGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLD--RLIVASCLSKVVASVITY 306

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFT 290
           P + ++TR+Q   S    S L    ++G+ +   EG+   Y G    ++R  P   +T  
Sbjct: 307 PHEILRTRMQVRHSGVPPSLLN---LLGR-IRASEGYVGFYSGFATNLVRTVPASVITLV 362

Query: 291 AYEFIRKELE 300
           ++E+ RK L 
Sbjct: 363 SFEYFRKYLR 372

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 136/333 (40%), Gaps = 43/333 (12%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQ--IYKNAVGSGVKA-------PGFI 55
            K+  P V+ +AGG  G+   +   P D +K R+Q  IY+N   S  +A       P  +
Sbjct: 51  HKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIV 110

Query: 56  KTG--------------GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD 101
                            G +YR EGF + +KGLG  ++G+ P  +I F +Y   + + + 
Sbjct: 111 NLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSK 170

Query: 102 KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYT 161
                       +                    K R+Q   L+       YKN+     +
Sbjct: 171 AFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQ---LDKAGKTRTYKNSYDCLKS 227

Query: 162 IVKEEGFSALYRGVSLTAARQATNQG-ANFTVYSKLKEFLQ-------GYHNQEMLPS-- 211
           I++ EG   LYRG  L+A+   + +G   + +Y +LK  ++       G H++  + +  
Sbjct: 228 ILRNEGIYGLYRG--LSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTD 285

Query: 212 ----WETSLIGL-ISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEG 266
               W     G  ++  +      P + ++TRL++            +    + +I+EEG
Sbjct: 286 KIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEG 345

Query: 267 FRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
             ++Y G+TP +MR  P   + F  +E + K L
Sbjct: 346 LASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLL 378

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 17  GGGAGL---MEGLCCHPLDTIKVRMQIYKNAVGSG-VKAPGFIKTGGEIYRNEGFLAFYK 72
            GGAGL   M  +  +P + ++ R++  ++ + +G VK  G +++   I + EG  + Y 
Sbjct: 294 SGGAGLAKFMASIVTYPHEVVRTRLR--QSPLENGKVKYTGLVQSFRVIIKEEGLASMYS 351

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLAD 101
           GL   ++   P   I F ++E    LL+D
Sbjct: 352 GLTPHLMRTVPNSIIMFGTWEVVIKLLSD 380

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 126/313 (40%), Gaps = 35/313 (11%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYK 72
           +++GG  G +     H LDT+K R Q   N      K    I     I+  EG     Y 
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVK----KYRNMISAYRTIWLEEGVRRGLYG 112

Query: 73  GLGAVVIGITPKMAIRFSSYEFY-RTLLADKETGKVSTGNTFIAG-VGAGITEAXXXXXX 130
           G  A ++G  P  AI F +YE+  RT++ D +     T     AG +G  I+        
Sbjct: 113 GYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTIT--HLSAGFLGDFISSFVYVPSE 170

Query: 131 XXXXKIRLQAQHLNPV-EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGAN 189
               +++LQ +  NP  +    Y N   A  T++KEEGF +L+ G   T AR        
Sbjct: 171 VLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQ 230

Query: 190 FTVYSKLKEFL------QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ--- 240
           F  Y K ++         G   +  +P+    L G  +G +      P+D +KTR+Q   
Sbjct: 231 FAFYEKFRQLAFKIEQKDGRDGELSIPN--EILTGACAGGLAGIITTPMDVVKTRVQTQQ 288

Query: 241 -KDKSTKNMSGL-------------KRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286
              +S K+ S                 I++  + + Q EG    + G+ PR +  +   +
Sbjct: 289 PPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSS 348

Query: 287 VTFTAYEFIRKEL 299
           +    Y+   + L
Sbjct: 349 IMLLLYQMTLRGL 361

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 4/100 (4%)

Query: 201 QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260
           +G  ++++ P W   + G I G IG  +   LDT+KTR Q      N+   + +    + 
Sbjct: 43  RGDSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ---GAPNVKKYRNMISAYRT 99

Query: 261 LIQEEGF-RALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +  EEG  R LY G    ++   P  A+ F  YE+ ++ +
Sbjct: 100 IWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTM 139

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 118/292 (40%), Gaps = 32/292 (10%)

Query: 17  GGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGA 76
           GG AG+   +  HPLD  KVR+Q       + +  P   +    I  NEG +  Y GL A
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQ------AAPMPKPTLFRMLESILANEGVVGLYSGLSA 73

Query: 77  VVIGITPKMAIRFSSYEFYRTLLADKETGK-------VSTGNTFIAGVGAGITEAXXXXX 129
            V+       +RF +Y+  +  +  +E           S  +  I G+     +      
Sbjct: 74  AVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADV----- 128

Query: 130 XXXXXKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEE-GFSALYRGVSLTAARQATNQ 186
                 + ++ Q+ + +E A +  YKNA+   Y I + E G   L+ G      R     
Sbjct: 129 ------VNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMT 182

Query: 187 GANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
            +    Y   K +L    + +   ++      L++G +     +P D +KTR+  + S  
Sbjct: 183 ASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIM-NGSGD 241

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           +   LK    I    +++EG   +++G  P   R+ P   + F A E ++K 
Sbjct: 242 HQPALK----ILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKH 289

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 222 GAIGPFSNA---PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
           GA G F+     PLD  K RLQ     K    L R+    + ++  EG   LY G++  V
Sbjct: 21  GAAGIFATMVTHPLDLAKVRLQAAPMPK--PTLFRML---ESILANEGVVGLYSGLSAAV 75

Query: 279 MRVAPGQAVTFTAYEFIRKEL 299
           +R      V F AY+ +++ +
Sbjct: 76  LRQCTYTTVRFGAYDLLKENV 96

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 119/279 (42%), Gaps = 26/279 (9%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+        V   G + +  +I   EG  A   G G  ++G + + A +F
Sbjct: 37  PIDVVKTRIQLEPT-----VYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKF 91

Query: 90  SSYEFYRTLLADK---ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPV 146
             YE ++    D    +T      + ++         A          +IRL +Q     
Sbjct: 92  GGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQ----- 146

Query: 147 EGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHN 205
              P++ N +   ++ I+KEEG  + Y G +    +Q     A F V+ +  EF  G+  
Sbjct: 147 ---PQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGFAG 203

Query: 206 -QEMLPSWETSLIGLISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260
            +E L S  T+L+ L+SG     + A    P DT+ +++ K K     S +  +  + KQ
Sbjct: 204 PKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQ 263

Query: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           L    GF   + G+  R++ V    ++ F  Y  ++  L
Sbjct: 264 L----GFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTL 298

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 220 ISGAIGPFSN----APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           ++GAIG  S      P+D +KTR+Q + +  N    K +    KQ+I  EG  AL  G  
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYN----KGMVGSFKQIIAGEGAGALLTGFG 77

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
           P ++  +   A  F  YE  +K
Sbjct: 78  PTLLGYSIQGAFKFGGYEVFKK 99

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 9/108 (8%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTG--GEIY 62
             +S   +NL++G  AGL   +   P DT+  ++   K       KAPG    G   ++ 
Sbjct: 209 SSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTK-------KAPGQSTVGLLAQLA 261

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG 110
           +  GF   + GL   ++ +    +++F  Y   ++ L    T ++  G
Sbjct: 262 KQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGCPPTIEIGGG 309

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 127/291 (43%), Gaps = 27/291 (9%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI---YRNEGFL 68
           +++I G  AG    +   P DT+KVR+Q   + V        F  T   I   Y+NEG  
Sbjct: 15  LDIINGSIAGACGKVIEFPFDTVKVRLQTQASNV--------FPTTWSCIKFTYQNEGIA 66

Query: 69  -AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXX 127
             F++G+ + ++G   + A  F SY      L +K T     G   I+G  AG + A   
Sbjct: 67  RGFFQGIASPLVGACLENATLFVSYNQCSKFL-EKHTNVFPLGQILISGGVAG-SCASLV 124

Query: 128 XXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQG 187
                  K +LQ  +L       K+   +     I+ E G + L++G S T  R++    
Sbjct: 125 LTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGV 184

Query: 188 ANFTVYSKLKEFLQGYHN-----QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242
           A F  Y  +K+ L+  H+     ++    WE  + G  +G     S  P DT+K+ +Q  
Sbjct: 185 AWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQ-- 242

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
             T+++S    +T   K++  + G +  Y+G+   + R  P  A  F  +E
Sbjct: 243 --TEHIS----LTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 76/176 (43%), Gaps = 25/176 (14%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFS-ALYRGVSLTAARQATNQGANFTVY 193
           K+RLQ Q  N     P   + ++  Y   + EG +   ++G++             F  Y
Sbjct: 38  KVRLQTQASNVF---PTTWSCIKFTY---QNEGIARGFFQGIASPLVGACLENATLFVSY 91

Query: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ---------KDKS 244
           ++  +FL+ + N  + P  +  + G ++G+       P++ +K +LQ         K K 
Sbjct: 92  NQCSKFLEKHTN--VFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKH 149

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           TK +  +K I       I E G   L++G +   +R + G    F  YE ++K L+
Sbjct: 150 TKVLPTIKAI-------ITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLK 198

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 119/289 (41%), Gaps = 20/289 (6%)

Query: 27  CCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYKGLGAVVIGITPKM 85
             H LDT+K R Q       S VK    I     I   EG     Y G    ++G  P  
Sbjct: 72  AMHSLDTVKTRQQ----GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSA 127

Query: 86  AIRFSSYEFYRTLLADKETGKVSTGNTFIAG-VGAGITEAXXXXXXXXXXKIRLQAQHLN 144
           AI F++YE+ +  +   E G   T +   AG +G  I+            +++LQ ++ N
Sbjct: 128 AIFFATYEYTKRKMIG-EWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNN 186

Query: 145 PV-EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY 203
           P       YKN   A  TIV+ EG+  L+ G   T +R     G  F  Y K ++     
Sbjct: 187 PFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAV 246

Query: 204 HNQ---EMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK------DKSTKNMSGLKRI 254
            N+   E L      + G  +G +      PLD +KTR+Q       + S++N+      
Sbjct: 247 ENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLT 306

Query: 255 TIIGKQLI---QEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
             I K ++   + EG   L+ G+ PR +  +   ++    Y+   K L+
Sbjct: 307 NSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTLD 355

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 117/296 (39%), Gaps = 28/296 (9%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI-KTGGEIYRNEGFLA--- 69
           L+AGG  G+   L  HP D IKVR Q   N   S + A   I K    +    G L    
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQ--SNQAKSTMDAVSIILKEARSLSTVNGSLTTSL 82

Query: 70  --------FYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGI 121
                   FYKG+   +IG+TP  A+ F  Y+  + L+  K+          +A  G  I
Sbjct: 83  FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGF-I 141

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
           +            +I++  Q  +  +G+      ++A   IV   G  +L+ G   T AR
Sbjct: 142 SAIPTTLVTAPTERIKVVLQTNSEFKGS-----FIKAAKHIVSTGGVKSLFNGSLATLAR 196

Query: 182 QATNQGANFTVYSKLKEFLQ---GYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTR 238
                   F  Y   K FL       +++ +      L G I+G        P+DTIKTR
Sbjct: 197 DGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTR 256

Query: 239 LQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
           LQ   +  +M     +       IQ  G +  + G+ P ++R  P  A TF   E 
Sbjct: 257 LQVATTPISM-----VQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVEL 307

>Scas_702.10
          Length = 302

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 112/287 (39%), Gaps = 21/287 (7%)

Query: 17  GGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGA 76
           GG AG+   +  HPLD  KVR+Q       + +  P   +    I RNE  +  Y GL A
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQ------AAPLPKPTLGRMLTTILRNENVMGLYSGLSA 69

Query: 77  VVIGITPKMAIRFSSYEFYRTLLADK----ETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
            V+       +RF +Y+  +  L  +    +   +   + F   +G  +           
Sbjct: 70  AVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGN------FAD 123

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE-GFSALYRGVSLTAARQATNQGANFT 191
              IR+Q       E    Y+NA+   Y I   E G   L  G      R      +   
Sbjct: 124 VVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVV 183

Query: 192 VYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGL 251
            Y   K +L    + +   +       L++G +     +P D IKTR+     T++ S +
Sbjct: 184 TYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIMNAHKTESESAI 243

Query: 252 KRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           K +T      I++EG   +++G  P   R+ P   + F A E ++K 
Sbjct: 244 KILT----SAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKKH 286

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 8/81 (9%)

Query: 222 GAIGPFS---NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
           GA G F+     PLD  K RLQ     K   G    TI+     + E    LY G++  V
Sbjct: 17  GAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTIL-----RNENVMGLYSGLSAAV 71

Query: 279 MRVAPGQAVTFTAYEFIRKEL 299
           +R      V F AY+ +++ L
Sbjct: 72  LRQCTYTTVRFGAYDLMKENL 92

>Scas_716.29
          Length = 316

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 123/305 (40%), Gaps = 35/305 (11%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP-GFIKTGGEIYRNEGFL-AF 70
           +L+AG  +GL+      PLDT+K+R+Q+  +  G   +AP G +K    +  NEG L +F
Sbjct: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTG---QAPSGLLKMMKGMILNEGGLRSF 81

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGN----TFIAGVGAGITEAXX 126
           +KG     +        +FSSY FY  L      G+ S  N    + + G  AG+T +  
Sbjct: 82  WKGNVPGTMMYVLYGGAQFSSYSFYNNLF-----GETSDMNGQLQSLVVGALAGMTSSFV 136

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                      +  Q +          +    C  I   EG    +RG + +      + 
Sbjct: 137 SYPTDVLRTRFIANQDV-------ALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSA 189

Query: 187 GANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
              F  Y  +K +   Y  +    ++       ISG        PLDTI+ R+Q   S  
Sbjct: 190 SILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVY 249

Query: 247 NMSGLKRITI--------------IGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292
               ++   +              +G  ++++EG  +LY+G++  + +  P   V+  AY
Sbjct: 250 VQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAY 309

Query: 293 EFIRK 297
           E + +
Sbjct: 310 ETVMR 314

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 15/105 (14%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAV--------------GSG 48
           SK+      +   A   +G+   +  +PLDTI+ R+Q+ +N+V                 
Sbjct: 207 SKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQV-RNSVYVQHNVENKIVTEIYQS 265

Query: 49  VKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93
            K   FI+ G  I R EG L+ Y+G+   +    P   +   +YE
Sbjct: 266 YKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYE 310

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query: 201 QGYHNQEMLPSWET-----SLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254
            G HN + L   E      SL+ G +SG +     APLDT+K RLQ   S    +    +
Sbjct: 6   DGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLL 65

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
            ++   ++ E G R+ +KG  P  M         F++Y F
Sbjct: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSF 105

>Scas_721.129
          Length = 323

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 118/291 (40%), Gaps = 18/291 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKN--AVGSGV-KAPGFIKTGGEIYRNEGFLA 69
           + IAGG A  +     +P++ +K+RMQ+     AVG  V + P  I+  G I+RNEG   
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNP--IQGMGVIFRNEGIRG 81

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYR-----TLLADKETGKVSTGNTFIA-GVGAGITE 123
             KGL A  I        R   YE  R     T   ++E+ K+   +  +A G  +GI  
Sbjct: 82  LQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIG 141

Query: 124 AXXXXXXXXXXKIRLQA-QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQ 182
           A          K R+Q+      +     Y+N      TI + EGF  L+RG+     R 
Sbjct: 142 AVIGSPLFLV-KTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRT 200

Query: 183 ATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKD 242
                    +Y+  K FL      +  P    +    ISG        P D I TR+   
Sbjct: 201 GAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTA-STISGLGVAVVMNPWDVILTRIYNQ 259

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           K       +        + ++ EG  ALYKG   +++R+AP   +  T  E
Sbjct: 260 KGNLYKGPVDCFV----KTVRTEGISALYKGFQAQILRIAPHTIICLTFME 306

>Kwal_23.3529
          Length = 395

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 116/287 (40%), Gaps = 22/287 (7%)

Query: 29  HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYKGLGAVVIGITPKMAI 87
           H LDT+K R Q   NA     K    I    +I+  EG     Y G  A ++G  P  AI
Sbjct: 104 HSLDTVKTRQQGAPNAP----KYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 88  RFSSYEFYRTLLADKETGKVSTGNTFIAGV-GAGITEAXXXXXXXXXXKIRLQAQHLNP- 145
            F +YE  +  L D + G   T +   AG+ G  ++            +++LQ  + NP 
Sbjct: 160 FFGTYELTKRKLID-DWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPH 218

Query: 146 VEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHN 205
                 Y+N   A   IV+ EG+  L+ G   T  R        F  Y K +++   +  
Sbjct: 219 FHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQW--AFTL 276

Query: 206 QEMLPSWETSLIG-----LISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260
           +   PS + SL+        +G +      P+D IKTR+Q    +   S   R+  I   
Sbjct: 277 EGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENS 336

Query: 261 LI-------QEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           LI       + EG    + G+ PR +  +   ++    Y+   K L+
Sbjct: 337 LIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSLD 383

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 122/302 (40%), Gaps = 31/302 (10%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI----- 55
           M    K  +    L+    AG+ME    HP+DTI  R+      + SG +    I     
Sbjct: 1   MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF 60

Query: 56  -----KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTL--LADKETGKVS 108
                K    ++   G+ A YK L  V        A  F +  + +    L  ++TGK  
Sbjct: 61  SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM 120

Query: 109 TGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGF 168
                 A  G+ I             KI+ Q    NP      +K   +    I+++EG 
Sbjct: 121 RS----AAAGSLIGIGEIVLLPLDVLKIKRQT---NP----ESFKG--RGFIKILRDEGL 167

Query: 169 SALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPF- 227
             LYRG   TAAR A    A F   +  KE++ G  +     +W  + I  I GA     
Sbjct: 168 FNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQ-ATWSQNFISSIVGACSSLI 226

Query: 228 SNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
            +APLD IKTR+Q        SGL+    I K  ++ EG  A +KG+TP+++   P    
Sbjct: 227 VSAPLDVIKTRIQNRNFDNPESGLR----IVKNTLKNEGVTAFFKGLTPKLLTTGPKLVF 282

Query: 288 TF 289
           +F
Sbjct: 283 SF 284

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 26  LCCHPLDTIKVRMQIYK-NAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPK 84
           +   PLD IK R+Q    +   SG++    +K      +NEG  AF+KGL   ++   PK
Sbjct: 226 IVSAPLDVIKTRIQNRNFDNPESGLR---IVKN---TLKNEGVTAFFKGLTPKLLTTGPK 279

Query: 85  MAIRFS 90
           +   F+
Sbjct: 280 LVFSFA 285

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 12/83 (14%)

Query: 215 SLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           SLIG     IG     PLD +K + Q +  +    G  +I       +++EG   LY+G 
Sbjct: 127 SLIG-----IGEIVLLPLDVLKIKRQTNPESFKGRGFIKI-------LRDEGLFNLYRGW 174

Query: 275 TPRVMRVAPGQAVTFTAYEFIRK 297
                R APG    F    F ++
Sbjct: 175 GWTAARNAPGSFALFGGNAFAKE 197

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/329 (26%), Positives = 147/329 (44%), Gaps = 52/329 (15%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQ------IYK-------NAVGSGVKAPGFIK 56
           P V+ +AGG  G+   +   P D +K R+Q       YK       N V  G+    F +
Sbjct: 49  PWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMH--FRE 106

Query: 57  TGG---EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRT----LLADKETGKVST 109
           T G    +Y  EGF + +KGLG  ++G+ P  +I F +Y   +     LL D   G+ + 
Sbjct: 107 TVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLLND---GQEAP 163

Query: 110 GNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEG-APKYKNAVQACYTIVKEEGF 168
              F+AG  AG   +          K RLQ       +G + +YKN+      +++ EG 
Sbjct: 164 WIHFLAGATAGWATSTATNPIWLV-KTRLQLD--KAADGRSRRYKNSWDCLKGVMRNEGI 220

Query: 169 SALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLI-------- 220
             LY+G+S  +   +      + +Y ++K  ++    +E     E +    +        
Sbjct: 221 LGLYKGLS-ASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQR 279

Query: 221 ---SGAIGPFSNA---PLDTIKTRLQ---KDKSTKNMSGL-KRITIIGKQLIQEEGFRAL 270
              +GA   F++    P + ++TRL+   K+      +GL +  ++I    I+EEGF ++
Sbjct: 280 SGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLI----IKEEGFASM 335

Query: 271 YKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           Y G+TP +MR  P   + F  +E + K L
Sbjct: 336 YSGLTPHLMRTVPNSIIMFGTWELVIKLL 364

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75
           + G A L   +  +P + ++ R++      G  +K  G  ++   I + EGF + Y GL 
Sbjct: 282 SAGAAKLFASILTYPHEVVRTRLRQAPKENGK-LKYTGLFQSFSLIIKEEGFASMYSGLT 340

Query: 76  AVVIGITPKMAIRFSSYEFYRTLLA 100
             ++   P   I F ++E    LLA
Sbjct: 341 PHLMRTVPNSIIMFGTWELVIKLLA 365

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 124/288 (43%), Gaps = 18/288 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFY 71
           ++  G  AG +  +  +P DT+KVR+Q     +      P         Y +EG    FY
Sbjct: 10  DIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHL-----YPTTWSCIRSTYTDEGIWKGFY 64

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
           +G+ + + G   + A+ F S+      L D+ T       T  +G  AG   A       
Sbjct: 65  QGIASPLFGAALENAVLFVSFNQCTNFL-DEFTQLKPLTKTIYSGAFAGAC-ASFILTPV 122

Query: 132 XXXKIRLQAQHL-NPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
              K +LQ  ++ N +    ++ +      +++KE+G   L++G   T  R+       F
Sbjct: 123 ELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWF 182

Query: 191 TVYSKLKEFLQGYHNQEML-PSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMS 249
           T Y  +K      H  E    +WE  + G  +G +   S  P DT+K+  Q    T+++S
Sbjct: 183 TTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQ----TEHVS 238

Query: 250 GLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
            +  +    K++++  G    Y+G+   ++R AP  A  F  YE ++K
Sbjct: 239 IVNAL----KKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKK 282

>Scas_562.12
          Length = 300

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 128/302 (42%), Gaps = 31/302 (10%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI----- 55
           MAS  +  +    L+    AG++E    HP+DTI  R+      +G+  +    I     
Sbjct: 1   MASNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHF 60

Query: 56  -----KTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA--DKETGKVS 108
                K    ++   G+ A YK L  V        A  F +  + +   +   ++TGK  
Sbjct: 61  SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAM 120

Query: 109 TGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGF 168
              T  AG   GI E           KI+ Q    NP   A K +  V+    I+K+EG 
Sbjct: 121 RSAT--AGSLIGIGE--IVLLPLDVLKIKRQT---NPE--AFKGRGFVK----ILKDEGI 167

Query: 169 SALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGA-IGPF 227
             LYRG   TAAR A    A F   +  KE++ G  +     SW  + I  I GA     
Sbjct: 168 FNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLEDYSQ-ASWSQNFISSIVGASCSLI 226

Query: 228 SNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
            +APLD IKTR+Q        +GL   TI+ K   + EG  A +KG+TP+++   P    
Sbjct: 227 VSAPLDVIKTRIQNRSFDNPETGL---TIV-KNTFKNEGITAFFKGLTPKLLTTGPKLVF 282

Query: 288 TF 289
           +F
Sbjct: 283 SF 284

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 16/92 (17%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI- 61
           S+   S   ++ I G    L   +   PLD IK R+Q            P   +TG  I 
Sbjct: 206 SQASWSQNFISSIVGASCSL---IVSAPLDVIKTRIQ------NRSFDNP---ETGLTIV 253

Query: 62  ---YRNEGFLAFYKGLGAVVIGITPKMAIRFS 90
              ++NEG  AF+KGL   ++   PK+   F+
Sbjct: 254 KNTFKNEGITAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 12/83 (14%)

Query: 215 SLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           SLIG     IG     PLD +K + Q +       G  +I       +++EG   LY+G 
Sbjct: 127 SLIG-----IGEIVLLPLDVLKIKRQTNPEAFKGRGFVKI-------LKDEGIFNLYRGW 174

Query: 275 TPRVMRVAPGQAVTFTAYEFIRK 297
                R APG    F    F ++
Sbjct: 175 GWTAARNAPGSFALFGGNAFAKE 197

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/339 (22%), Positives = 128/339 (37%), Gaps = 66/339 (19%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRM-------------QIYKNA----------VGSGV 49
            +++     L+  L   PLD ++VR+             Q+ K A             G 
Sbjct: 14  RMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGC 73

Query: 50  KAP-----GFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET 104
           + P     G ++   +I + EG    ++GLG  ++   P   + FS YE  R        
Sbjct: 74  REPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRD--NSPLA 131

Query: 105 GKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTI-- 162
            ++   N  + G  A I  A          + RLQ+         P+ ++  +  Y I  
Sbjct: 132 SRLPVANPLVCGAFARIL-AATTIAPLELLRTRLQS--------VPRARDTERTIYLIGD 182

Query: 163 --------VKEEGFSALYRGVSLTAARQATNQGANFTVYSKLK-EFLQGYHNQEMLPSWE 213
                   V   G+ AL++G+ +T  R        +  Y   K +F   +       +W+
Sbjct: 183 LLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWD 242

Query: 214 TSL----IGLISGAIGPFSNAPLDTIKTRLQ-----------KDKSTKNMSGLKRITIIG 258
             +     G + GA+      P D  KTR+Q             K+TK        + + 
Sbjct: 243 HFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLN 302

Query: 259 KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
             + + EG RALY G+ PRVM++AP  A+  + YE  +K
Sbjct: 303 A-IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKK 340

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 71/162 (43%), Gaps = 17/162 (10%)

Query: 147 EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQ 206
           E A + +  ++    I + EG   L+RG+ +T           F+ Y  L++      N 
Sbjct: 75  EPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRD------NS 128

Query: 207 EM---LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQL-- 261
            +   LP     + G  +  +   + APL+ ++TRLQ     ++    + I +IG  L  
Sbjct: 129 PLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTE--RTIYLIGDLLRE 186

Query: 262 ----IQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
               +   G+RAL+KG+   + R  P  A+ +  YEF + + 
Sbjct: 187 MRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQF 228

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 83/220 (37%), Gaps = 27/220 (12%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           +AS+   +NP   L+ G  A ++      PL+ ++ R+Q    +V         I   G+
Sbjct: 130 LASRLPVANP---LVCGAFARILAATTIAPLELLRTRLQ----SVPRARDTERTIYLIGD 182

Query: 61  IYRNE-------GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKE--TGKVSTGN 111
           + R         G+ A +KGL   +    P  AI + +YEF +T    +   T   S  +
Sbjct: 183 LLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWD 242

Query: 112 TFIAGVGAGI---TEAXXXXXXXXXXKIRLQAQHLNP----VEGAPKYKNAVQACYT--- 161
            FI     G      A          K R+Q    +P    V G     +  +  ++   
Sbjct: 243 HFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLN 302

Query: 162 -IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
            I K EG  ALY G+     + A +     + Y   K+F 
Sbjct: 303 AIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 104/236 (44%), Gaps = 16/236 (6%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYK 72
            +AGG  G++     H LDT+K R Q   N      K    ++    ++  EGF    Y 
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVH----KYKHMLQAYRTMFIEEGFRRGLYG 112

Query: 73  GLGAVVIGITPKMAIRFSSYEFY-RTLLADKETGKVSTGNTFIAG-VGAGITEAXXXXXX 130
           G  A ++G  P  AI FS+YEF  RT++ D       T +   AG +G   +        
Sbjct: 113 GYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLND--TFSHLTAGFLGDFFSSFVYVPSE 170

Query: 131 XXXXKIRLQAQHLNP-VEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGAN 189
               +++LQ  + NP       YK+   A  TI + EG +AL+ G   T AR        
Sbjct: 171 VLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQ 230

Query: 190 FTVYSKLKEF---LQG--YHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240
           F  Y K +++   L+G   +  ++  S E  + G  +G +      PLD +KTR+Q
Sbjct: 231 FAFYEKFRQWAFLLEGKDIYKHDLSISNEI-VTGACAGGLAGILTTPLDVVKTRVQ 285

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 203 YHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI 262
           + + E  P W   L G + G IG  +   LDT+KTR Q      N+   K +    + + 
Sbjct: 45  FDDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ---GAPNVHKYKHMLQAYRTMF 101

Query: 263 QEEGF-RALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            EEGF R LY G    ++   P  A+ F+ YEF ++ +
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTM 139

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 117/295 (39%), Gaps = 26/295 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI-----KTGGEIYRNEGF 67
           +L AGG  G+   L  HP D +KVR Q   N   S + A   I     +  G    N   
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLVKVRCQ--SNQARSAMDAVSHILQAARQAAGPTSLN-AV 87

Query: 68  LAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD------KETGKVSTGNTFIAGVGAGI 121
             FYKG+   ++G+TP  A+ F  Y+  + L+             V    T      AG 
Sbjct: 88  RGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
             A          + R++   L   +G   + +A +    IV+ +GF +L++G   T +R
Sbjct: 148 ISAIPTTLVTAPTE-RVKVV-LQTTQGKASFLDAAKQ---IVRTQGFQSLFKGSLATLSR 202

Query: 182 QATNQGANFTVYSKLKEFLQGY--HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239
                   F  Y   KE+L     H    L      + G ++G        P+DT+KT+L
Sbjct: 203 DGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQL 262

Query: 240 QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
           Q     ++M  + R+    +      G +  + G+ P ++R  P  A TF   E 
Sbjct: 263 QSSSKRQSMLEVTRMIYNTR-----GGIKGFFPGVGPAILRSFPANAATFLGVEL 312

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
           G IS        AP + +K  LQ  +      G        KQ+++ +GF++L+KG    
Sbjct: 146 GFISAIPTTLVTAPTERVKVVLQTTQ------GKASFLDAAKQIVRTQGFQSLFKGSLAT 199

Query: 278 VMRVAPGQAVTFTAYEFIRKEL 299
           + R  PG A+ F +YE  ++ L
Sbjct: 200 LSRDGPGSALYFASYEICKEYL 221

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 3/83 (3%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQL---IQEEGFRALYKGI 274
           G + G     +  P D +K R Q +++   M  +  I    +Q          R  YKG+
Sbjct: 35  GGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLNAVRGFYKGV 94

Query: 275 TPRVMRVAPGQAVTFTAYEFIRK 297
            P ++ V P  AV+F  Y+  +K
Sbjct: 95  VPPLLGVTPIFAVSFWGYDVGKK 117

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 70.5 bits (171), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 117/292 (40%), Gaps = 13/292 (4%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG--VKAPGFIKTG 58
           M++ +K S  A  ++    AG++E    HP+DTI  R+      +GS   + +  F +  
Sbjct: 1   MSNDKKQSGLA-RVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHA 59

Query: 59  GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVG 118
            E      F   + GLG        +   ++    F    L      K    NTF    G
Sbjct: 60  AEPLSKRVF-TLFPGLGYAATYKILQRVYKYGGQPFANEFL--NRNFKADFDNTFGEKTG 116

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
             +  A           + L    L             +    I+K+EG   LYRG   T
Sbjct: 117 KALRSATAGSMIGIGEIVLLPLDVLKIKRQTNPEAFKGRGFVKILKDEGL-GLYRGWGWT 175

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFS-NAPLDTIKT 237
           AAR A    A F   +  KE++ G  +     +W  + +  I GA      +APLD IKT
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSQ-ATWSQNFVSSIVGASASLIISAPLDVIKT 234

Query: 238 RLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
           R+Q        SG    TI+ K  ++ EGF A +KG+TP+++   P    +F
Sbjct: 235 RIQNKNFENPESGF---TIV-KNTLKNEGFSAFFKGLTPKLLTTGPKLVFSF 282

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 12/90 (13%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP--GFIKTGGE 60
           S+   S   V+ I G  A L   +   PLD IK R+Q          + P  GF      
Sbjct: 204 SQATWSQNFVSSIVGASASL---IISAPLDVIKTRIQ------NKNFENPESGFTIVKNT 254

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFS 90
           + +NEGF AF+KGL   ++   PK+   F+
Sbjct: 255 L-KNEGFSAFFKGLTPKLLTTGPKLVFSFA 283

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLIS 221
           I+K+EGF  LYRG   TAAR A    A F   +  KE++ G  +     +W  + +  I 
Sbjct: 161 IIKDEGF-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQ-ATWSQNFVSSIV 218

Query: 222 GAIGPF-SNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280
           GA      +APLD IKTR+Q        SG K I    K  ++ EGF A +KG+TP+++ 
Sbjct: 219 GASASLIVSAPLDVIKTRIQNRNFDNPESGFKII----KNTLKNEGFTAFFKGLTPKLLT 274

Query: 281 VAPGQAVTF 289
             P    +F
Sbjct: 275 TGPKLVFSF 283

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYK-NAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           V+ I G  A L   +   PLD IK R+Q    +   SG K    IK      +NEGF AF
Sbjct: 214 VSSIVGASASL---IVSAPLDVIKTRIQNRNFDNPESGFK---IIK---NTLKNEGFTAF 264

Query: 71  YKGLGAVVIGITPKMAIRFS 90
           +KGL   ++   PK+   F+
Sbjct: 265 FKGLTPKLLTTGPKLVFSFA 284

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 130/300 (43%), Gaps = 64/300 (21%)

Query: 29  HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAI- 87
           +PL TI  ++Q   N   + VK+   ++T  EIYR +G L FY GL + + G    MA+ 
Sbjct: 32  YPLVTITTKLQTQGNDENNQVKSK--LETIKEIYRKDGLLGFYAGLESAIYG----MALT 85

Query: 88  RFSSYEFY----RTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHL 143
            F  Y FY    R +L  ++  K++T  + + G  AG   A                   
Sbjct: 86  NFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIAS---------------- 129

Query: 144 NPVEGA-------PKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKL 196
           NP+  A          K A+     IVK++    L+ G+   A     N    +TV+ +L
Sbjct: 130 NPIWVANTRMTVTKSEKTALATIIEIVKKDSAKTLFNGLK-PALVLVMNPIVQYTVFEQL 188

Query: 197 KEFLQGYHNQEML-PSWETSLIGLISGAIGPF----SNAPLDTIKTRLQ--------KDK 243
           K  +  ++ Q +L PSW       + GA+G      S  P  T+KTR+          D 
Sbjct: 189 KNLVLAWNKQGILSPSW-----AFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDD 243

Query: 244 STKNMSGLK-----RITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           S K   G K      +++I  ++++++G   LY+G+  ++      Q++   A+ F  KE
Sbjct: 244 SGKKAKGHKASSKSMLSLI-TEIVKKDGVSGLYRGVGIKL-----AQSILTAAFLFFFKE 297

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 107/255 (41%), Gaps = 25/255 (9%)

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEA 124
           EG    ++GL   ++   P   + FS YE +R     +++    + N    G  A +  A
Sbjct: 111 EGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDS--YPSLNPLFCGATARMV-A 167

Query: 125 XXXXXXXXXXKIRLQA--QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQ 182
                     K RLQ+  +          +K+ ++     ++  G+  L++G+ +T  R 
Sbjct: 168 ATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRD 227

Query: 183 ATNQGANFTVYSKLK-----EFLQGYHNQEMLPSWE---TSLIG-LISGAIGPFSNAPLD 233
                  +  Y   K     +F +      + P+W+    S IG  +SG+       P D
Sbjct: 228 VPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFD 287

Query: 234 TIKTRLQKDKSTKN------MSGLKRITIIGK-----QLIQEEGFRALYKGITPRVMRVA 282
             KTR+Q     +N      +S  KR++  G       + Q EG+ ALY G+ PRVM++A
Sbjct: 288 VGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIA 347

Query: 283 PGQAVTFTAYEFIRK 297
           P  A+  + YE  ++
Sbjct: 348 PSCAIMISTYELSKR 362

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 76/165 (46%), Gaps = 11/165 (6%)

Query: 141 QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
           Q +     A ++ +  +A   I + EG + L+RG+S+T         AN   +S  + F 
Sbjct: 86  QDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIP---ANVVYFSGYEMFR 142

Query: 201 QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ------KDKSTKNMSGLKRI 254
                ++  PS      G  +  +   + APL+ IKTRLQ      KD +T+ M   K +
Sbjct: 143 DHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMM--FKDL 200

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
               +  I+  G++ L+KG+   + R  P  A+ + +YEF +K  
Sbjct: 201 LKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNF 245

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI-------YKNAVGSG---VKAPGFIKTGGEIY 62
           + I G  +G    L  HP D  K RMQI        +N + S    V A G  K    I 
Sbjct: 268 SFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIK 327

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
           + EG+ A Y GL   V+ I P  AI  S+YE  + L A
Sbjct: 328 QTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 79/197 (40%), Gaps = 26/197 (13%)

Query: 3   SKQKSSNPAVN-LIAGGGAGLMEGLCCHPLDTIKVRMQIY----KNAVGSGVKAPGFIKT 57
           S  + S P++N L  G  A ++      PL+ IK R+Q      K+     +      +T
Sbjct: 145 SPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKET 204

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYR----------TLLADKETGKV 107
             EI R+ G+   +KGL   +    P  AI + SYEFY+           L  +      
Sbjct: 205 RNEI-RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWD 263

Query: 108 STGNTFIAGVGAGITEAXXXXXXXXXXKIRLQA------QHLNPVEGAPKYKNA---VQA 158
              N+FI G  +G + A          K R+Q       +  N +    K  +A    + 
Sbjct: 264 FFINSFIGGSVSG-SSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKF 322

Query: 159 CYTIVKEEGFSALYRGV 175
            Y I + EG+ ALY G+
Sbjct: 323 LYNIKQTEGYGALYTGL 339

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 130/305 (42%), Gaps = 24/305 (7%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           +  +AGG  G +      P++ +K+ +Q+  +         G +    ++Y+ EG    +
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYN---GGLVHAVKQVYKEEGVKGLF 74

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRT-LLADKETGK---VSTGNTFIAGVGAGITEAXXX 127
           +G G   + I P  A++++ YEF +T +    ++G     S        +G G +     
Sbjct: 75  RGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTY 134

Query: 128 XXXXXXXKIRLQAQHLNPVEGAPKYK-----NAVQACYTIVKEEG-FSALYRGVSLTAAR 181
                  ++ +Q  +L  +  +  +        V+    I +EEG     YRGV  T+  
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 182 QATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK 241
                  NF +Y +LK  +   ++   + + + + IG +SG I      P D ++ R Q 
Sbjct: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAKLA-IGAVSGGIAQTVVYPFDLLRRRFQV 253

Query: 242 DKSTKNMSGLKRITI------IGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
               ++  G +  ++      IG+Q    EG R  YKG+T  +++V P  AV +  YE I
Sbjct: 254 LTMGQSELGFRYASVADALWTIGRQ----EGLRGYYKGLTANLVKVVPAMAVQWFVYELI 309

Query: 296 RKELE 300
            + + 
Sbjct: 310 SENMH 314

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 82/187 (43%), Gaps = 12/187 (6%)

Query: 26  LCCHPLDTIKVRMQI--------YKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYKGLGA 76
           L  +PLD ++ R+ I        +++      + PG ++    I+R EG L  +Y+G+  
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 77  VVIGITPKMAIRFSSYEFYRTLLA-DKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXK 135
             +G+ P +A+ F+ YE  + L+  D + G V+     I  V  GI  A          +
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGI--AQTVVYPFDLLR 248

Query: 136 IRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSK 195
            R Q   +   E   +Y +   A +TI ++EG    Y+G++    +        + VY  
Sbjct: 249 RRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

Query: 196 LKEFLQG 202
           + E + G
Sbjct: 309 ISENMHG 315

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 112/287 (39%), Gaps = 16/287 (5%)

Query: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA-PGFIKTGGEIYRNEGFLAFYKGL 74
           AGG A  +     +P++ +K+RMQ+    + +  +      +  G ++RNEG     KGL
Sbjct: 24  AGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGL 83

Query: 75  GAVVIGITPKMAIRFSSYEFYR-----TLLADKETGKV-STGNTFIAGVGAGITEAXXXX 128
            A  I        R   YE  R     T   D+E+ KV S G    AG  +GI  A    
Sbjct: 84  VAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGS 143

Query: 129 XXXXXXKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                 K RLQ+ + N ++   +  Y        TI   EG   L+RG+     R     
Sbjct: 144 PLFLV-KTRLQS-YSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGS 201

Query: 187 GANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK 246
                +Y+  K FL      E  PS   +    ISG        P D I TR+   K   
Sbjct: 202 SVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-STISGLGVAVVMNPWDVILTRIYNQKGDL 260

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
               +  +     + ++ EG  ALYKG   +V R+ P   +  T  E
Sbjct: 261 YKGPIDCLV----KTVKIEGITALYKGFEAQVFRIGPHTILCLTFLE 303

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 69/176 (39%), Gaps = 17/176 (9%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA--VGSGVKAPGFIKTGGEIY 62
            K  +  +N+ AG  +G++  +   PL  +K R+Q Y NA  +G      G       IY
Sbjct: 119 HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIY 178

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK----VSTGNTFIAGVG 118
             EG    ++G+ A ++      +++   Y   +  L   +  +    +    + I+G+G
Sbjct: 179 MTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLG 238

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
             +             +I  Q   L        YK  +      VK EG +ALY+G
Sbjct: 239 VAVV---MNPWDVILTRIYNQKGDL--------YKGPIDCLVKTVKIEGITALYKG 283

>Kwal_55.21338
          Length = 323

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 127/279 (45%), Gaps = 34/279 (12%)

Query: 29  HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIR 88
           +PL  +  ++Q  ++A G  +     IK   +IYR +G + F+ GL + + G T    + 
Sbjct: 41  YPLIVVTTKLQT-QDAKGEKLSLADTIK---DIYRKDGAMGFFAGLESALFGTTLSNFVY 96

Query: 89  FSSYE-FYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVE 147
           +  YE   R +L  + T +++T  + + G  AG   A            R+  Q  +   
Sbjct: 97  YYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNA-TAANPLWVANTRMTVQKSD--- 152

Query: 148 GAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEF-LQGYHNQ 206
                +  +   + IVK+EG S L++G++  A     N    +TVY +LK + L     +
Sbjct: 153 -----RGTLSTIFDIVKDEGISGLFKGLN-PALILVINPIIQYTVYEQLKNWILSSRQTR 206

Query: 207 EMLPSWETSLIGLISGAIGPF----SNAPLDTIKTRLQ---KDKSTKNMSGLKRITIIGK 259
            + PSW       I GA+G      S  P  T+K R+    + KS+        ++++  
Sbjct: 207 TLSPSW-----AFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMA- 260

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           ++I+++G   LY+GI  +++     Q++   A+ F  KE
Sbjct: 261 EIIKKDGILGLYRGIGIKLV-----QSILTAAFLFFFKE 294

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 125/298 (41%), Gaps = 25/298 (8%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGFIKTGG 59
           +KQ+ +N A+N + GG +  +      P++ +K+ +Q     +  G    K  G +    
Sbjct: 5   AKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFK 64

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET---GKVSTGNTFIAG 116
              + EG ++F++G  A VI   P  A+ F+  +  + +   K+    GK   GN  +A 
Sbjct: 65  RTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGN--LAS 122

Query: 117 VGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSALYRGV 175
            GA    +          + RL A   +  +G  +  N +   Y   +K +G + LYRG 
Sbjct: 123 GGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

Query: 176 SLTAARQATNQGANFTVYSKLKEF-LQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDT 234
             +       +G  F ++  LK   L G  +   L S+   L+G +        + PLDT
Sbjct: 183 MPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASF---LLGWVVTTGASTCSYPLDT 239

Query: 235 IKTRL-----QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
           ++ R+     Q  K    +  LK+I       +  EG  +L+KG    ++R   G  V
Sbjct: 240 VRRRMMMTSGQAVKYNGAIDCLKKI-------VASEGVGSLFKGCGANILRSVAGAGV 290

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 78/191 (40%), Gaps = 6/191 (3%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           N  + GV A I +            I+ Q + +       KY   V       K+EG  +
Sbjct: 15  NFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLIS 74

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    K+K  + G+  +E    W    +  G  +GA+    
Sbjct: 75  FWRGNTANVIRYFPTQALNFAFKDKIK-LMFGFKKEEGYGKWFAGNLASGGAAGALSLLF 133

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKR---ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
              LD  +TRL  D  +    G ++   +T + K+ ++ +G   LY+G  P V+ +   +
Sbjct: 134 VYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYR 193

Query: 286 AVTFTAYEFIR 296
            + F  ++ ++
Sbjct: 194 GLYFGMFDSLK 204

>Scas_714.18
          Length = 305

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 129/306 (42%), Gaps = 36/306 (11%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYK 72
           ++AG  AG +     +P DT+KVR+Q  +         P         Y NEG L  FY+
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQTQE-----AYMFPSTWSCIKYTYENEGILEGFYQ 70

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           G+ + +IG   + AI F +Y    + L      + S     +   G   + A        
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFL--NAFTEFSAFLIILISAGFAGSCASFVLTPVE 128

Query: 133 XXKIRLQAQHLN-------------------PVEGAPKYKNAVQACYTIVKEEGFSALYR 173
             K +LQ  +L+                    V G  ++   +    +I+KE+G   L++
Sbjct: 129 LIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQ 188

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLD 233
           G S T  R++      F  Y  +K+ L+     E+  +W+  + G  +G     S  P D
Sbjct: 189 GQSSTFIRESIGSVVWFATYELMKQTLRD-PKSEVNTTWQLLISGATAGLAFNGSVFPAD 247

Query: 234 TIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           T+K+ +Q    T++++ ++ +    + +++ +G    Y+G+   ++R  P  A  F  YE
Sbjct: 248 TVKSIMQ----TEHLALMETV----RSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYE 299

Query: 294 FIRKEL 299
            + K L
Sbjct: 300 KLSKIL 305

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 124/288 (43%), Gaps = 46/288 (15%)

Query: 27  CCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMA 86
              PL T+  RMQ+ +     G ++   ++   EIYR EG + FY GL + + G+    A
Sbjct: 33  LTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMA---A 89

Query: 87  IRFSSYEFY----RTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQH 142
              + Y FY    R  +  + + +++T    ++   AG   A                  
Sbjct: 90  NSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIAS--------------- 134

Query: 143 LNPV-------EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSK 195
            NP+         A   ++ +     IV+++G +AL+ G+   A    +N    +TV+ +
Sbjct: 135 -NPIWVVNTRMTVAKSEQSTLAVLLDIVRKDGVTALFNGLR-PALMLVSNPIIQYTVFEQ 192

Query: 196 LKEFLQGYHNQE-MLPSWETSLIGLISGAIGPF----SNAPLDTIKTRLQKDKSTKNMSG 250
           LK  +  +   + +LPSW       + GA+G      S  P  T+KTR+   K  ++   
Sbjct: 193 LKNVVLKWSGSDVLLPSW-----AFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADT 247

Query: 251 LKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
            + +  +   ++++EG + LY GI  ++      Q++   A+ F  KE
Sbjct: 248 QQSMWSLMVDIVKKEGIQGLYHGIGVKL-----TQSILTAAFLFYFKE 290

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 118/292 (40%), Gaps = 22/292 (7%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++IAG  +G+   +   P+DT+K+R Q+    V    K  G   T   I + EG  A +K
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQL--QPVQED-KYKGIASTVRTIMKEEGLRALWK 77

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           G            A++F SY ++  + + K       G T   G  AG+T +        
Sbjct: 78  GNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSYPLDL 137

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             + RL A   +         +  + C  +   EG    + G+S        +    F  
Sbjct: 138 L-RTRLIANRTS------HRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLT 190

Query: 193 YSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMS--- 249
           Y  +    +  H +E      ++  G+I+G +      P+DT++ R+Q   S + +    
Sbjct: 191 YETVNIVCEN-HEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTK 249

Query: 250 --------GLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
                     K  T I  +++++EG  ALY+G+T  + +  P  A++   YE
Sbjct: 250 FPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 80/193 (41%), Gaps = 18/193 (9%)

Query: 107 VSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE 166
           VS  N+ IAG  +G+  A          KIR Q   L PV+   KYK       TI+KEE
Sbjct: 16  VSWYNSVIAGSVSGVF-ARMATAPMDTVKIRYQ---LQPVQ-EDKYKGIASTVRTIMKEE 70

Query: 167 GFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSW----ETSLIGLISG 222
           G  AL++G     A         F  YS               P +    +T  +G ++G
Sbjct: 71  GLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSA-----KFPRFSQQGQTLTVGALAG 125

Query: 223 AIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVA 282
                 + PLD ++TRL  ++++   S  +      +Q+   EG R  + GI+  +  V 
Sbjct: 126 MTSSVVSYPLDLLRTRLIANRTSHRTSVAEEC----RQMWLNEGVRGFFTGISTAMTTVT 181

Query: 283 PGQAVTFTAYEFI 295
              A+ F  YE +
Sbjct: 182 LSTAIMFLTYETV 194

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 84/206 (40%), Gaps = 21/206 (10%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
            L  G  AG+   +  +PLD ++ R+   + +  + V      +   +++ NEG   F+ 
Sbjct: 117 TLTVGALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVA-----EECRQMWLNEGVRGFFT 171

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXX 132
           G+   +  +T   AI F +YE    +  + E    S   +  +G+ AG            
Sbjct: 172 GISTAMTTVTLSTAIMFLTYETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDT 231

Query: 133 XXKIRLQAQHLNP-----------VEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
              +R + Q +N            V    +YK++    Y I+++EG SALYRG+++   +
Sbjct: 232 ---LRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCK 288

Query: 182 QATNQGANFTVYSKLKEFLQGYHNQE 207
                  +  VY +  +     H Q 
Sbjct: 289 SVPTTAISLFVYERTMDLFD--HGQR 312

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 110/289 (38%), Gaps = 14/289 (4%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA-PGFIKTGGEIYRNEGFLAFY 71
           + +AGG A  +     +P++ IK+RMQ+      S  K     I+    I++NEG     
Sbjct: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLL-----ADKETGKV-STGNTFIAGVGAGITEAX 125
           KGL A  I        R   YE  R+ L      D+E  KV S G    +G  +GI  A 
Sbjct: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAV 144

Query: 126 XXXXXXXXXKIRLQA-QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                    K RLQ+      +     Y        TI K EG   L+RG+     R   
Sbjct: 145 IGSPLFLV-KTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203

Query: 185 NQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
                  +Y+  K  L      +  P+   +    ISG        P D I TR+   K 
Sbjct: 204 GSSVQLPIYNTAKNILVKNDLMKDGPALHLTA-STISGLGVAVVMNPWDVILTRIYNQKG 262

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
                 +  +     + ++ EG  ALYKG   +V R+AP   +  T  E
Sbjct: 263 DLYKGPIDCLV----KTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 78/200 (39%), Gaps = 17/200 (8%)

Query: 106 KVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE 165
           K+S   +F+AG G     A          KIR+Q Q       A  YKN +Q    I K 
Sbjct: 19  KISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77

Query: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI-------- 217
           EG   L +G++     Q    G+    Y  ++  L    NQ   P  E   +        
Sbjct: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL----NQLFFPDQEPHKVQSVGVNVF 133

Query: 218 -GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKG 273
            G  SG IG    +PL  +KTRLQ       +      T +   L+   + EG + L++G
Sbjct: 134 SGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG 193

Query: 274 ITPRVMRVAPGQAVTFTAYE 293
           I   ++R   G +V    Y 
Sbjct: 194 IDAAILRTGAGSSVQLPIYN 213

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 72/185 (38%), Gaps = 17/185 (9%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKN--AVGSGVKAPGFIKTGGEIY 62
            K  +  VN+ +G  +G++  +   PL  +K R+Q Y     +G      G       I+
Sbjct: 123 HKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK----VSTGNTFIAGVG 118
           + EG    ++G+ A ++      +++   Y   + +L   +  K    +    + I+G+G
Sbjct: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLG 242

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
             +             +I  Q   L        YK  +      V+ EG +ALY+G +  
Sbjct: 243 VAVV---MNPWDVILTRIYNQKGDL--------YKGPIDCLVKTVRIEGVTALYKGFAAQ 291

Query: 179 AARQA 183
             R A
Sbjct: 292 VFRIA 296

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 125/289 (43%), Gaps = 26/289 (8%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA--FY 71
           +I+G  AG +  L  HPLD  KVR+Q+    + +     G+     EI  ++  L    Y
Sbjct: 12  VISGLTAGSVTTLIVHPLDLFKVRLQL----LITSTTKKGYRNLWSEIVGSDLSLTRELY 67

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLAD-----KETGKVSTGNTFIAGVGAGITEAXX 126
           +GL   ++G T    + F+SY   +  L +     +    +S+     A   +G+     
Sbjct: 68  RGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGML-TTV 126

Query: 127 XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQ 186
                   K R+ ++       A     +++    ++K +G   L++G  L  A    +Q
Sbjct: 127 LTNPLWVIKTRMMSK-------ANSDLTSMKVLRDLIKNDGVQGLWKG--LVPALVGVSQ 177

Query: 187 GA-NFTVYSKLK-EFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS 244
           GA +FT Y  LK + +    + + + + ET  +  +S  +   +  P   +K+ LQ  ++
Sbjct: 178 GALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQA 237

Query: 245 TKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           ++N     ++  + K +    G    YKG++  ++R  P   +TF  YE
Sbjct: 238 SENDF---KLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 67/133 (50%), Gaps = 10/133 (7%)

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH----NQEMLPSWETSLIGLISGAIGP 226
           LYRG+++         G  F  Y   K++L  Y+    N + L SW        SG +  
Sbjct: 66  LYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTT 125

Query: 227 FSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286
               PL  IKTR+   K+  +++ +K    + + LI+ +G + L+KG+ P ++ V+ G A
Sbjct: 126 VLTNPLWVIKTRMMS-KANSDLTSMK----VLRDLIKNDGVQGLWKGLVPALVGVSQG-A 179

Query: 287 VTFTAYEFIRKEL 299
           + FT Y+ ++ +L
Sbjct: 180 LHFTCYDTLKHKL 192

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 77/189 (40%), Gaps = 15/189 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           L A   +G++  +  +PL  IK RM    N+  + +K         ++ +N+G    +KG
Sbjct: 114 LSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLR------DLIKNDGVQGLWKG 167

Query: 74  LGAVVIGITPKMAIRFSSYEF--YRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXX 131
           L   ++G++ + A+ F+ Y+   ++ +L ++++ +++   T        +T         
Sbjct: 168 LVPALVGVS-QGALHFTCYDTLKHKLVLKNRDSDEITNLETI------AVTSVSKMLSTS 220

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
                +L   +L   + +      +     I    G    Y+G+S    R   +    F 
Sbjct: 221 AVYPFQLLKSNLQSFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFC 280

Query: 192 VYSKLKEFL 200
           +Y   K FL
Sbjct: 281 IYENFKSFL 289

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRIT--IIGKQLIQEEGFRALYKGIT 275
           GL +G++      PLD  K RLQ   ++    G + +   I+G  L      R LY+G+T
Sbjct: 15  GLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDL---SLTRELYRGLT 71

Query: 276 PRVMRVAPGQAVTFTAYEFIRKEL 299
             ++       + F +Y   +  L
Sbjct: 72  VNLVGNTIAWGLYFASYRVAKDYL 95

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 121/280 (43%), Gaps = 28/280 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+        V   G I +  +I  +EG  A   G G  ++G + + + +F
Sbjct: 33  PIDVVKTRIQLEPT-----VYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKF 87

Query: 90  SSYEFYRTLLAD--KETGKVSTGNTFIAGVGAGITE--AXXXXXXXXXXKIRLQAQHLNP 145
             YE ++ L  D       V+  N+   G  A I E  A          +IRL +Q    
Sbjct: 88  GGYEVFKKLFIDVLGYDQAVNYKNSIYIG-SAAIAEFFADIALCPLEATRIRLVSQ---- 142

Query: 146 VEGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH 204
               P + N +   ++ I+KEEG  + Y G +    +Q     A F V+ +  E   G  
Sbjct: 143 ----PTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMA 198

Query: 205 N-QEMLPSWETSLIGLISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
             +E L +  T+ I L+SG     + A    P DT+ +++ K K     S +  +  + K
Sbjct: 199 GPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAK 258

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           QL    GF   + G+  R++ V    ++ F  Y  ++K L
Sbjct: 259 QL----GFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTL 294

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 220 ISGAIGPFSN----APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           ++GAIG  +      P+D +KTR+Q + +  N   +       KQ+I  EG  AL  G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSF----KQIISSEGAGALLTGFG 73

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
           P ++  +   +  F  YE  +K
Sbjct: 74  PTLLGYSLQGSFKFGGYEVFKK 95

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTG--GE 60
           S   +S   +NL++G  AGL   +   P DT+  ++   K       KAPG    G   +
Sbjct: 203 SLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTK-------KAPGQSTIGLLAQ 255

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSY 92
           + +  GF+  + GL   ++ +    +++F  Y
Sbjct: 256 LAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 126/308 (40%), Gaps = 40/308 (12%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG  +GL    C  PLDT+K+++Q+  +   + V           I + EG   F+K
Sbjct: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI--------NILKREGIRGFWK 69

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-NTFIAGVGAGITEAXXXXXXX 131
           G     I        +F SY +  + L       +S    + + G  AG+T +       
Sbjct: 70  GNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFD 129

Query: 132 XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191
              + R  A   N      K ++ + A ++    EG    + G   +      N    F 
Sbjct: 130 VL-RTRFAA---NSQGQLIKLRDEIMAIWS---HEGLMGFFSGCGSSMINIGLNTAIMFG 182

Query: 192 VYSKLKEFLQ---GYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-------- 240
           VY  +K F +      ++    +    L G ISG     +  PLDT++ R+Q        
Sbjct: 183 VYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242

Query: 241 -------KD--KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTA 291
                  KD  KS KN    +R   +G  ++Q+EG  +LY+G+T  +++  P  A++  +
Sbjct: 243 RHDREFTKDIYKSYKN----RRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWS 298

Query: 292 YEFIRKEL 299
           YE    +L
Sbjct: 299 YELFMNKL 306

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 118/294 (40%), Gaps = 24/294 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA-PGFIKTGGEIYRNEGFLAFY 71
           + +AGG A  +     +P D +K RMQ+      +  K     I+  G I++NEG     
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLL-----ADKETGKV-STGNTFIAGVGAGITEAX 125
           KGL +  +        R   YE  R +L      + E+ KV   G    AG  +G+  A 
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAF 142

Query: 126 XXXXXXXXXKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
                    K R+Q+ + N +    +  Y +A     TI + EG   L+RGV     R  
Sbjct: 143 IGSPLFLV-KTRMQS-YSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTG 200

Query: 184 TNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPF----SNAPLDTIKTRL 239
                   +Y+  K FL  +         + + + L+S  I  F    +  P D + TR+
Sbjct: 201 IGSAVQLPIYNICKNFLLKHDLMN-----DGTGLHLLSSTIAGFGVGVAMNPWDVVLTRV 255

Query: 240 QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
              K     SG     I   + ++ EG  ALYKG   +++R+ P   +  T  E
Sbjct: 256 YNQKGNL-YSGPIDCFI---KTVRNEGLSALYKGFGAQILRIGPHTVLCLTFME 305

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 83/213 (38%), Gaps = 31/213 (14%)

Query: 106 KVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE 165
           KVS   +F+AG G     A          K R+Q Q       A  Y N +QA   I K 
Sbjct: 17  KVSKFGSFVAG-GLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKN 75

Query: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI-------- 217
           EG + L +G++     Q    G+    Y  ++  L    N    P+ E+  +        
Sbjct: 76  EGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGIL----NNVFYPNVESHKVQHIGINVA 131

Query: 218 -GLISGAIGPFSNAPLDTIKTRL----------QKDKSTKNMSGLKRITIIGKQLIQEEG 266
            G  SG +G F  +PL  +KTR+          Q+   T   +GL  I        + EG
Sbjct: 132 AGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATI-------FRSEG 184

Query: 267 FRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            + L++G+   ++R   G AV    Y   +  L
Sbjct: 185 IKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 17/176 (9%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGG--EIY 62
            K  +  +N+ AG  +G++      PL  +K RMQ Y NA+  G +        G   I+
Sbjct: 121 HKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIF 180

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG----NTFIAGVG 118
           R+EG    ++G+ A ++      A++   Y   +  L   +     TG    ++ IAG G
Sbjct: 181 RSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFG 240

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
            G+             ++  Q  +L        Y   +      V+ EG SALY+G
Sbjct: 241 VGVA---MNPWDVVLTRVYNQKGNL--------YSGPIDCFIKTVRNEGLSALYKG 285

>Kwal_23.3965
          Length = 307

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 129/320 (40%), Gaps = 61/320 (19%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +L+AG  +G+   +   PLDT+K+R+Q+    + +  +  G + T   + R EG  A +K
Sbjct: 17  SLVAGCLSGISARIVTAPLDTLKIRLQL---QLANEAQYGGILVTFKRLVRQEGVRALWK 73

Query: 73  GLGAVVIGITPKMAI-------RFSSYEFYRTLLADKET-GKVSTGNTFIAGVGAGITEA 124
           G         P MA+       +F+SY     LL+  +   ++ TG   + G  +G   A
Sbjct: 74  G-------NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTG---MVGALSGTCSA 123

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     + R  A H      + +    +     I + EGF   ++GVS +    A 
Sbjct: 124 IASYPCDVL-RTRFIANH------SRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAV 176

Query: 185 NQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGL-------ISGAIGPFSNAPLDTIKT 237
              +    Y  +K F       E  P  ++S+I L       I+G +      P+DT++ 
Sbjct: 177 ATSSILATYESVKIFC------EQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRK 230

Query: 238 RLQ-----------------KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280
           R Q                 K   +   +   R+ ++   ++++EG  ALY G T  + +
Sbjct: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALM---IVEKEGLLALYHGYTLGIAK 287

Query: 281 VAPGQAVTFTAYEFIRKELE 300
             P   V+   YE+  + +E
Sbjct: 288 SVPSTVVSLGVYEWCLRRME 307

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFR 268
           +P +++ + G +SG       APLDT+K RLQ   + +   G   I +  K+L+++EG R
Sbjct: 12  VPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG--GILVTFKRLVRQEGVR 69

Query: 269 ALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           AL+KG  P +       +  FT+Y  + K L
Sbjct: 70  ALWKGNVPAMAMYILYGSTQFTSYAILNKLL 100

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 83/207 (40%), Gaps = 28/207 (13%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCC----HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI 61
           KS  PA   I  G  G + G C     +P D ++ R            +    + T  EI
Sbjct: 102 KSQLPA--QIHTGMVGALSGTCSAIASYPCDVLRTRF-----IANHSRELSTMLSTAQEI 154

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA---DKETGKVSTGNTFIAGVG 118
           +R+EGF  F+KG+ + ++ I    +   ++YE  +       D+++  +    +  A V 
Sbjct: 155 WRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESS-ASVI 213

Query: 119 AGITEAXXXXXXXXXXKIRLQA---QHL-NPVEGAPKYK--------NAVQACYTIVKEE 166
           AGI             K R Q    Q L +P      YK        N ++    IV++E
Sbjct: 214 AGIVSKTIVFPIDTVRK-RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKE 272

Query: 167 GFSALYRGVSLTAARQATNQGANFTVY 193
           G  ALY G +L  A+   +   +  VY
Sbjct: 273 GLLALYHGYTLGIAKSVPSTVVSLGVY 299

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 129/312 (41%), Gaps = 39/312 (12%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAF--- 70
           +I+G  AG +  +  HPLD +KVR+Q+    + +  K  G+      I ++    +F   
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQL----LATNKKPQGYYDVVKRIVKDSKQHSFFRE 67

Query: 71  -YKGLGAVVIGITPKMAIRFSSY----------------EFYRTLLADKETGKVSTGNTF 113
            Y+GLG  ++G +    + F  Y                 F  T+  DKE   +++    
Sbjct: 68  TYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKE---MTSLMYL 124

Query: 114 IAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYR 173
           +A   +G+  +          K R+ +        +  Y++ V     + + EG +  +R
Sbjct: 125 LAAAMSGVATS-VLTNPIWVIKTRIMSTSF---VDSRSYRSTVDGIKKLYRIEGLAGFWR 180

Query: 174 GVSLTAARQATNQGA-NFTVYSKLK-EFLQGYH--NQEMLPSWETSLIGLISGAIGPFSN 229
           G  L  +    +QGA  FTVY  LK  +    H   ++ L + E   I  +S  +   + 
Sbjct: 181 G--LVPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAV 238

Query: 230 APLDTIKTRLQ--KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
            PL  +K+ LQ  +  +  N     R+  +   +   +G   LYKG+   ++R  P   +
Sbjct: 239 YPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 288 TFTAYEFIRKEL 299
           TF  YE  R  L
Sbjct: 299 TFCVYENFRHWL 310

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 136/354 (38%), Gaps = 94/354 (26%)

Query: 7   SSNPAV--NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRN 64
            +NP++  NL+AG  A + +    HP +                     F+KTG +++R+
Sbjct: 3   DTNPSLYSNLLAGSAAAVFQTTLSHPFE---------------------FLKTGQQLHRS 41

Query: 65  ----EGFLAF------YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET--GKVSTGNT 112
               E F  F      + G  A+ IGI  K A RF++++    LL D E     VS    
Sbjct: 42  LPNAEAFNMFHHVKSYFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRL 101

Query: 113 FIAGVGAGITEAXXXXXXXXXX----------------------KIRLQAQHLNPVEGA- 149
             AG   G  E+                                K + +++ +N +E   
Sbjct: 102 IAAGSITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKE 161

Query: 150 ---------------PKY-------KNAVQACYTIVKE----EGFSALYRGVSLTAARQA 183
                          P+Y       K+     +T V+E     GF+  ++G   T  RQ 
Sbjct: 162 QIRPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQV 221

Query: 184 TNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDK 243
            N    FT Y+ LK+ +      + L  +    IG+ S         P+D +KTR+Q   
Sbjct: 222 GNSAVRFTTYTTLKQMISP---NKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQ--- 275

Query: 244 STKNMSGLKR--ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
            +K    L R  +  + +  I EEG  +L+KG  PR+ +V     V+F  Y+++
Sbjct: 276 -SKYTWSLYRNSLNCVYRTFI-EEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYV 327

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 21/39 (53%)

Query: 259 KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           ++++Q  GF   ++G  P + R     AV FT Y  +++
Sbjct: 198 REMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQ 236

>Kwal_27.11626
          Length = 299

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 115/292 (39%), Gaps = 13/292 (4%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPG--FIKTG 58
           M++ +K S  A  ++    AG++E    HP+DT+  R+      + S  +     F +  
Sbjct: 1   MSNDKKQSGIA-RVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHA 59

Query: 59  GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVG 118
           GE      F  F  GLG        +   ++    F    L   +  K    N F    G
Sbjct: 60  GEALGKRLFTLF-PGLGYAASYKILQRVYKYGGQPFANEFL--NKNFKADFDNAFGEKTG 116

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
             +  A           + L    L             +    I+K+EGF  LYRG   T
Sbjct: 117 KALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILKDEGF-GLYRGWGWT 175

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPF-SNAPLDTIKT 237
           AAR A    A F   +  KE++ G  +     +W  + +  I GA      +APLD IKT
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSS-ATWSQNFVSSIVGASASLIVSAPLDVIKT 234

Query: 238 RLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
           R+Q        SG +    I +  ++ EG  A +KG+TP+++   P    +F
Sbjct: 235 RIQNRHFDNPESGFR----IVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSF 282

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 12/81 (14%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQ--IYKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69
           V+ I G  A L   +   PLD IK R+Q   + N         GF +      +NEG  A
Sbjct: 213 VSSIVGASASL---IVSAPLDVIKTRIQNRHFDNP------ESGF-RIVQNTLKNEGITA 262

Query: 70  FYKGLGAVVIGITPKMAIRFS 90
           F+KGL   ++   PK+   F+
Sbjct: 263 FFKGLTPKLLTTGPKLVFSFA 283

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 116/276 (42%), Gaps = 33/276 (11%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           PLD +K R+Q+      S +      KT   I R+EG    + G+GA  IG + + A ++
Sbjct: 35  PLDLVKCRLQVNPQLYRSNLDG---WKT---IVRSEGLSKVFTGVGATFIGYSLQGACKY 88

Query: 90  SSYEF----YRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNP 145
             YE+    Y  LL+ +   +  T     A   A   E            I+++ Q   P
Sbjct: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASA---EFLADILLCPWEAIKVKQQTTIP 145

Query: 146 VEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG--- 202
               P  KN ++    I   EG S LY+G++    RQ       FT + ++ E +     
Sbjct: 146 ----PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLP 201

Query: 203 YHNQEMLPSWE--TSLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
              QEM PS +   S + G ++G +    + P D + +++  D+        + +    K
Sbjct: 202 RSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG-----ESMVEASK 256

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           ++    GF  L+ G+  R+  +      T T+++++
Sbjct: 257 RIYSRIGFGGLWNGLPVRIFMIG-----TLTSFQWL 287

>Kwal_33.15597
          Length = 305

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 119/280 (42%), Gaps = 28/280 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+        V   G I +  +I  +EG  A   G G  ++G + + + +F
Sbjct: 33  PIDVVKTRIQLEPT-----VYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKF 87

Query: 90  SSYEFYRTLLADK--ETGKVSTGNTFIAGVGAGITE--AXXXXXXXXXXKIRLQAQHLNP 145
             YE ++ L  D       V+  N+   G  A I E  A          +IRL +Q    
Sbjct: 88  GGYEVFKKLFIDTLGYDQAVNYKNSIYIG-SAAIAEFFADIALCPLEATRIRLVSQ---- 142

Query: 146 VEGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH 204
               P + N +   ++ I+KEEG S+ Y G +    +Q     A F V+ +  E   G  
Sbjct: 143 ----PTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMA 198

Query: 205 NQE-----MLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
             +        +    L GL +G      + P DT+ +++ K K     S    I ++G 
Sbjct: 199 GPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQS---TIGLLG- 254

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           QL +E GF   + G+  R++ V    ++ F  Y  ++K L
Sbjct: 255 QLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTL 294

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 220 ISGAIGPFSN----APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           ++GAIG  +      P+D +KTR+Q + +  N   +       KQ+I  EG  AL  G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSF----KQIISSEGAGALLTGFG 73

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
           P ++  +   +  F  YE  +K
Sbjct: 74  PTLLGYSLQGSFKFGGYEVFKK 95

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 9/82 (10%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTG--GEIYRNEGFLAF 70
           NL++G  AGL   +   P DT+  ++   K       KAPG    G  G++ +  GF+  
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAK-------KAPGQSTIGLLGQLAKELGFVGS 265

Query: 71  YKGLGAVVIGITPKMAIRFSSY 92
           + GL   ++ +    +++F  Y
Sbjct: 266 FAGLPTRLVMVGTLTSLQFGIY 287

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 135/315 (42%), Gaps = 40/315 (12%)

Query: 3   SKQKSSNPAV--NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPG--FIKTG 58
           S +K  N A    L+AG  +GL+      P+DTIK+R+Q+      +G+K  G   ++  
Sbjct: 7   SLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQVMEVA 63

Query: 59  GEIYRNEGFLAFYKG-LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGV 117
             + +NEG  +F+KG +   ++ +T   A +FSSY  +   L     G  +  ++ + G 
Sbjct: 64  RSMIKNEGIRSFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYLTP--FGLEARLHSLVVGA 120

Query: 118 GAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSL 177
            AGIT +          + RL A   N +       +  +    I K EG    ++G   
Sbjct: 121 FAGITSSIVSYPFDVL-RTRLVAN--NQMHSM----SITREVRDIWKLEGLPGFFKGSIA 173

Query: 178 TAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS---WETSLI----GLISGAIGPFSNA 230
           +           F  Y  ++ +     N++   +   WE + +    G I G I      
Sbjct: 174 SMTTITLTASIMFGTYETIRIYCD--ENEKTTAAHKKWELATLNHSAGTIGGVIAKIITF 231

Query: 231 PLDTIKTRLQKDKSTKNMSGLKR------------ITIIGKQLIQEEGFRALYKGITPRV 278
           PL+TI+ R+Q   S K++    R               IG Q++++EG  +LY+GI   +
Sbjct: 232 PLETIRRRMQFMNS-KHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVAL 290

Query: 279 MRVAPGQAVTFTAYE 293
            +  P   V+F  YE
Sbjct: 291 SKTIPTTFVSFWGYE 305

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 91/209 (43%), Gaps = 27/209 (12%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRM----QIYKNAVGSGVKAPGFIKTGGEIYRNEGFL 68
           +L+ G  AG+   +  +P D ++ R+    Q++  ++   V+         +I++ EG  
Sbjct: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVR---------DIWKLEGLP 165

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET-------GKVSTGNTFIAGVGAGI 121
            F+KG  A +  IT   +I F +YE  R    + E         +++T N     +G  I
Sbjct: 166 GFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 122 TEAXXXXXXXXXXKIR-LQAQHL------NPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
            +           +++ + ++HL      + V G+ K     +    I+K+EG S+LYRG
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 175 VSLTAARQATNQGANFTVYSKLKEFLQGY 203
           + +  ++       +F  Y     +L+ Y
Sbjct: 286 ILVALSKTIPTTFVSFWGYETAIHYLRMY 314

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 10/96 (10%)

Query: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLK----RITIIGKQLIQE 264
           + +W+T L G +SG +     AP+DTIK RLQ   +    +GLK    ++  + + +I+ 
Sbjct: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPA----NGLKPFGSQVMEVARSMIKN 69

Query: 265 EGFRALYKGITP-RVMRVAPGQAVTFTAYEFIRKEL 299
           EG R+ +KG  P  ++ V  G A  F++Y    + L
Sbjct: 70  EGIRSFWKGNIPGSLLYVTYGSA-QFSSYSLFNRYL 104

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIY----------KNAVGSGVKA 51
           A+ +K     +N  AG   G++  +   PL+TI+ RMQ             ++V    K 
Sbjct: 204 AAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKG 263

Query: 52  PGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93
            GF + G +I + EG  + Y+G+   +    P   + F  YE
Sbjct: 264 YGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 39/283 (13%)

Query: 13  NLIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           N++ G G  L E      PL+ +K  M  ++           F++    ++   G   FY
Sbjct: 14  NILLGAGLNLSEVTTLGQPLEVVKTTMAAHREF--------NFLQATKHVWSRGGIFGFY 65

Query: 72  KGL-----------GAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
           +GL           GAV++ ++ +   RF            K  G  + G   + G+  G
Sbjct: 66  QGLIPWAWIEASTKGAVLLFVSAEAEYRF------------KVLGLNNFGAGIMGGITGG 113

Query: 121 ITEAXXXXXXXXXXK-IRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTA 179
           +T+A          K + +  Q    V G    +++ Q   +I K+EG   + +GV+  A
Sbjct: 114 VTQAYLTMGFCTCMKTVEITRQKAANVPGVIP-QSSWQVFKSIYKKEGIRGINKGVNAVA 172

Query: 180 ARQATNQGANF----TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTI 235
            RQ TN G+ F     V   +++        + L + E  +   I G +  + N P++ I
Sbjct: 173 IRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAW-NQPIEVI 231

Query: 236 KTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
           +  +Q  K   N      +    K + Q  G + LY+G+TPRV
Sbjct: 232 RVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV 274

>Kwal_26.7653
          Length = 325

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 83/207 (40%), Gaps = 18/207 (8%)

Query: 100 ADKETG-KVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQA 158
           ADK    KVS   +FIAG G     A          K R+Q Q     +    YKN +QA
Sbjct: 14  ADKPAAQKVSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQA 72

Query: 159 CYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI- 217
              I K EG   L +G+S     Q    G+    Y  ++  L    N+   P+ +   + 
Sbjct: 73  LKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVL----NKTFYPAMDPHKVQ 128

Query: 218 --------GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQL---IQEEG 266
                   G  SG IG    +PL  IKTR+Q   +   +      T I   L    + EG
Sbjct: 129 NVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEG 188

Query: 267 FRALYKGITPRVMRVAPGQAVTFTAYE 293
           F+ LY+G+   ++R   G +V    Y 
Sbjct: 189 FKGLYRGVDAAILRTGAGSSVQLPIYN 215

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 119/304 (39%), Gaps = 44/304 (14%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQ-----------IYKNAVGSGVKAPGFIKTGGEI 61
           + IAGG A  +     +P++ +K RMQ           IYKN + +       +K    I
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQA-------LKV---I 76

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-----ETGKV-STGNTFIA 115
           ++NEG     KGL    I        R   YE  R++L        +  KV +     ++
Sbjct: 77  FKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS 136

Query: 116 GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEEGFSALYR 173
           G  +GI  A          K R+Q+ + N ++   +  Y +      +I + EGF  LYR
Sbjct: 137 GATSGIIGAIMGSPLFLI-KTRMQS-YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA--- 230
           GV     R          +Y+  K FL  +   +     E + + L++  +  F      
Sbjct: 195 GVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGLHLVASTVSGFGVGVVM 249

Query: 231 -PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
            P D I TR+   K       L        + ++ EG  ALYKG   ++ R+AP   +  
Sbjct: 250 NPWDVILTRVYNQKGNLYKGPLDCFV----KTVRIEGIGALYKGFEAQIFRIAPHTILCL 305

Query: 290 TAYE 293
           T  E
Sbjct: 306 TFME 309

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 72/176 (40%), Gaps = 17/176 (9%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA--VGSGVKAPGFIKTGGEIY 62
            K  N AVN+++G  +G++  +   PL  IK RMQ Y NA  +G              IY
Sbjct: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIA----GVG 118
           R EGF   Y+G+ A ++      +++   Y   +  L   +  K  TG   +A    G G
Sbjct: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG 244

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
            G+             ++  Q  +L        YK  +      V+ EG  ALY+G
Sbjct: 245 VGVV---MNPWDVILTRVYNQKGNL--------YKGPLDCFVKTVRIEGIGALYKG 289

>Scas_662.12
          Length = 308

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 131/310 (42%), Gaps = 36/310 (11%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQI------------YKNAVGSGVKAPGFIKTGGEI 61
           +I+G  AG +  L  HPLD IKVR+Q+            Y   +   +     + + G I
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFI---AGVG 118
           Y        Y+GL   ++G     ++ F+ Y   +  +   +   +   NT I   +G+ 
Sbjct: 71  Y--NLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMF--QNNYLHNNNTTIFLTSGLI 126

Query: 119 AGI-TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSL 177
           +GI T            +I   ++H         YK+      +++ +EG  A++ G  L
Sbjct: 127 SGISTTLLTNPLWVIKTRIMSTSRH-----HKDSYKSIRHGFKSLLTKEGPKAIWMG--L 179

Query: 178 TAARQATNQGA-NFTVYSKLKEFLQGYHNQEMLPS----WETSLIGLISGAIGPFSNAPL 232
             +    +QGA  F +Y  LK       N+    +     +  LI  +S  +   S  P 
Sbjct: 180 LPSLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPF 239

Query: 233 DTIKTRLQKDKSTKN---MSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
             +K+ LQ  +S  N    +    IT+I +++ ++ G + LYKG++  ++R  P   +TF
Sbjct: 240 QLLKSNLQTFRSVTNNIPQNDYHFITLI-RKIYRDNGIKGLYKGLSANLLRAIPSTCITF 298

Query: 290 TAYEFIRKEL 299
             YE  + +L
Sbjct: 299 CIYENFKSKL 308

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 11/99 (11%)

Query: 206 QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEE 265
            E+ P  +  + GL +G++      PLD IK RLQ   +T      K  T +  +LI   
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 266 G-----------FRALYKGITPRVMRVAPGQAVTFTAYE 293
                        +  Y+G+   ++  A   ++ FT Y 
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYN 100

>Scas_667.4
          Length = 308

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 127/303 (41%), Gaps = 28/303 (9%)

Query: 1   MASKQ---KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGF 54
           M+SK+   K SN A++ + GG +  +      P++ +K+ +Q     +  G    K  G 
Sbjct: 1   MSSKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGI 60

Query: 55  IKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET---GKVSTGN 111
           I+      + EG +AF++G  A VI   P  A+ F+  +  + +   K+    GK   GN
Sbjct: 61  IECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGN 120

Query: 112 TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPK-YKNAVQACYTIVKEEGFSA 170
               G   G++            + RL A   +  +G  + YK  +      +  +G + 
Sbjct: 121 LASGGAAGGLS--LLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAG 178

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLK-EFLQGYHNQEMLPSWETSLIGLISGAIGPFSN 229
           LYRG   +       +G  F +Y  LK   L G      L S+   L+G I       ++
Sbjct: 179 LYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASF---LLGWIVTTGASTAS 235

Query: 230 APLDTIKTRLQKDKSTKNMSGLKRITIIG-----KQLIQEEGFRALYKGITPRVMRVAPG 284
            PLDT++ R+        M+  + +   G     ++++  EG  +L+KG    ++R   G
Sbjct: 236 YPLDTVRRRMM-------MTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAG 288

Query: 285 QAV 287
             V
Sbjct: 289 AGV 291

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 74/191 (38%), Gaps = 6/191 (3%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           +  + GV A + +            I+ Q + +       KYK  ++      K EG  A
Sbjct: 16  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIA 75

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    K+K    G+  +E    W    +  G  +G +    
Sbjct: 76  FWRGNTANVIRYFPTQALNFAFKDKIKAMF-GFKKEEGYGKWFAGNLASGGAAGGLSLLF 134

Query: 229 NAPLDTIKTRLQKDKSTKNMSG---LKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
              LD  +TRL  D  +    G    K +  + KQ +  +G   LY+G  P V+ +   +
Sbjct: 135 VYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIVYR 194

Query: 286 AVTFTAYEFIR 296
            + F  Y+ ++
Sbjct: 195 GLYFGLYDSLK 205

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 130/320 (40%), Gaps = 59/320 (18%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           MA + K+S+   +LI G   GL   +   P D +K R+Q  K+    G      I++  +
Sbjct: 1   MAERPKTSS---HLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKE--IRSPKQ 55

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIA----- 115
           ++R     +    +G+         A+  S+   +RT +A  +T  ++ G++F+      
Sbjct: 56  LWRGALPSSLRTSIGS---------ALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMY 106

Query: 116 ----------GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE 165
                     GV   IT            K+R ++   +       YK+  +A   I   
Sbjct: 107 ENLASGAFTRGVVGFIT------MPITIIKVRYESTMYS-------YKSLGEATRHIYST 153

Query: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQ--------GYHNQEMLPSWETSLI 217
           EG    + G   T  R A   G    +Y K K  +          Y    M  ++ ++++
Sbjct: 154 EGIRGFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVV 213

Query: 218 ----GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKG 273
                 +S ++     +P DTIKTR+Q D +    SG  +  ++   ++ +E F+ L+ G
Sbjct: 214 NSISAFMSASLATTITSPFDTIKTRMQLDPT--KFSGFYKTLVL---IVSKEKFKNLFDG 268

Query: 274 ITPRVMRVAPGQAVTFTAYE 293
           +T R+ R A    + +  YE
Sbjct: 269 LTLRLTRKAFSAGIAWGIYE 288

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 219 LISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           LI G +G  ++A    P D +KTRLQ++K T     LK I             + L++G 
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEI----------RSPKQLWRGA 60

Query: 275 TPRVMRVAPGQAVTFTAYEFIRKEL 299
            P  +R + G A+  +     R  +
Sbjct: 61  LPSSLRTSIGSALYLSTLNVFRTAM 85

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 123/306 (40%), Gaps = 40/306 (13%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQI---------YKNAVGSGVKAPGFIKTGGEIYRN 64
           +I+G  AG +  +  HPLD IK+R+Q+         Y N V   +K      +G +    
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKD----GSGTQQLLK 71

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET----------GKVSTGNTFI 114
           E     Y+GLG  +IG      + F  Y   + ++    +           +  T + ++
Sbjct: 72  EA----YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYL 127

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
              GA               K R+ +      +G     NA+   YT   EEG    +RG
Sbjct: 128 VSAGASGLATALLTNPMWVIKTRIMST--KSSQGYTSILNAITRIYT---EEGLKTFWRG 182

Query: 175 VSLTAARQATNQGA-NFTVYSKLK-EFLQGYHN--QEMLPSWETSLIGLISGAIGPFSNA 230
             L  +     QGA  F +Y  LK ++L   ++  +  L + ET  I  +S  I   S  
Sbjct: 183 --LVPSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVY 240

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFT 290
           PL  +KT LQ  ++  N +   ++  + + +    G    YKG+   ++R  P   +TF 
Sbjct: 241 PLQLLKTNLQTFRTEHNENS--KMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFG 298

Query: 291 AYEFIR 296
            YE  +
Sbjct: 299 VYEHFK 304

>Kwal_34.15907
          Length = 312

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 125/306 (40%), Gaps = 45/306 (14%)

Query: 13  NLIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNA-VGSGVKAPGFIKTGGEIYRNEGFLAF 70
           N++ G G  L E      PL+ IK  M   +N   G  VK          ++   G   F
Sbjct: 20  NILLGAGLNLCEATTLGQPLEVIKTTMAANRNLNFGQSVK---------HVWSRGGVFGF 70

Query: 71  YKGL-----------GAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGA 119
           Y+GL           GAV++ ++ +     + Y+F R  L +        G   + GV  
Sbjct: 71  YQGLIPWAWIEASTKGAVLLFVSAE-----AEYQFKRLGLGN-------FGAGIMGGVSG 118

Query: 120 GITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTA 179
           G+ +A          K     +  + V GA   +++  A   I  +EG   + +GV+  A
Sbjct: 119 GVAQAYLTMGFCTCMKTVEITKAKSAVAGAIP-QSSWSAFKEIYSKEGIKGINKGVNAVA 177

Query: 180 ARQATNQGANF----TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTI 235
            RQ TN G+ F     V   +++F    +  + L + E      + G +  + N P++ I
Sbjct: 178 IRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAW-NQPIEVI 236

Query: 236 KTRLQKDKSTKNMSGLKRITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           +  +Q  K   N    K++T+    K + Q  G + LY+G+ PR+  +   Q V    + 
Sbjct: 237 RVEMQSKKEDPNRP--KKLTVGSAFKYIYQSSGIKGLYRGVAPRI-GLGVWQTVFMVGFG 293

Query: 294 FIRKEL 299
            I KE 
Sbjct: 294 DIAKEF 299

>Kwal_23.5757
          Length = 307

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 115/278 (41%), Gaps = 36/278 (12%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           PLD +K R Q+  +   S +          +I R+EG    + G+GA  IG + + A ++
Sbjct: 39  PLDLVKCRRQVDASLYKSNLDG------WRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92

Query: 90  SSYEFYR---TLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPV 146
             YEF++   + L   ET        F+A   +    A          K+R Q     P 
Sbjct: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPF 152

Query: 147 EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQ 206
                 +N   A   +V  EGF++LY+G++    RQ       FT + ++ E +   + +
Sbjct: 153 A-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMI---YAR 204

Query: 207 EMLPSWETSLIGLIS---------GAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITII 257
              P  E S +G IS         G +    + P D + +++  ++ +   +      I 
Sbjct: 205 LPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGESTLQATSRIY 264

Query: 258 GKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           GK      GF  L+ G+  R++ +      T T+++++
Sbjct: 265 GKI-----GFPGLWNGLAVRILMIG-----TLTSFQWL 292

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 13/88 (14%)

Query: 215 SLIGLISGAIGPFSNA--PLDTIKTRLQKDKST--KNMSGLKRITIIGKQLIQEEGFRAL 270
           +L GL+  A GP  +A  PLD +K R Q D S    N+ G +       Q+++ EG   +
Sbjct: 23  TLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWR-------QIVRSEGATKV 73

Query: 271 YKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           + G+    +  +   A  +  YEF + +
Sbjct: 74  FTGVGATAIGYSLQGAFKYGGYEFFKHQ 101

>Scas_645.9
          Length = 391

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 111/283 (39%), Gaps = 44/283 (15%)

Query: 43  NAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK 102
           N   S V+  G ++   +I++ EG    ++G+   ++   P   + F+ YE+ R    D 
Sbjct: 121 NCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR----DN 176

Query: 103 ETGKVS--TGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY 160
                S  T N  + G  A I  A           + L    L  +    K   +     
Sbjct: 177 SPLATSSPTFNPLMCGAIARILAASTVA------PLELLKTKLQSIPRVSKSTTSWMMVK 230

Query: 161 TIVKEE--------GFSALYRGVSLTAARQATNQGANFTVY--SKLKEFLQGYHNQEMLP 210
            ++KE           +AL++G+ +T  R        +  Y   K   ++    +   L 
Sbjct: 231 ELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLT 290

Query: 211 SWETSLIG-LISGAIGPFSNAPLDTIKTRLQ------KDKS---------TKNMSGLKRI 254
            +  S IG  ISG I      P D  KTR Q       DKS         TKNM    R 
Sbjct: 291 FFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLR- 349

Query: 255 TIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
                 + + EG+ ALY G+ PR++++AP  A+  ++YE  ++
Sbjct: 350 -----NIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 14/167 (8%)

Query: 141 QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
           Q LN    + ++   ++A   I K EG + L+RG+S+            FT Y  L++  
Sbjct: 118 QELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRD-- 175

Query: 201 QGYHNQEML---PSWETSLIGLISGAIGPFSNAPLDTIKTRLQK----DKSTKNMSGLKR 253
               N  +    P++   + G I+  +   + APL+ +KT+LQ      KST +   +K 
Sbjct: 176 ----NSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKE 231

Query: 254 ITIIGKQLIQEEG-FRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +    +Q ++  G   AL+KG+   + R  P  A+ + +YEF +  L
Sbjct: 232 LLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHL 278

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQI--YKNAVGSGVKAPGFIKTGG------EIYRN 64
           + I G  +G +  L  HP D  K R QI    N   S VK+P   +T         I++ 
Sbjct: 295 SFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKL 354

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
           EG+ A Y GL   ++ I P  AI  SSYE  + L 
Sbjct: 355 EGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

>Kwal_23.4354
          Length = 343

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 108/262 (41%), Gaps = 37/262 (14%)

Query: 59  GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVG 118
           G+I + EG  + ++GL   ++   P   + F  YE  R     +   K  T N  + G  
Sbjct: 92  GKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD--KSRLQDKYPTLNPLMCGAL 149

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE-------GFSAL 171
           A +  A          + RLQ+        +PK   A+     ++KE        G+ AL
Sbjct: 150 ARVL-AATTVAPLELFRTRLQSIP----RSSPKSTTAMMI-KDLIKESRYEISKVGYKAL 203

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS----WE---TSLIG-LISGA 223
           +RG+ +T  R        +  Y   K  +     + ++ S    W     S +G    GA
Sbjct: 204 FRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGA 263

Query: 224 IGPFSNAPLDTIKTRLQ--------KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           +      P D  KTR+Q        + K +KNM   K +     Q+ + EG  ALY G+ 
Sbjct: 264 VAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNM--FKYLN----QMRKSEGLAALYTGLV 317

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
           PRV+++AP  A+  + YE  ++
Sbjct: 318 PRVIKIAPSCAIMISTYEVCKR 339

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 9/154 (5%)

Query: 151 KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLP 210
           +Y +   A   I K EG  +L+RG+S+T    A      F  Y  L++       Q+  P
Sbjct: 83  RYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD---KSRLQDKYP 139

Query: 211 SWETSLIGLISGAIGPFSNAPLDTIKTRLQ-----KDKSTKNMSGLKRITIIGKQLIQEE 265
           +    + G ++  +   + APL+  +TRLQ       KST  M  +K +    +  I + 
Sbjct: 140 TLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMM-IKDLIKESRYEISKV 198

Query: 266 GFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           G++AL++G+   + R  P  ++ +  YEF +  +
Sbjct: 199 GYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNV 232

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 46/100 (46%), Gaps = 2/100 (2%)

Query: 3   SKQKSSNPAVNLIAGGG-AGLMEGLCCHPLDTIKVRMQI-YKNAVGSGVKAPGFIKTGGE 60
           S   + N  VN   GG   G +  +  HP D  K RMQI Y N+      +    K   +
Sbjct: 243 SSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQ 302

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
           + ++EG  A Y GL   VI I P  AI  S+YE  + L +
Sbjct: 303 MRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

>Kwal_47.19228
          Length = 281

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 96/264 (36%), Gaps = 44/264 (16%)

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET--GKVSTGNTFIAGVGAGITEA--- 124
           ++ G  A+ +G   K A RF++++    LL D E   G +S      AGV  G  E+   
Sbjct: 8   YFAGCSALNVGTLLKTATRFTTFDRACQLLHDPENPNGTISGPRLLAAGVITGFMESLLV 67

Query: 125 ---------------------------XXXXXXXXXXKIRLQAQHLNPVEGAPKY----- 152
                                                    Q + L+P +    Y     
Sbjct: 68  IPFENIKTTMIENALLLSERANAEPQEKKKVTVQPRATFHSQKKALHPRQKWALYYDEHP 127

Query: 153 -KNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS 211
            +  +     I +  G     +G   T  RQ +N    FT Y+ LK+ +      + L  
Sbjct: 128 SRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISP---NKPLNE 184

Query: 212 WETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALY 271
           +    +G IS         P+D IKTR+Q   S    S  K       ++  EEGF   +
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRMQ---SKYTWSNYKNSLNCAYRIFVEEGFTKFW 241

Query: 272 KGITPRVMRVAPGQAVTFTAYEFI 295
           KG  PR+M+V     V+F  Y+++
Sbjct: 242 KGWAPRLMKVGLSGGVSFGVYQYV 265

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 68/156 (43%), Gaps = 12/156 (7%)

Query: 54  FIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTF 113
           F+ T  EIYR+ G   F +G    +I  T   A+RF++Y   + +++  +       N +
Sbjct: 131 FLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPL-----NEY 185

Query: 114 IAGVGAGITEAXXXXXXX--XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSAL 171
            A     I+              K R+Q+++         YKN++   Y I  EEGF+  
Sbjct: 186 YAFALGFISSCAVVAVTQPIDVIKTRMQSKY-----TWSNYKNSLNCAYRIFVEEGFTKF 240

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQE 207
           ++G +    +   + G +F VY  +   ++  + Q+
Sbjct: 241 WKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQ 276

>Scas_673.17
          Length = 314

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 117/280 (41%), Gaps = 28/280 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+        V   G + +  +I  +EG  A   G G  ++G + + A +F
Sbjct: 40  PVDVVKTRIQLEPT-----VYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKF 94

Query: 90  SSYEFYRTLLADK--ETGKVSTGNTFIAGVGAGITE--AXXXXXXXXXXKIRLQAQHLNP 145
             YE ++ L  D       V   N+   G  A + E  A          +IRL +Q    
Sbjct: 95  GGYEVFKKLSIDTIGYENAVHYKNSVYMG-SAAVAEFLADIALCPLEATRIRLVSQ---- 149

Query: 146 VEGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH 204
               P + N +   ++ I+KEEG  + Y G +    +Q     A F V+ +  E   G  
Sbjct: 150 ----PTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGIV 205

Query: 205 N-QEMLPSWETSLIGLISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
             +E L     + I L+SG    F+ A    P DT+ +++ K K     S +  +  + K
Sbjct: 206 GAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAK 265

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           QL    G    + G+  R++ V    ++ F  Y  ++  L
Sbjct: 266 QL----GVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTL 301

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 220 ISGAIG----PFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           ++GAIG      S  P+D +KTR+Q + +  N   +       K++I +EG  AL  G  
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSF----KKIIADEGAGALLTGFG 80

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
           P ++  +   A  F  YE  +K
Sbjct: 81  PTLLGYSVQGAFKFGGYEVFKK 102

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 116/291 (39%), Gaps = 23/291 (7%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
            +AG  +G+ +    HP DTIKVR+Q  +N   +  K P  +    + +RN+G   FY G
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE--TRFKGP--LDCVYKTFRNQGIRGFYLG 82

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVSTGNTFIAGVGAGITEAXXXXXX 130
               ++G     ++       YR L+         K+      I+GV AG +        
Sbjct: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWS-VSFIAPP 141

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
               K +LQ Q+    +   +YK  +     I   +G   LY+G+  T   +      +F
Sbjct: 142 IELAKAKLQVQY---DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT-----HF 193

Query: 191 TVYSKLKEFLQGY--HNQEMLPSWETSLIGLISGAIGPFSNA-PLDTIK-TRLQKDKSTK 246
             +    E L  +   N +M  +      G  S + G ++ A P D +K   L  DK   
Sbjct: 194 VYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDG 253

Query: 247 NMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           +    +      K + Q +G    +KG  P  +R  P  A    A+EF+ +
Sbjct: 254 SFKSWRTAV---KDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLR 301

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 131/328 (39%), Gaps = 53/328 (16%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQI----YKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           +AGG +G        PLD IK+  Q     Y    GS V   G  +    I+ N+G   F
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLV---GLYEAAKHIWINDGIRGF 79

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXX 130
           ++G    ++ I P  A++F +YE  R++L      + S      +G  AG+  +      
Sbjct: 80  FQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYE-SHWRRLASGSLAGLC-SVFITYP 137

Query: 131 XXXXKIRLQ--AQHLNPVEGAPKYKNAVQACYTIVKEEGFSA-------------LYRGV 175
               ++RL    +H        K ++ V+  Y     EG ++              YRG 
Sbjct: 138 LDLTRVRLAYVTEH-----KRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGY 192

Query: 176 SLTAARQATNQGANFTVYSKLKEFLQG----------YHNQEMLP-----------SWET 214
             T        G +F  +  + + ++             +QE L            +W  
Sbjct: 193 VPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAE 252

Query: 215 SLIGLISGAIGPFSNAPLDTIKTRLQKDK-STKNMSGLK--RITIIGKQLIQEEGFRALY 271
            + G +SG +   +  PL+ I+ RLQ    S + M   K   I+ I + + QE+G+R  +
Sbjct: 253 LVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFF 312

Query: 272 KGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            G++   ++V P  A +F  YE ++  L
Sbjct: 313 VGLSIGYIKVTPMVACSFFVYERMKWHL 340

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 73/201 (36%), Gaps = 26/201 (12%)

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE----EGFSA 170
           +G+  G++ +          +I++  Q  NP     KY  ++   Y   K     +G   
Sbjct: 21  SGLAGGVSGSCAKTLIAPLDRIKILFQTSNP--HYSKYAGSLVGLYEAAKHIWINDGIRG 78

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
            ++G S+T  R        F  Y +++  L    ++E    W     G ++G    F   
Sbjct: 79  FFQGHSVTLLRIFPYAAVKFVAYEQIRSILIP--SREYESHWRRLASGSLAGLCSVFITY 136

Query: 231 PLDTIKTRLQKDKSTKNM---------------SGLKRITIIGKQLIQEEGFRALYKGIT 275
           PLD  + RL      K +                GL    ++ K       F   Y+G  
Sbjct: 137 PLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNF---YRGYV 193

Query: 276 PRVMRVAPGQAVTFTAYEFIR 296
           P V+ + P   V+F A++ I 
Sbjct: 194 PTVLGMIPYAGVSFFAHDLIH 214

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 213 ETSLIGLISGAIGPFSNAPLDTIKTRLQKDKS--TKNMSGLKRITIIGKQLIQEEGFRAL 270
            + L G +SG+      APLD IK   Q      +K    L  +    K +   +G R  
Sbjct: 20  RSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGF 79

Query: 271 YKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           ++G +  ++R+ P  AV F AYE IR  L
Sbjct: 80  FQGHSVTLLRIFPYAAVKFVAYEQIRSIL 108

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGS--GVKAPGFIKTGGEIYRNEGFLAF 70
            L+AGG +G++     +PL+ I+ R+Q+   +       K          IY+ +G+  F
Sbjct: 252 ELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGF 311

Query: 71  YKGLGAVVIGITPKMAIRFSSYE 93
           + GL    I +TP +A  F  YE
Sbjct: 312 FVGLSIGYIKVTPMVACSFFVYE 334

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 114/279 (40%), Gaps = 26/279 (9%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+        V   G + +  +I   EG  A   G G  ++G + + A +F
Sbjct: 33  PIDVVKTRIQLEPT-----VYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKF 87

Query: 90  SSYEFYRTLLADK---ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPV 146
             YE ++    D    +T      + +I    A    A          +IRL +Q     
Sbjct: 88  GGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ----- 142

Query: 147 EGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKE-FLQGYH 204
              P + N +   ++ I+KEEG  + Y G +    +Q     A F V+ +  E +     
Sbjct: 143 ---PTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFSLAP 199

Query: 205 NQEMLPSWETSLIGLISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260
            ++ L     + I L+SG     + A    P DT+ +++ K       S +  +  + KQ
Sbjct: 200 PKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQ 259

Query: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           L    GF   + G+  R++ V    ++ F  Y  ++K L
Sbjct: 260 L----GFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKKSL 294

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 220 ISGAIGPFSN----APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
           ++GAIG  S      P+D +KTR+Q + +  N    K +    +++I EEG  AL  G  
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYN----KGMVGSFRKIIAEEGAGALLTGFG 73

Query: 276 PRVMRVAPGQAVTFTAYEFIRK 297
           P ++  +   A  F  YE  +K
Sbjct: 74  PTLLGYSIQGAFKFGGYEVFKK 95

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTG--GEIYR 63
           ++S  A+NL++G  AGL   +   P DT+  +       V    KAPG    G   ++ +
Sbjct: 206 QTSLTAINLLSGLTAGLAAAIVSQPADTLLSK-------VNKTSKAPGQSTVGLLFQLAK 258

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSY 92
             GF+  + GL   ++ +    +++F  Y
Sbjct: 259 QLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 126/313 (40%), Gaps = 41/313 (13%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFI--------KTGGEIYRNE 65
           +I+G  AG +  L  HPLD +KVR+Q+   +       P  +           G    NE
Sbjct: 13  VISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNE 72

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSY-----EFYRTLLADKETGKVSTGNT-------- 112
                Y+GL   + G      + F  Y       Y+++    ET     GN         
Sbjct: 73  ----LYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIY 128

Query: 113 FIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAP-KYKNAVQACYTIVKEEGFSAL 171
             AG  +G+  A             ++ + ++  +GA   Y +       +++ +GF  L
Sbjct: 129 LSAGASSGLMTAILTNPIWV-----IKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGL 183

Query: 172 YRGVSLTAARQATNQGA-NFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
           ++G  L  A    +QGA  F VY  LK+       +  L    T+L  +   ++G   + 
Sbjct: 184 WKG--LVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSV 241

Query: 231 ----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286
               P   +K+ LQ  ++ +      R+  + K +I  +GF  LYKG++  ++R  P   
Sbjct: 242 TLVYPFQLLKSNLQSFRANEQKF---RLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTC 298

Query: 287 VTFTAYEFIRKEL 299
           +TF  YE ++  L
Sbjct: 299 ITFCVYENLKHRL 311

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 112/282 (39%), Gaps = 39/282 (13%)

Query: 13  NLIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           N++ G G  + E      PL+ +K  M   +           F +    I+   G   FY
Sbjct: 17  NILLGAGLNMCEVTTLGQPLEVVKTTMAANRQFT--------FFQAINHIWSRGGVFGFY 68

Query: 72  KGL-----------GAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
           +GL           GAV++ ++ +     + Y F       K+ G  + G   + GV  G
Sbjct: 69  QGLIPWAWIEASTKGAVLLFVSAE-----AEYHF-------KKLGLNNFGAGIMGGVSGG 116

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
           + +A          K     +H +   GA +   A  A   I  +EG   + +GV+  A 
Sbjct: 117 VAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWA--AFKEIYNKEGIRGINKGVNAVAI 174

Query: 181 RQATNQGANF----TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIK 236
           RQ TN G+ F     V   L++F    +  + L + E      I G +  + N P++ I+
Sbjct: 175 RQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAW-NQPIEVIR 233

Query: 237 TRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
             +Q   +  N      +    + + Q  G + LY+G+TPR+
Sbjct: 234 VEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTPRI 275

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 115/290 (39%), Gaps = 25/290 (8%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
            ++G  +G+ +    HP DTIKVR+Q  +++  +  K P  +    + +  +G   FY G
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS--TRFKGP--LDCVYKTFTQQGIRGFYLG 119

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADK---ETGKVSTGNTFIAGVGAGITEAXXXXXX 130
               ++G     ++       YR LL         K+      I+GV AG +        
Sbjct: 120 FTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWS-VSFIAAP 178

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
               K +LQ Q+        KY   V     +    G   LY+G++ T   +      NF
Sbjct: 179 VELAKAKLQVQY---DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT-----NF 230

Query: 191 TVYSKLKEFLQGYHNQEMLPSWETSL---IGLISGAIGPFSNA-PLDTIK-TRLQKDKST 245
             +    E L  +  +    S +T++    G  S + G ++ A P D IK   L  DK  
Sbjct: 231 VFWWGSYELLTRWFKEHTNMS-DTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYD 289

Query: 246 KNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
                 K   +  K + +  G+R  +KG  P  +R  P  A    A+EF+
Sbjct: 290 GTFRSWK---LAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFV 336

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 127/320 (39%), Gaps = 49/320 (15%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQI----YKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           +AGG +G        PLD IK+  Q     Y    GS +   G ++    I+ N+G   F
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLI---GLVEAAKHIWINDGVRGF 94

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYR-TLLADKETGKVSTGNTFIAGVGAGITEAXXXXX 129
           ++G  A ++ I P  A++F +YE  R TL+  KE    S     ++G  AG+  +     
Sbjct: 95  FQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFE--SHWRRLVSGSLAGLC-SVFITY 151

Query: 130 XXXXXKIRL--QAQHLNPVEG---APKYKNAVQACYTIVKEE-------GFSALYRGVSL 177
                ++RL  + +H     G      YK    A  T++K +        +   YRG   
Sbjct: 152 PLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASA--TLIKNDYIPNWFCHWCNFYRGYVP 209

Query: 178 TAARQATNQGANFTVYSKLKE-----FLQGYHNQEM----------------LPSWETSL 216
           T        G +F  +  L +     F   Y   E+                L +W   +
Sbjct: 210 TVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELI 269

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDK-STKNMSGLK--RITIIGKQLIQEEGFRALYKG 273
            G ++G     +  P + I+ RLQ    S K M   K   I+ I   + +E G R  + G
Sbjct: 270 SGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVG 329

Query: 274 ITPRVMRVAPGQAVTFTAYE 293
           ++   ++V P  A +F  YE
Sbjct: 330 LSIGYIKVTPMVACSFFVYE 349

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 82/202 (40%), Gaps = 20/202 (9%)

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNA----VQACYTIVKEEGFSA 170
           +G+  GI+ +          +I++  Q  NP     KY  +    V+A   I   +G   
Sbjct: 36  SGLAGGISGSCAKTLIAPLDRIKILFQTSNP--HYTKYTGSLIGLVEAAKHIWINDGVRG 93

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
            ++G S T  R        F  Y +++  L    ++E    W   + G ++G    F   
Sbjct: 94  FFQGHSATLLRIFPYAAVKFVAYEQIRNTLIP--SKEFESHWRRLVSGSLAGLCSVFITY 151

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQ-----LIQEE-------GFRALYKGITPRV 278
           PLD ++ RL  +   K +   + I  I K+     LI+ +        +   Y+G  P V
Sbjct: 152 PLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTV 211

Query: 279 MRVAPGQAVTFTAYEFIRKELE 300
           + + P   V+F A++ +   L+
Sbjct: 212 LGMIPYAGVSFFAHDLLHDVLK 233

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 83/223 (37%), Gaps = 45/223 (20%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRM----------------QIYKNAVGSGVKAPGFIKT 57
           L++G  AGL      +PLD ++VR+                +IYK    + +    +I  
Sbjct: 136 LVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPN 195

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL--------------ADKE 103
               + N     FY+G    V+G+ P   + F +++    +L               D E
Sbjct: 196 WFCHWCN-----FYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDE 250

Query: 104 TGKVS--------TGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNP-VEGAPKYKN 154
             +V         T    I+G  AG+             + RLQ   L+P      K+++
Sbjct: 251 LERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRR-RLQVSALSPKTMYDHKFQS 309

Query: 155 AVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLK 197
             +  + I KE G    + G+S+   +       +F VY ++K
Sbjct: 310 ISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 122/298 (40%), Gaps = 25/298 (8%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGFIKTGG 59
           +K+  SN A++ + GG +  +      P++ +K+ +Q     +  G    +  G +    
Sbjct: 4   TKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQ 63

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA-DKETG--KVSTGNTFIAG 116
              R EG ++F++G  A VI   P  A+ F+  +  + +    KE G  K   GN    G
Sbjct: 64  RTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGG 123

Query: 117 VGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSALYRGV 175
           +  G++            + RL A   +  +G  +  N +   Y   +  +G + LYRG 
Sbjct: 124 IAGGLS--LMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 176 SLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDT 234
             +       +G  F +Y   K   L G      + S+   L+G +       ++ PLDT
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASF---LLGWVVTTGASTASYPLDT 238

Query: 235 IKTRL-----QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
           ++ R+     Q  K    M  L++I       +  EG  +L+KG    ++R   G  V
Sbjct: 239 VRRRMMMTSGQAVKYKGAMDCLQKI-------VAAEGVSSLFKGCGANILRGVAGAGV 289

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 74/188 (39%), Gaps = 6/188 (3%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           +  + GV A + +            I+ Q + +       +YK  V       ++EG  +
Sbjct: 14  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIIS 73

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    ++K    G+  +E    W    +  G I+G +    
Sbjct: 74  FWRGNTANVIRYFPTQALNFAFKDQIKAMF-GFKKEEGYAKWFAGNLASGGIAGGLSLMF 132

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKR---ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
              LD  +TRL  D  +    G ++   +  + K+ I  +G   LY+G  P V+ +   +
Sbjct: 133 VYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYR 192

Query: 286 AVTFTAYE 293
            + F  Y+
Sbjct: 193 GLYFGLYD 200

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 78/197 (39%), Gaps = 15/197 (7%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG--VKAPGFIKTGGEIYRNEGFL 68
           A NL +GG AG +  +  + LD  + R+     +   G   +  G +    +   ++G  
Sbjct: 116 AGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVA 175

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG---ITEAX 125
             Y+G    VIGI     + F  Y+  + LL    TG +    +FIA    G    T A 
Sbjct: 176 GLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLL---TGSLE--GSFIASFLLGWVVTTGAS 230

Query: 126 XXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATN 185
                    + R+       V    KYK A+     IV  EG S+L++G      R    
Sbjct: 231 TASYPLDTVRRRMMMTSGQAV----KYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAG 286

Query: 186 QGANFTVYSKLKEFLQG 202
            G   ++Y +L+  L G
Sbjct: 287 AGV-ISLYDQLQMILFG 302

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 107/265 (40%), Gaps = 37/265 (13%)

Query: 29  HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGL-----------GAV 77
            PL+ +K  M   +N          F+++   ++   G L +Y+GL           GAV
Sbjct: 39  QPLEVVKTTMAANRNFT--------FLESVKHVWSRGGILGYYQGLIPWAWIEASTKGAV 90

Query: 78  VIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIR 137
           ++ ++ +   RF            K  G  +  +  + GV  G+T+A          K  
Sbjct: 91  LLFVSAEAEYRF------------KSLGLNNFASGILGGVTGGVTQAYLTMGFCTCMKTV 138

Query: 138 LQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF----TVY 193
              +H +   G    +++      I K+EG   + +GV+  A RQ TN G+ F     V 
Sbjct: 139 EITRHKSASAGGVP-QSSWSVFKNIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVE 197

Query: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR 253
             +++     +  + L  +E      + G +  + N P++ I+  +Q  K   N      
Sbjct: 198 DGIRKITGKTNKDDKLNPFEKIGASALGGGLSAW-NQPIEVIRVEMQSKKEDPNRPKNLT 256

Query: 254 ITIIGKQLIQEEGFRALYKGITPRV 278
           +    K + Q  G + LY+G+TPR+
Sbjct: 257 VGKTFKYIYQSNGLKGLYRGVTPRI 281

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLIS 221
           I+++EG   LYRG   TAAR A    A F   +  KE++ G  +     +W  + +  I 
Sbjct: 160 ILRDEGM-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQ-ATWGQNFVSSIF 217

Query: 222 GAIGPF-SNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280
           GA      +APLD IKTR+Q        SG    TI+ K  ++ EG  A +KG+TP+++ 
Sbjct: 218 GASASLIVSAPLDVIKTRIQSRNFESAESGF---TIV-KNTLKNEGATAFFKGLTPKLLT 273

Query: 281 VAPGQAVTF 289
             P    +F
Sbjct: 274 TGPKLVFSF 282

 Score = 31.2 bits (69), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 12/81 (14%)

Query: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQI--YKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69
           V+ I G  A L   +   PLD IK R+Q   +++A        GF      + +NEG  A
Sbjct: 213 VSSIFGASASL---IVSAPLDVIKTRIQSRNFESA------ESGFTIVKNTL-KNEGATA 262

Query: 70  FYKGLGAVVIGITPKMAIRFS 90
           F+KGL   ++   PK+   F+
Sbjct: 263 FFKGLTPKLLTTGPKLVFSFA 283

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 73/348 (20%), Positives = 128/348 (36%), Gaps = 69/348 (19%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYK--------------NAVGSGVKAPGFIKTGG 59
           +++ G   ++  L   P+D +++R+Q  +              NAV SG K   F   GG
Sbjct: 16  MLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAVSSGSKMKTFTNVGG 75

Query: 60  EIYRN-----------------------------------EGFLAFYKGLGAVVIGITPK 84
           +   N                                   EG  + ++G+   ++   P 
Sbjct: 76  QNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPA 135

Query: 85  MAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQA--QH 142
             + FS YE+ R +     T    T N    G  A +  A          K +LQ+  + 
Sbjct: 136 NMVYFSGYEYIRDVSPIAST--YPTLNPLFCGAIARVF-AATSIAPLELVKTKLQSIPRS 192

Query: 143 LNPVEGAPKYKNAVQACYTIVKEEGFS-ALYRGVSLTAARQATNQGANFTVYSKLKEFLQ 201
               +     K+ +      +K  G S AL++G+ +T  R        ++ Y   KE L 
Sbjct: 193 SKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERL- 251

Query: 202 GYHNQEMLPSWETSLI--------GLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNMS 249
            + +     S + + +        G ISG I      P D  KTR Q     +   K  +
Sbjct: 252 -WLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGN 310

Query: 250 GLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
             + +    + + + EG  ALY G+  RV+++ P  A+  ++YE  +K
Sbjct: 311 RSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKK 358

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 50/105 (47%), Gaps = 4/105 (3%)

Query: 2   ASKQKSSNPAVNLIAGGG-AGLMEGLCCHPLDTIKVRMQIY---KNAVGSGVKAPGFIKT 57
           ASK  +    +N  A G  +G++  +C HP D  K R QI     +    G ++    K 
Sbjct: 259 ASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKF 318

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK 102
              I+R EG  A Y GL A VI I P  AI  SSYE  + +  +K
Sbjct: 319 LETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFGNK 363

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 76/164 (46%), Gaps = 8/164 (4%)

Query: 141 QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
           Q L+    + K+   ++A   I   EG ++L+RG+SLT           F+ Y  +++  
Sbjct: 91  QELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDV- 149

Query: 201 QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNMSGLKRITI 256
                    P+      G I+      S APL+ +KT+LQ      KSTK    +K +  
Sbjct: 150 --SPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLN 207

Query: 257 IGKQLIQEEG-FRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
             +Q ++  G  RAL+KG+   + R  P  A+ +++YE  ++ L
Sbjct: 208 ETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERL 251

>Kwal_27.12481
          Length = 304

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 122/302 (40%), Gaps = 29/302 (9%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTG-G 59
           MA  +K SN AV+ + GG +  +      P++ +K+ +Q     +  G     +  TG G
Sbjct: 1   MADSKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRY--TGIG 58

Query: 60  EIYR----NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA-DKETG--KVSTGNT 112
           E ++    NEG  +F++G  A VI   P  A+ F+  +  + +    KE G  K   GN 
Sbjct: 59  ECFKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNL 118

Query: 113 FIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSAL 171
              G   G++            + RL A      +G  +  N +   Y   +  +G + L
Sbjct: 119 ASGGAAGGLS--LMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
           YRG   +       +G  F  Y  LK   L G      L S+   L+G         ++ 
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASF---LLGWAVTTGASTASY 233

Query: 231 PLDTIKTRL-----QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
           PLDT++ R+     Q  K        ++I       +  EG ++L+KG    ++R   G 
Sbjct: 234 PLDTVRRRMMMTSGQAVKYNGAFDAFRKI-------VAAEGIKSLFKGCGANILRGVAGA 286

Query: 286 AV 287
            V
Sbjct: 287 GV 288

>Scas_718.24
          Length = 337

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 123/295 (41%), Gaps = 15/295 (5%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG---VKAPGFIKT 57
           M++++  SN A++ + GG +  +      P++ +K+ +Q     +  G    K  G +  
Sbjct: 33  MSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDC 92

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET---GKVSTGNTFI 114
                + EG ++F++G  A VI   P  A+ F+  +  + +   K+    GK   GN   
Sbjct: 93  FRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLAS 152

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSALYR 173
            G   G++            + RL A   +  +G  +  N +   Y   +K +G + LYR
Sbjct: 153 GGAAGGLS--LLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYR 210

Query: 174 GVSLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPL 232
           G   +       +G  F +Y  +K   L G      L S+   L+G +        + PL
Sbjct: 211 GFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASF---LLGWVVTTGASTCSYPL 267

Query: 233 DTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
           DT++ ++    ++      K      K+++  EG  +L+KG    ++R   G  V
Sbjct: 268 DTVRRKMM--MTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 78/194 (40%), Gaps = 6/194 (3%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           +  + GV A + +            I+ Q + L       KYK  V       ++EG  +
Sbjct: 45  DFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIIS 104

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    K+K  + G+  ++    W    +  G  +G +    
Sbjct: 105 FWRGNTANVIRYFPTQALNFAFKDKIK-LMFGFKKEDGYGKWFAGNLASGGAAGGLSLLF 163

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKR---ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
              LD  +TRL  D  +    G ++   +  + K+ ++ +G   LY+G  P V+ +   +
Sbjct: 164 VYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYR 223

Query: 286 AVTFTAYEFIRKEL 299
            + F  Y+ I+  L
Sbjct: 224 GLYFGLYDSIKPVL 237

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 76/194 (39%), Gaps = 9/194 (4%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAV--GSGVKAPGFIKTGGEIYRNEGFL 68
           A NL +GG AG +  L  + LD  + R+     +   G   +  G I    +  +++G  
Sbjct: 147 AGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVA 206

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXX 128
             Y+G    V+GI     + F  Y+  + +L    TG +    +F+A    G        
Sbjct: 207 GLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLL---TGSLE--GSFLASFLLGWVVTTGAS 261

Query: 129 XXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188
                     +   +   + A KYK A      IV  EG ++L++G      R     G 
Sbjct: 262 TCSYPLDTVRRKMMMTSGQ-AVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

Query: 189 NFTVYSKLKEFLQG 202
             ++Y +L+  L G
Sbjct: 321 -ISMYDQLQMILFG 333

>Scas_717.20
          Length = 356

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 131/332 (39%), Gaps = 61/332 (18%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQI----YKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           +AGG +G        PLD IK+  Q     Y    GS V   G  +    I+ N+G   F
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLV---GLKEAAKHIWLNDGIRGF 93

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYR-TLLADKETGKVSTGNTFIAGVGAGITEAXXXXX 129
           ++G    ++ I P  A++F +YE  R TL+  KE    S     ++G  AG+        
Sbjct: 94  FQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYE--SHWRRLMSGSLAGLCSVFTTYP 151

Query: 130 XXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSAL----------------YR 173
                 IR++  ++       K  + +    TI KE   + L                YR
Sbjct: 152 LDL---IRVRLAYVT----EHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYR 204

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQG---------------------YHNQEMLPSW 212
           G + T        G +F  +  L + L+                       H +  L +W
Sbjct: 205 GYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTW 264

Query: 213 ETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGL-----KRITIIGKQLIQEEGF 267
              L G ++G     +  P + I+ RLQ   ST ++S +     + I+ I K + +E G+
Sbjct: 265 AELLSGGLAGMASQTAAYPFEIIRRRLQ--VSTLSVSQMYDHRFQSISEIAKIIYKERGW 322

Query: 268 RALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           R  + G++   ++V P  A +F  YE ++  L
Sbjct: 323 RGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 20/202 (9%)

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAV----QACYTIVKEEGFSA 170
           +G+  GI+ +          +I++  Q  NP     KY  ++    +A   I   +G   
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNP--HYTKYAGSLVGLKEAAKHIWLNDGIRG 92

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230
            ++G S+T  R        F  Y +++  L    ++E    W   + G ++G    F+  
Sbjct: 93  FFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIP--SKEYESHWRRLMSGSLAGLCSVFTTY 150

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQ----LIQEEGFRA--------LYKGITPRV 278
           PLD I+ RL      K +S L  +  I K+     ++ +G+           Y+G TP V
Sbjct: 151 PLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTV 210

Query: 279 MRVAPGQAVTFTAYEFIRKELE 300
           + + P   V+F A++ +   L+
Sbjct: 211 LGMIPYAGVSFFAHDLLHDVLK 232

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 88/226 (38%), Gaps = 45/226 (19%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRM----------------QIYKNAVGSGVKAPGFIKT 57
           L++G  AGL      +PLD I+VR+                 IYK    + ++A G+I  
Sbjct: 135 LMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPN 194

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYR-----------TLLADKETGK 106
               + N     FY+G    V+G+ P   + F +++              ++LA  E+ +
Sbjct: 195 WFAHWCN-----FYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQ 249

Query: 107 -----------VSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAP-KYKN 154
                      + T    ++G  AG+             + RLQ   L+  +    ++++
Sbjct: 250 EERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRR-RLQVSTLSVSQMYDHRFQS 308

Query: 155 AVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
             +    I KE G+   + G+S+   +       +F VY ++K  L
Sbjct: 309 ISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGS--GVKAPGFIKTGGEIYRNEGFLAF 70
            L++GG AG+      +P + I+ R+Q+   +V      +     +    IY+  G+  F
Sbjct: 266 ELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGF 325

Query: 71  YKGLGAVVIGITPKMAIRFSSYE 93
           + GL    I +TP +A  F  YE
Sbjct: 326 FVGLSIGYIKVTPMVACSFFVYE 348

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 124/312 (39%), Gaps = 28/312 (8%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60
           M S++  S   +  +AG  +G+ +    HP DT+KVR+Q  +   G+G++  G +    +
Sbjct: 1   MVSEETYSR-VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYK 59

Query: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVSTGNTFIAGV 117
             +N+G    Y G    + G     +    S   YR LL      E  K+      I+GV
Sbjct: 60  TLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119

Query: 118 GAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE--------EGFS 169
            AG T            K +LQ Q+        KY   +     + K+         G  
Sbjct: 120 MAGWT-VSFIAAPVELAKAKLQVQY---DAKTTKYTGPIDVVQKVFKQGMATNGILGGVR 175

Query: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFL-QGYHNQEMLPSWETSLI-GLISGAIGPF 227
           +LY+G+  T   +     +NF  +    E + Q +     L +   +   G +S + G +
Sbjct: 176 SLYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW 230

Query: 228 SNA-PLDTIK-TRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
           ++A P D +K   L  DK   +    +        + ++ G    +KG  P  +R  P  
Sbjct: 231 TSAYPSDVVKQVVLCNDKYDGSFKSWRTAV---SDIYRQRGIHGFFKGFLPSFLRSFPAN 287

Query: 286 AVTFTAYEFIRK 297
           A    A+EF+ +
Sbjct: 288 AAALAAFEFVLR 299

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 113/284 (39%), Gaps = 29/284 (10%)

Query: 29  HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI--YRN----EGFL-AFYKGLGAVVIGI 81
           H LDT+K R Q           APG +K    I  YR     EG     Y G GA ++G 
Sbjct: 72  HSLDTVKTRQQ----------GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGS 121

Query: 82  TPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQ 141
            P  A+ F +YE+ +  + ++     +  +     +G   +            +++LQ  
Sbjct: 122 FPSAAVFFGTYEWVKRQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGC 181

Query: 142 HLN-PVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEF- 199
           + N   +    Y+    A  TIV+ EG SAL+ G   T +R        F  Y + +++ 
Sbjct: 182 YNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWA 241

Query: 200 --LQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK----DKSTKNMSGLKR 253
             L+       L      + G  +G +      PLD +KTR+Q        T + S   R
Sbjct: 242 FLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPAR 301

Query: 254 I--TIIGKQLI--QEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
           +  +I    L+  + EG    + G+ PR +  +   ++    Y+
Sbjct: 302 LNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQ 345

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
            ++ G  AG + G+   PLD +K R+Q           A    +  G I+R+   +  Y+
Sbjct: 258 EVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYE 317

Query: 73  GLGAVVIGITPKM 85
           GLG    G+ P+ 
Sbjct: 318 GLGGAFSGVGPRF 330

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 232 LDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFR-ALYKGITPRVMRVAPGQAVTFT 290
           LDT+KTR Q           + +    + L  EEG R  LY G    ++   P  AV F 
Sbjct: 74  LDTVKTRQQGAPGEVKY---RHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFG 130

Query: 291 AYEFIRKEL 299
            YE++++++
Sbjct: 131 TYEWVKRQM 139

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 118/285 (41%), Gaps = 44/285 (15%)

Query: 13  NLIAGGGAGLMEGLCC-HPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71
           N++ G G  + E      PL+ IK  M        +  ++  F      ++   G   FY
Sbjct: 20  NILLGAGLNMCEVTTLGQPLEVIKTTM--------AANRSFSFFNAIKHVWSRGGVFGFY 71

Query: 72  KGL-----------GAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120
           +GL           GAV++ ++ +     S Y+F R  L++        G+  + GV  G
Sbjct: 72  QGLIPWAWIEASTKGAVLLFVSAE-----SEYQFKRMGLSN-------FGSGIMGGVTGG 119

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
           + +A          K     +  +   GA   +++  A   I K++G   + +GV+  A 
Sbjct: 120 VAQAYLTMGFCTCMKTVEITKKKSAGAGAIP-QSSWGAFKEIYKKDGIKGINKGVNAVAI 178

Query: 181 RQATNQGANFTVYSKLKEFLQGYHN-------QEMLPSWETSLIGLISGAIGPFSNAPLD 233
           RQ TN G+ F  +S+L E  +G  N        + L + E      I G +  + N P++
Sbjct: 179 RQMTNWGSRFG-FSRLVE--EGIRNATGKTNPDDKLTALEKIAASAIGGGLSAW-NQPIE 234

Query: 234 TIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
            I+  +Q  K   N      ++   K + Q  G + LY+G+ PR+
Sbjct: 235 VIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAPRI 279

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 125/315 (39%), Gaps = 53/315 (16%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +LI G   GL   +   PLD +K R Q  K   G+  +    + T  +++R     A   
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQQTKG--GTLWQTVKSLDTPWQLWRGTLPSAIRT 64

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXX------ 126
            +G+         A+  SS    RT LA ++  +  T ++ + G  + + +         
Sbjct: 65  SVGS---------ALYLSSLNLMRTALAKRK--QFDTADSVVTGKSSNLPQLSMYENLVT 113

Query: 127 ----------XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVS 176
                             K+R ++   N       YK+  +A  +I  +EG    +RG  
Sbjct: 114 GAFARGTVGYITMPITIIKVRYESTLYN-------YKSIAEAAKSIAAQEGIRGFFRGFG 166

Query: 177 LTAARQATNQGANFTVYSKLKEFLQGYHNQEML--------PSWETSLI----GLISGAI 224
            T  R A   G    +Y KLK  L     + +L         ++ ++ I     ++S ++
Sbjct: 167 PTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASM 226

Query: 225 GPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPG 284
                AP DTIKTR+Q +  TK  +    +T I   + QE   + ++ G++ R+ R A  
Sbjct: 227 ATTVTAPFDTIKTRMQLEP-TKFKTFWSTLTTI---VTQEHPIK-IFSGLSMRLTRKALS 281

Query: 285 QAVTFTAYEFIRKEL 299
             + +  YE + K  
Sbjct: 282 AGIAWGIYEELIKHF 296

>Kwal_33.15446
          Length = 305

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 124/321 (38%), Gaps = 49/321 (15%)

Query: 1   MASKQKSS----NPAVNLIAGGGAGLMEGLC----CHPLDTIKVRMQIYKNAVGSGVKAP 52
           M+S+  S+    N A + + G  +G+  G+      HP DTIKVR+Q  ++      K P
Sbjct: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDT--GRFKGP 58

Query: 53  GFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVST 109
             +    +  R +G   FY G    ++G     ++       YR LL     +   K+  
Sbjct: 59  --LDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL 116

Query: 110 GNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFS 169
               ++GV AG +            K +LQ Q+        +Y+  +     +   +G  
Sbjct: 117 SGCILSGVLAGWS-VSFIAAPVELAKAKLQVQY---DAQTTRYRGPLDVIKKVYAADGIR 172

Query: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSW--------ETSL---IG 218
            +Y+G+  T   +                F+  + + E+L  W        +T++    G
Sbjct: 173 GMYKGLVSTLIFRT--------------HFVYWWGSYELLTRWFKANTNLSDTAINFWAG 218

Query: 219 LISGAIGPFSNA-PLDTIK-TRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP 276
             S + G ++ A P D IK   L  DK   ++   +        + +  G R  +KG  P
Sbjct: 219 GFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWRNA---ASDIWRTRGIRGFFKGFVP 275

Query: 277 RVMRVAPGQAVTFTAYEFIRK 297
             +R  P  A    ++EF+ +
Sbjct: 276 SFLRSFPANAAALASFEFVLR 296

>Scas_669.6
          Length = 373

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 116/306 (37%), Gaps = 46/306 (15%)

Query: 29  HPLDTIKVRMQ------IYKNAVGSGVKAPGFIKTGGEIYRNEGFL-AFYKGLGAVVIGI 81
           H LDT+K R Q       YKN   +        +T   I+  EG     Y G  A ++G 
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKNMTTA-------YRT---IFLEEGIARGLYGGYFAAMLGS 119

Query: 82  TPKMAIRFSSYEFY-RTLLADKETGKVSTGNTFIAGV-GAGITEAXXXXXXXXXXKIRLQ 139
            P  AI F +YE+  R ++ D   G   T +   AG+ G  ++            +++LQ
Sbjct: 120 FPSAAIFFGTYEWCKRKMIGD--LGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQ 177

Query: 140 AQHLNPV-EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKE 198
            +  NP  +    Y++   A   IV  EG  AL+ G   T AR        F  Y K ++
Sbjct: 178 GRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQ 237

Query: 199 FLQGYHNQEM----LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRI 254
                  +++    L        G I+G +      P+D IKTRLQ  ++  N +    +
Sbjct: 238 TAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTV 297

Query: 255 TIIG--------------------KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294
             I                     K + Q EG    + G+ PR +  +   ++    Y+ 
Sbjct: 298 GAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQM 357

Query: 295 IRKELE 300
             + L 
Sbjct: 358 TLRLLN 363

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/105 (20%), Positives = 42/105 (40%), Gaps = 19/105 (18%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG-------------------VKAPGF 54
           +  G  AG + G+   P+D IK R+Q  +  +                      V +   
Sbjct: 258 IFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSI 317

Query: 55  IKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
            ++   +Y++EG + F+ G+G   +  + + +I    Y+    LL
Sbjct: 318 FRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLL 362

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 120/274 (43%), Gaps = 34/274 (12%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           PLD +K R+Q+      S ++  GF K    I  NEG+   Y G GA  +G + + A ++
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQ--GFRK----IIANEGWKKVYTGFGATFVGYSLQGAGKY 91

Query: 90  SSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGA 149
             YE+++ L +      +S G T +  + +   E            I+++ Q   P    
Sbjct: 92  GGYEYFKHLYSS----WLSPGVT-VYLMASATAEFLADIMLCPFEAIKVKQQTTMP---- 142

Query: 150 PKYKNAVQACYTIVKEE-GFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY---HN 205
           P   N V     +  E  G  A Y+G+     RQ       FT + K+ + +        
Sbjct: 143 PFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKK 202

Query: 206 QEM--LPSWETSLI-GLISGAIGPFSNAPLDTIKTRLQKD-KSTKNMSGLKRITIIGKQL 261
           +EM  L     S + G ++G +    + P D + +++  + K+ ++MS      +  K++
Sbjct: 203 EEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMS------VASKRI 256

Query: 262 IQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
            Q+ GF  L+ G+  R++ +      T T+++++
Sbjct: 257 YQKIGFTGLWNGLMVRIVMIG-----TLTSFQWL 285

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 69/181 (38%), Gaps = 45/181 (24%)

Query: 135 KIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYS 194
           K RLQ   +NP      Y + +Q    I+  EG+  +Y G            GA F  YS
Sbjct: 43  KCRLQ---VNP----KLYTSNLQGFRKIIANEGWKKVYTGF-----------GATFVGYS 84

Query: 195 KLKEFLQGY-------HNQEMLPSWETS--LIGLISGAIGPFSN----APLDTIKTRLQK 241
                LQG        + + +  SW +    + L++ A   F       P + IK + Q 
Sbjct: 85  -----LQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQT 139

Query: 242 DK---STKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
                    + G K      K   +  G +A YKGI P   R  P     FT++E I ++
Sbjct: 140 TMPPFCNNVVDGWK------KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQK 193

Query: 299 L 299
           +
Sbjct: 194 I 194

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 77/191 (40%), Gaps = 24/191 (12%)

Query: 102 KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAV-QACY 160
           K+  K  +   FIAG  AG   +          KI LQ Q          Y + +  A  
Sbjct: 4   KQLAKQESSIAFIAGGVAGAV-SRTVVSPFERVKILLQVQ-----SSTSAYNHGIINAVG 57

Query: 161 TIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL---QGYHNQEMLPSWETSLI 217
            + KEEG + L+RG  L   R        F VY   K+ +    G   +E L +W+    
Sbjct: 58  QVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSA 117

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR------------ITIIGKQLIQEE 265
           G + G +   +  PLD ++TRL     T N++ L +              ++ K   +E 
Sbjct: 118 GALCGGMSVLATYPLDLVRTRL--SIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEG 175

Query: 266 GFRALYKGITP 276
           G R LY+GI P
Sbjct: 176 GIRGLYRGIYP 186

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 3  SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62
          +KQ+SS   +  IAGG AG +      P + +K+ +Q+  +   +     G I   G++Y
Sbjct: 7  AKQESS---IAFIAGGVAGAVSRTVVSPFERVKILLQVQSS---TSAYNHGIINAVGQVY 60

Query: 63 RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYR 96
          + EG    ++G G   + I P  A++F  YE+ +
Sbjct: 61 KEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK 94

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMS-GLKRITIIGKQLIQEEGFRALYKGITP 276
           G ++GA+     +P + +K  LQ   ST   + G+  I  +G Q+ +EEG   L++G   
Sbjct: 18  GGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGI--INAVG-QVYKEEGVAGLFRGNGL 74

Query: 277 RVMRVAPGQAVTFTAYEFIRKEL 299
             +R+ P  AV F  YE+ +K +
Sbjct: 75  NCVRIFPYSAVQFVVYEWCKKHI 97

>Scas_687.15*
          Length = 328

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 124/329 (37%), Gaps = 57/329 (17%)

Query: 6   KSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG-VKAPGFIKTGGEIYRN 64
           K ++  + ++AG  A + E    +P + +K   Q+++  VG+   +A   IK        
Sbjct: 4   KQTDVPIQILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKPFEALRPIK-------- 55

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVST---GNTFIAGVGAGI 121
                ++ G  A+ +    K ++RF++++    +L D    K S        +AG+  G 
Sbjct: 56  ----VYFAGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGA 111

Query: 122 TEAXXXX----XXXXXXKIRLQAQHLNPVE---------------GAPKY---------- 152
            E+              +  LQ     P E                 PK           
Sbjct: 112 VESLCIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQV 171

Query: 153 --KNAVQACYTIVKE----EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQ 206
             K      +++VKE     G     +G   T  RQ +N    FT Y+ LK+ +      
Sbjct: 172 YSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPL 231

Query: 207 EMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEG 266
             + ++    IGL S         P+D +KTR+Q   S       K       ++  EEG
Sbjct: 232 NEVYAFG---IGLFSSCAVVALTQPIDVVKTRMQ---SKTAHYFYKNSLNCAYRVFVEEG 285

Query: 267 FRALYKGITPRVMRVAPGQAVTFTAYEFI 295
             +L+KG  PR+ +V     ++F  Y+++
Sbjct: 286 MVSLWKGWLPRLFKVGLSGGISFGVYQYV 314

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 98/242 (40%), Gaps = 25/242 (10%)

Query: 70  FYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG--------NTFIAGVGAGI 121
            Y+GLG  ++G +   A+ F  Y   + +       + +TG        + ++   G+  
Sbjct: 65  LYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSG 124

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181
                        K R+ A        A  YK+     Y + + EG  A +RGV    + 
Sbjct: 125 IATAVLTNPIWVIKTRIMA-----TSRAGPYKSTFDGVYKLYQTEGVLAFWRGV--VPSL 177

Query: 182 QATNQGA-NFTVYSKLK-EFLQGYHNQEMLPSWETSLIGL--ISGAIGPFSNAPLDTIKT 237
              +QGA  F +Y  LK  +L    ++       + +IG+  IS  I   S  P   +K+
Sbjct: 178 LGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKS 237

Query: 238 RLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
           +LQ      +      IT + + +   EG R  Y+G++  ++R  P   +TF  YE I+ 
Sbjct: 238 KLQ------DFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIKY 291

Query: 298 EL 299
            L
Sbjct: 292 RL 293

>Scas_696.9
          Length = 312

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 68/139 (48%), Gaps = 14/139 (10%)

Query: 148 GAPKYKNAVQACYTIVK----EEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY 203
           GAP     VQ+ + + +    +EG   +Y+GV+  A RQ TN G+ F     ++++++  
Sbjct: 147 GAP-----VQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKA 201

Query: 204 HN----QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
                 ++ L +WE      + G +  + N P++ I+  +Q  K   N      +    K
Sbjct: 202 TGKTKPEDRLNAWEKIGATAVGGGLSAW-NQPIEVIRVEMQSKKEDPNRPKNLTVAKTFK 260

Query: 260 QLIQEEGFRALYKGITPRV 278
            +++  G + LY+G+TPR+
Sbjct: 261 YIMKTNGVKGLYRGVTPRI 279

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 115/298 (38%), Gaps = 28/298 (9%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           ++AG  +GL+      P+DT+K+R Q+    + S  K  G + T   + R EG  A +KG
Sbjct: 28  VVAGSVSGLVARSVTAPMDTVKIRRQL---QLASEHKYHGILHTFRTVAREEGVRALWKG 84

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXX 133
                       +++F +Y +  T  A    G     ++   G  AG+  +         
Sbjct: 85  NVPASAMYVLYGSLQFGTYAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLL 142

Query: 134 XKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVY 193
            + RL A        +  + +  +    I   EG +  +RG +   A      G  F +Y
Sbjct: 143 -RTRLVANR------SAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIY 195

Query: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ-----------KD 242
                    Y     LP W  +     +G +   +  PLDT++ RLQ           +D
Sbjct: 196 ETCTIAADTYG----LP-WLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRD 250

Query: 243 KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
               +     R   +   +++ EG  +LYKG+T  + +  P   +T   Y+   + LE
Sbjct: 251 PGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLE 308

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQI--------YKNAVG--SGVKAPGFIKTGG 59
           P +   A   AGL+      PLDT++ R+QI        +    G  S ++   F+    
Sbjct: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE 93
            + R EG  + YKGL   +   TP   I    Y+
Sbjct: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 82/203 (40%), Gaps = 25/203 (12%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           A +L  G  AGL+  L  +PLD ++ R+   ++A    ++     +    I+  EG   F
Sbjct: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLR-----RQARVIWDTEGPAGF 173

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVG---AGITEAXXX 127
           ++G    +   T    + F  YE   T+ AD      + G  ++A      AG+      
Sbjct: 174 FRGGAWAIAATTLTTGLIFGIYETC-TIAAD------TYGLPWLAAAASPTAGLVSKAAV 226

Query: 128 XXXXXXXKIRLQ---AQHLNPVEGAPKYKNAVQA------CYTIVKEEGFSALYRGVSLT 178
                  + RLQ   A+H+      P   +A++          +V+ EG ++LY+G+++ 
Sbjct: 227 FPLDTVRR-RLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMA 285

Query: 179 AARQATNQGANFTVYSKLKEFLQ 201
             +          VY +    L+
Sbjct: 286 LCKSTPTTVITLWVYQRCLRLLE 308

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 119/324 (36%), Gaps = 58/324 (17%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           ++IAG  A + +    HP + +K   Q+++   G+                   F  ++ 
Sbjct: 23  SVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAA-----------FNMLHPFKYYFS 71

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGK--VSTGNTFIAGVGAGITEAXXXXXX 130
           G  A+ +G   K   RF+++E     L D E     ++     +AG   G  E+      
Sbjct: 72  GCAALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVVPF 131

Query: 131 XXXXKIRLQ-AQHLNP-VEGAPKYKNA-----------------VQACYT---------- 161
                  ++ A  L+  V+G P+ + A                 VQ  +           
Sbjct: 132 ESIKTTAVENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERWLLHYERQP 191

Query: 162 ----------IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS 211
                     I +  G     +G   T  RQ  N    FT Y+ +   +Q     + L  
Sbjct: 192 SSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWI---VQSLSPHKALDE 248

Query: 212 WETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALY 271
           ++    G +S A       P+D IKTR+Q   S       K       ++  EEGFR ++
Sbjct: 249 YQAFAAGALSSAAVVALTQPIDVIKTRMQ---SKTAWFTYKSSLNCAYRIFVEEGFRYMW 305

Query: 272 KGITPRVMRVAPGQAVTFTAYEFI 295
           KG  PR+ +V+    ++F  Y+++
Sbjct: 306 KGWVPRLFKVSLSGGISFGVYQYV 329

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 63/158 (39%), Gaps = 9/158 (5%)

Query: 54  FIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTF 113
           F  T  EIYR  G   F +G    +        +RF++Y +    L+  +   +     F
Sbjct: 195 FAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKA--LDEYQAF 252

Query: 114 IAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYR 173
            AG  +               K R+Q++          YK+++   Y I  EEGF  +++
Sbjct: 253 AAGALSS-AAVVALTQPIDVIKTRMQSK-----TAWFTYKSSLNCAYRIFVEEGFRYMWK 306

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGY-HNQEMLP 210
           G      + + + G +F VY  ++  +  + H + + P
Sbjct: 307 GWVPRLFKVSLSGGISFGVYQYVENLVLLWEHERSLAP 344

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 117/324 (36%), Gaps = 59/324 (18%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73
           ++AG  A + +    +P + +K  +Q++++           +           F  ++ G
Sbjct: 98  IVAGSCASVFQTTISYPFEFLKTGLQLHRS-----------LPNAHPFNMMHQFKYYFSG 146

Query: 74  LGAVVIGITPKMAIRFSSYEFYRTLLADKETGK--VSTGNTFIAGVGAGITEAXXXXXXX 131
             A+ +G   K   RF+++E    LL D  +    +S     +AG   G  E+       
Sbjct: 147 CAALNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFE 206

Query: 132 XXXKI----------RLQAQHLNPVEGAPKYKNAVQACY--------------------- 160
                          R Q +  +  +     K  V+A +                     
Sbjct: 207 NIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHP 266

Query: 161 -----TIVKE----EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS 211
                + VKE     G     +G + T  RQ  N    FT Y+ LK+ +      + L  
Sbjct: 267 TSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISP---NKPLNE 323

Query: 212 WETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALY 271
           +   ++G IS         P+D IKTR+Q   +  N    K       ++  EEG    +
Sbjct: 324 YYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANY---KNSLNCAYRIFVEEGIPKFW 380

Query: 272 KGITPRVMRVAPGQAVTFTAYEFI 295
           KG  PR+M+V     V+F  Y+++
Sbjct: 381 KGWAPRLMKVGLSGGVSFGVYQYV 404

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 64/158 (40%), Gaps = 12/158 (7%)

Query: 54  FIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTF 113
           F  T  EIY   G   F +G    +       A+RF++Y   + L++  +       N +
Sbjct: 270 FFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPL-----NEY 324

Query: 114 IAGVGAGITEAXXXXXXX--XXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSAL 171
            A V   I+              K R+Q+++         YKN++   Y I  EEG    
Sbjct: 325 YAFVLGFISSCAVVAVTQPIDVIKTRMQSKY-----AWANYKNSLNCAYRIFVEEGIPKF 379

Query: 172 YRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEML 209
           ++G +    +   + G +F VY  ++  ++   +++ L
Sbjct: 380 WKGWAPRLMKVGLSGGVSFGVYQYVENLIKLMAHEKQL 417

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/344 (21%), Positives = 133/344 (38%), Gaps = 54/344 (15%)

Query: 1   MASKQKSSNP----AVNLI-----AGGGAGLMEGLCCHPLDTIKVRMQI----YKNAVGS 47
           M+ +Q+ S P    +V+ I     AGG AG        PLD IK+  Q     +    GS
Sbjct: 1   MSGRQRGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGS 60

Query: 48  GVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKV 107
                G ++    I  ++G   F++G  A ++ I P  AI+F +YE  R+++      + 
Sbjct: 61  ---MGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHE- 116

Query: 108 STGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYK-----------NAV 156
           S     ++G  AG+              +R++  ++     A   K            A+
Sbjct: 117 SHWRRLLSGSLAGLCSVFVTYPLDL---VRVRLAYVTERHDAKVRKIMACIYNERPSEAL 173

Query: 157 QACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQ--------------- 201
           +  Y       +S  YRG + T        G +F  +   ++  +               
Sbjct: 174 RKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGS 233

Query: 202 -GYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNMSGLKRITI 256
             Y     L +W   + G ++G     +  P + I+ RLQ     D + ++  G+     
Sbjct: 234 SAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINE--- 290

Query: 257 IGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           I K +  E G+R  + G++   ++V P  A +F  YE  +  L+
Sbjct: 291 IAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYLQ 334

>Scas_715.45
          Length = 305

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/275 (20%), Positives = 113/275 (41%), Gaps = 29/275 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           PLD IK R+Q+      S     G I    +I + EG    + G+GA  IG + + A ++
Sbjct: 36  PLDLIKCRLQVDPTLYRSNTS--GII----QILKKEGLGKLFTGVGATCIGYSLQGAGKY 89

Query: 90  SSYEFYRTLLAD---KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPV 146
             YE ++ L +    K+        T I  + +   E            I+++ Q   P 
Sbjct: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMP- 148

Query: 147 EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG---Y 203
              P   N ++    +  +EG +  Y+G++    RQ       FT + ++ E +      
Sbjct: 149 ---PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPT 205

Query: 204 HNQEM--LPSWETSLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260
              EM  L     S + G ++G +    + P D + +++  ++        + + +  K+
Sbjct: 206 KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-----ESMNVALKR 260

Query: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295
           +    GF  L+ G+  R++ +      T T+++++
Sbjct: 261 IYSRIGFVGLWNGLPVRILMIG-----TLTSFQWL 290

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 223 AIGPFSNA--PLDTIKTRLQKDKST--KNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278
           A GP  ++  PLD IK RLQ D +    N SG+        Q++++EG   L+ G+    
Sbjct: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI-------IQILKKEGLGKLFTGVGATC 78

Query: 279 MRVAPGQAVTFTAYEFIRK 297
           +  +   A  +  YE  ++
Sbjct: 79  IGYSLQGAGKYGGYELFKR 97

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 101/241 (41%), Gaps = 29/241 (12%)

Query: 53  GFIKTGGEIYRNEGFLAFYKGL-----------GAVVIGITPKMAIRFSSYEFYRTLLAD 101
           GF +    ++   G   FY+GL           GAV++ ++ +     + Y+F R  L++
Sbjct: 52  GFSQAVRHVWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAE-----AEYQFRRLGLSN 106

Query: 102 KETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXK-IRLQAQHLNPVEGAPKYKNAVQACY 160
              G        + GV  G+ +A          K + +         G P   +++Q   
Sbjct: 107 FGAG-------ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVP-VPSSLQVFK 158

Query: 161 TIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY---HNQEMLPSWETSLI 217
            I   EG   + +GV+  A RQ TN G+ F +   +++ ++      + E L + E  + 
Sbjct: 159 QIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVA 218

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
             + G +  + N P++ I+  +Q   +  N      +    + + +  G R LY+G+TPR
Sbjct: 219 SALGGGLSAW-NQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPR 277

Query: 278 V 278
           +
Sbjct: 278 I 278

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 56/154 (36%), Gaps = 12/154 (7%)

Query: 28  CHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAI 87
           C  + T+++     K A   GV  P  ++   +I+  EG     KG+ AV I        
Sbjct: 129 CTCMKTVEITRS--KAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGS 186

Query: 88  RFSSYEFY----RTLLADKETGKVSTGNTFIA-GVGAGITEAXXXXXXXXXXKIRLQAQH 142
           RF          R +   +   K+S     +A  +G G++             IR++ Q 
Sbjct: 187 RFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGLSAWNQPIEV-----IRVEMQS 241

Query: 143 LNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVS 176
                  PK     +    I +  G   LYRGV+
Sbjct: 242 RTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVT 275

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 76/179 (42%), Gaps = 17/179 (9%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGG-- 59
           +   K  N AVN+ AG  +G++  +   PL  +K RMQ Y NA+  G +      + G  
Sbjct: 121 SDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLA 180

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG----NTFIA 115
            I++ EG L  ++G+ A ++      +++   Y   +  L   +  K  T     ++ + 
Sbjct: 181 TIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVT 240

Query: 116 GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
           G+G GI               R+  Q  N       YK  +   +  +K EG  ALY+G
Sbjct: 241 GLGVGIVMNPWDVVLT-----RVYNQKGN------TYKGPIDCMFKTIKIEGIGALYKG 288

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 119/305 (39%), Gaps = 46/305 (15%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQ-----------IYKNAVGSGVKAPGFIKTGGEI 61
           + IAGG A  +     +P + +K RMQ           IY+N            +  G I
Sbjct: 26  SFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNP----------FQALGVI 75

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL-----ADKETGKV-STGNTFIA 115
           ++NEG     +GL +  +        R   YE  RT+L      + +  K+ +      A
Sbjct: 76  FKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTA 135

Query: 116 GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEEGFSALYR 173
           G  +GI  A          K R+Q+ + N ++   +  Y +      TI K+EG   L+R
Sbjct: 136 GATSGIIGAIVGSPLFLV-KTRMQS-YSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFR 193

Query: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEM-----LPSWETSLIGLISGAIGPFS 228
           GV     R          +Y+  K FL    N  M     L    +++ GL    +G   
Sbjct: 194 GVDAAILRTGAGSSVQLPIYNTTKNFL--LQNDIMKEGTALHLLSSTVTGL---GVGIVM 248

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVT 288
           N P D + TR+   K       +  +     + I+ EG  ALYKG   ++ R+AP   + 
Sbjct: 249 N-PWDVVLTRVYNQKGNTYKGPIDCMF----KTIKIEGIGALYKGFGAQLFRIAPHTILC 303

Query: 289 FTAYE 293
            T  E
Sbjct: 304 LTFME 308

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 115/278 (41%), Gaps = 27/278 (9%)

Query: 41  YKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA 100
           ++N      K  G ++   +I + EG    ++G+   ++   P   + F+ YE+ R    
Sbjct: 100 FQNLNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVR---- 155

Query: 101 DKE--TGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAP--KYKNAV 156
           D+    G   T N  I G  A  T A          K +LQ+   + ++      Y++  
Sbjct: 156 DRSPLNGLYPTINPLICGAFAR-TLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLF 214

Query: 157 QACYTIVKEEGFS-ALYRGVSLTAARQATNQG---ANFTVYSKLKEFLQGYHNQEMLPSW 212
               + +   G +  +++G+ +T  R         A++  Y     +L      +   +W
Sbjct: 215 NEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNW 274

Query: 213 ----ETSLIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNMSGLK---RITIIG--K 259
                + L G ISG++      P D  KTR Q     DK   N S LK     T+ G   
Sbjct: 275 FHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLAN-SNLKYGSSNTMFGFLN 333

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297
            + + EG  ALY G+ PRV ++AP  A+  ++YE  ++
Sbjct: 334 YIRKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKR 371

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 72/156 (46%), Gaps = 12/156 (7%)

Query: 151 KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEF--LQGYHNQEM 208
           K+   ++A   I K EG + L+RG+S+T           FT Y  +++   L G +    
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGLY---- 164

Query: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQK--DKSTKNMSGLKRITIIG--KQLIQE 264
            P+    + G  +  +   S APL+ IKT+LQ     S KN S +    +    K  I  
Sbjct: 165 -PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAM 223

Query: 265 EGF-RALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
            G  + ++KG+   + R  P  A+ + +YEF + ++
Sbjct: 224 RGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKV 259

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 41/97 (42%), Gaps = 13/97 (13%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIY----KNAVGSGVK------APGFIKTGGEIY 62
           + + G  +G +  +C HP D  K R QI     K    S +K        GF+     I 
Sbjct: 280 SFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFL---NYIR 336

Query: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
           + EG  A Y GL   V  I P  AI  SSYE  + L 
Sbjct: 337 KTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

>Kwal_27.11419
          Length = 298

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 126/314 (40%), Gaps = 53/314 (16%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           + I G   GL   +   P D +K R+Q  +N   + +     I+T G++++     A   
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQ--QNKSSNLLDVVRSIETPGQLWKGTLPSALRT 67

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGN---TFIAG-------VGAGIT 122
            +G+         A+  S+    R+ +ADK    ++  N   +F+         +   IT
Sbjct: 68  SVGS---------ALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAIT 118

Query: 123 EAXX--XXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
            A            K+R ++   N       YK+  +A   I + EG   L+ G   T  
Sbjct: 119 RAAVGVATMPITVLKVRFESTMYN-------YKSLGEAATHIYRSEGIRGLFSGCGATVM 171

Query: 181 RQATNQGANFTVYS----KLKEFLQGY---HNQEMLPSWETSLIGLISGAIGPFSNA--- 230
           R A   G     Y     +L   L  +   HN+  + S +TS    I  +I  FS+A   
Sbjct: 172 RDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTS---TIINSIAAFSSASLA 228

Query: 231 -----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
                P DTIKTR+Q + S     G  +     K +I+ E  R L+ G++ R+ R A   
Sbjct: 229 TTITSPFDTIKTRMQLNPS--QYYGFIQTF---KSIIRYERPRNLFDGLSLRLSRKALSA 283

Query: 286 AVTFTAYEFIRKEL 299
            + +  YE + K+ 
Sbjct: 284 GIAWGIYEELVKKF 297

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 125/297 (42%), Gaps = 48/297 (16%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGL 74
           IAG   G       +PL TI   +Q  +N      +A   ++T  EIY   G + ++ GL
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKEN------EARPKLETIKEIYNKNGIIGYFLGL 69

Query: 75  GAVVIGITPKMAIRFSSYEFY----RTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXX 130
            + V G+     + +  YE+     RTL   +    +ST  + +A   AG   A      
Sbjct: 70  ESAVYGMATTNFVYYYFYEWCAKTARTLTTKQY---LSTWESILASTIAGSMTA-VASNP 125

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
                 R+     N         + ++    IVK +G   L  G+   A    +N    +
Sbjct: 126 IWVANTRMTVAKSN--------HSTLRTVIDIVKTDGPLTLLNGLK-PALVLVSNPIIQY 176

Query: 191 TVYSKLKEFLQGYHNQEML-PSWETSLIGLISGAIGPF----SNAPLDTIKTR---LQKD 242
           TVY +LK  +     +++L PSW       + GAIG      +  P  T+KTR   +Q D
Sbjct: 177 TVYEQLKNLVLRLQRKKVLSPSW-----AFLLGAIGKLAATGTTYPYITLKTRMHLMQND 231

Query: 243 -KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
            K  K+M  L    I+  ++++++G   LY G+  +++     Q++   A+ F  KE
Sbjct: 232 PKHQKSMWSL----IV--EIVKKDGVSGLYNGVAVKLV-----QSIMTAAFLFFFKE 277

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 124/300 (41%), Gaps = 25/300 (8%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGFIKT 57
           M++ +K SN A++ + GG +  +      P++ +K+ +Q     +  G    +  G ++ 
Sbjct: 1   MSTDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVEC 60

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA-DKETG--KVSTGNTFI 114
                 +EG  +F++G  A VI   P  A+ F+  +  + +    KE G  K   GN   
Sbjct: 61  FKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNL-- 118

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSALYR 173
           A  G     +          + RL A   +  +G  +  N +   Y   +  +G + LYR
Sbjct: 119 ASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYR 178

Query: 174 GVSLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPL 232
           G   +       +G  F +Y  LK   L G      L S+   L+G         ++ PL
Sbjct: 179 GFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASF---LLGWAVTTGASTASYPL 235

Query: 233 DTIKTRLQKDKSTKNMSGLKRITIIG-----KQLIQEEGFRALYKGITPRVMRVAPGQAV 287
           DT++ R+        M+  + +   G     ++++  EG ++L+KG    ++R   G  V
Sbjct: 236 DTVRRRMM-------MTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 122/292 (41%), Gaps = 26/292 (8%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG---VKAPGFIKTGG 59
           ++ + S+  V+ + GG +  +      P++ +K+ MQ  +  +  G    +  G +    
Sbjct: 6   TQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFK 65

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA-DKET---GKVSTGNTFIA 115
               +EG ++F++G  A V+   P  A+ F+  +  ++LL+ D+E     K   GN F  
Sbjct: 66  RTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSG 125

Query: 116 GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYT-IVKEEGFSALYRG 174
           G   G++            + RL A        + +  N +   Y   +K +G   LYRG
Sbjct: 126 GAAGGLS--LLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRG 183

Query: 175 VSLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLD 233
              +       +G  F +Y   K   L G      + S+   L+G +       ++ PLD
Sbjct: 184 FVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASF---LLGWVITMGASTASYPLD 240

Query: 234 TIKTRL-----QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280
           T++ R+     Q  K    +  L++I       +Q+EG  +L+KG    + R
Sbjct: 241 TVRRRMMMTSGQTIKYDGALDCLRKI-------VQKEGAYSLFKGCGANIFR 285

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 73/191 (38%), Gaps = 11/191 (5%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           +  + GV A I +            ++ Q + L       +YK  +         EG  +
Sbjct: 16  DFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVS 75

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    K+K  L     ++    W    +  G  +G +    
Sbjct: 76  FWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLF 135

Query: 229 NAPLDTIKTRLQKD----KST--KNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVA 282
              LD  +TRL  D    KST  +  +GL  +    K+ ++ +G   LY+G  P V+ + 
Sbjct: 136 VYSLDYARTRLAADARGSKSTSQRQFNGLLDVY---KKTLKTDGLLGLYRGFVPSVLGII 192

Query: 283 PGQAVTFTAYE 293
             + + F  Y+
Sbjct: 193 VYRGLYFGLYD 203

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 84/199 (42%), Gaps = 19/199 (9%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP----GFIKTGGEIYRNEG 66
           A NL +GG AG +  L  + LD  + R+    +A GS   +     G +    +  + +G
Sbjct: 119 AGNLFSGGAAGGLSLLFVYSLDYARTRLA--ADARGSKSTSQRQFNGLLDVYKKTLKTDG 176

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAG--VGAGITE- 123
            L  Y+G    V+GI     + F  Y+ ++ +L    TG +    +F+A   +G  IT  
Sbjct: 177 LLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLL---TGALE--GSFVASFLLGWVITMG 231

Query: 124 AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQA 183
           A          + R+       +    KY  A+     IV++EG  +L++G      R  
Sbjct: 232 ASTASYPLDTVRRRMMMTSGQTI----KYDGALDCLRKIVQKEGAYSLFKGCGANIFRGV 287

Query: 184 TNQGANFTVYSKLKEFLQG 202
              G   ++Y +L+  + G
Sbjct: 288 AAAGV-ISLYDQLQLIMFG 305

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 4/89 (4%)

Query: 216 LIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGL----KRITIIGKQLIQEEGFRALY 271
           L+G +S AI     AP++ +K  +Q  +       L    K I    K+    EG  + +
Sbjct: 18  LMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFW 77

Query: 272 KGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           +G T  V+R  P QA+ F   + I+  L 
Sbjct: 78  RGNTANVLRYFPTQALNFAFKDKIKSLLS 106

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 102/273 (37%), Gaps = 19/273 (6%)

Query: 29  HPLDTIKVRMQIYKNAV-GSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAI 87
           +P++T+K R+Q+    V G      G  +    IYR EG     +GL             
Sbjct: 30  NPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGS 89

Query: 88  RFSSYEFYR-----TLLADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQH 142
           R   Y+  R      +L+D+ T   +          A               K R+QA  
Sbjct: 90  RLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQA-- 147

Query: 143 LNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG 202
           L P    P      +    + K+ G   LY+GV     R          VYS  KE L  
Sbjct: 148 LAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR 207

Query: 203 YHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR--ITIIGKQ 260
           +    M  +  T    L S A+    N P D   TR+   +      GL R  +  + K 
Sbjct: 208 HVPDGM--ALYTLASALSSVAVCIAMN-PFDVAMTRMYHHRG-----GLYRGPLDCLCKT 259

Query: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
            +++EGF ALYKG   +++R+AP   +  T  E
Sbjct: 260 -VRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 117/293 (39%), Gaps = 25/293 (8%)

Query: 8   SNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGFIKTGGEIYRN 64
           SN  ++ + GG +  +      P++ +K+ +Q     +  G    K  G +         
Sbjct: 21  SNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQ 80

Query: 65  EGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLA-DKETG--KVSTGNTFIAGVGAGI 121
           EG ++F++G  A VI   P  A+ F+  +  + +    KE G  K   GN  +A  GA  
Sbjct: 81  EGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGN--LASGGAAG 138

Query: 122 TEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSALYRGVSLTAA 180
             +          + RL A   +  +G  +  N +   Y   +K +G + LYRG   +  
Sbjct: 139 ALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVV 198

Query: 181 RQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239
                +G  F +Y  LK   L G      L S+   L+G +        + PLDT++ R+
Sbjct: 199 GIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASF---LLGWVVTTGASTCSYPLDTVRRRM 255

Query: 240 -----QKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAV 287
                Q  K       L++I       +  EG  +L+KG    ++R   G  V
Sbjct: 256 MMTSGQAVKYDGAFDCLRKI-------VAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 76/194 (39%), Gaps = 6/194 (3%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           +  + GV A + +            I+ Q + L       KY   +        +EG  +
Sbjct: 26  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVIS 85

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    K+K    G+  +E    W    +  G  +GA+    
Sbjct: 86  FWRGNTANVIRYFPTQALNFAFKDKIKAMF-GFKKEEGYAKWFAGNLASGGAAGALSLLF 144

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKR---ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
              LD  +TRL  D  +    G ++   +  + K+ ++ +G   LY+G  P V+ +   +
Sbjct: 145 VYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYR 204

Query: 286 AVTFTAYEFIRKEL 299
            + F  Y+ ++  L
Sbjct: 205 GLYFGMYDSLKPLL 218

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 76/197 (38%), Gaps = 15/197 (7%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAV--GSGVKAPGFIKTGGEIYRNEGFL 68
           A NL +GG AG +  L  + LD  + R+     +   G   +  G I    +  +++G  
Sbjct: 128 AGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVA 187

Query: 69  AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG---ITEAX 125
             Y+G    V+GI     + F  Y+  + LL    TG +    +F+A    G    T A 
Sbjct: 188 GLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLL---TGSLE--GSFLASFLLGWVVTTGAS 242

Query: 126 XXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATN 185
                    + R+       V    KY  A      IV  EG  +L++G      R    
Sbjct: 243 TCSYPLDTVRRRMMMTSGQAV----KYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAG 298

Query: 186 QGANFTVYSKLKEFLQG 202
            G   ++Y +L+  L G
Sbjct: 299 AGV-ISMYDQLQMILFG 314

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 117/280 (41%), Gaps = 28/280 (10%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+        V   G + +  +I  +EG  A   G G  ++G + + + +F
Sbjct: 33  PIDVVKTRIQLEPT-----VYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKF 87

Query: 90  SSYEFYRTLLADKE--TGKVSTGNTFIAGVGAGITE--AXXXXXXXXXXKIRLQAQHLNP 145
             YE ++ L  D       V+  NT   G  A I E  A          +IRL +Q    
Sbjct: 88  GGYELFKKLAIDNMGYDNAVNYKNTIYIG-SAAIAEFFADIALCPLEATRIRLVSQ---- 142

Query: 146 VEGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH 204
               P + N +   ++ I+KEEG  + Y G +    +Q     A F V+        G  
Sbjct: 143 ----PTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANAYFGLA 198

Query: 205 --NQEMLPSWETSL---IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
              + M  +  T++    GL +G      + P DT+ +++ K K     S +  +  + K
Sbjct: 199 GPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAK 258

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           QL    GF   + G+  R++ V    ++ F  Y  ++K L
Sbjct: 259 QL----GFVGSFTGLPTRLVMVGTLTSLQFGIYGTLKKSL 294

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 215 SLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           +L G I   I   S  P+D +KTR+Q + +  N    K +    KQ+I  EG  AL  G 
Sbjct: 17  ALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYN----KGMVSSFKQIISSEGAGALLTGF 72

Query: 275 TPRVMRVAPGQAVTFTAYEFIRK 297
            P ++  +   +  F  YE  +K
Sbjct: 73  GPTLLGYSLQGSFKFGGYELFKK 95

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/299 (21%), Positives = 120/299 (40%), Gaps = 26/299 (8%)

Query: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV---KAPGFIKTGG 59
           S  K SN  +N + GG +  +      P++ +K+ +Q     +  G    +  G +    
Sbjct: 2   SDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFK 61

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKET----GKVSTGNTFIA 115
               +EG ++F++G  A VI   P  A+ F+  +  + +   ++      K   GN    
Sbjct: 62  RTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASG 121

Query: 116 GVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACY-TIVKEEGFSALYRG 174
           G   G++            + RL A   +  +G  +  N +   Y   +  +G + LYRG
Sbjct: 122 GAAGGLS--LLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 175 VSLTAARQATNQGANFTVYSKLKE-FLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLD 233
              +       +G  F +Y  LK   L G      + S+   L+G         ++ PLD
Sbjct: 180 FLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASF---LLGWAVTTGASTASYPLD 236

Query: 234 TIKTRLQKDKSTKNMSGLKRITIIG-----KQLIQEEGFRALYKGITPRVMRVAPGQAV 287
           T++ R+        M+  + +   G     ++++  EG ++L+KG    ++R   G  V
Sbjct: 237 TVRRRMM-------MTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 71/194 (36%), Gaps = 5/194 (2%)

Query: 111 NTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA 170
           N  + GV A +++            I+ Q + L       +Y   V         EG  +
Sbjct: 12  NFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVIS 71

Query: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--GLISGAIGPFS 228
            +RG +    R    Q  NF    K+K         +    W    +  G  +G +    
Sbjct: 72  FWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGAAGGLSLLF 131

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKR---ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285
              LD  +TRL  D  +    G ++   +  + K+ +  +G   LY+G  P V+ +   +
Sbjct: 132 VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYR 191

Query: 286 AVTFTAYEFIRKEL 299
            + F  Y+ ++  L
Sbjct: 192 GLYFGMYDSLKPLL 205

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 77/194 (39%), Gaps = 13/194 (6%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG--VKAPGFIKTGGEIYRNEGFLAF 70
           NL +GG AG +  L  + LD  + R+     +   G   +  G +    +   ++G    
Sbjct: 117 NLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAG--VGAGITEAXXXX 128
           Y+G    V+GI     + F  Y+  + LL    TG + +  +FIA   +G  +T      
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLL---TGNLES--SFIASFLLGWAVTTGASTA 231

Query: 129 XXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGA 188
                   R   + +     A KY  A  A   IV  EG  +L++G      R     G 
Sbjct: 232 SYPLDTVRR---RMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

Query: 189 NFTVYSKLKEFLQG 202
             ++Y +L+  L G
Sbjct: 289 -ISLYDQLQLVLFG 301

>Kwal_26.7972
          Length = 358

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 122/314 (38%), Gaps = 47/314 (14%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQI----YKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           +AGG AG        PLD IK+  Q     Y    GS +   G I+ G  I  ++G   F
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTM---GLIRAGAHINAHDGIRGF 88

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAXXXXXX 130
           Y+G  A +I I P  AI+F +YE  R  +   +  + +      +G  AG+         
Sbjct: 89  YQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYE-THARRLASGSMAGLCSVFMTYPL 147

Query: 131 XXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSA-------------LYRGVSL 177
                IR++  ++       K    ++  YT    E  ++              YRG + 
Sbjct: 148 DL---IRVRLAYVTD-RSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTP 203

Query: 178 TAARQATNQGANFTVYSKLKEFLQG----------YHNQEM-----------LPSWETSL 216
           T        G +F  +    + L+             ++E+           L +W   +
Sbjct: 204 TVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELV 263

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKD-KSTKNMSGLKRITIIGKQLIQEEGFRALYKGIT 275
            G ++G     ++ P + I+ RLQ    S  ++   + I  + + + +E G+R  + G++
Sbjct: 264 AGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLS 323

Query: 276 PRVMRVAPGQAVTF 289
              ++V P  A +F
Sbjct: 324 IGYIKVTPMVACSF 337

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 86/220 (39%), Gaps = 40/220 (18%)

Query: 101 DKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNA----V 156
           ++   K S      +G+  GI  +          +I++  Q  NP     KY  +    +
Sbjct: 16  NQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNP--HYLKYSGSTMGLI 73

Query: 157 QACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS--WET 214
           +A   I   +G    Y+G S T  R        F  Y +++ F        M+PS  +ET
Sbjct: 74  RAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHF--------MIPSKEYET 125

Query: 215 SLIGLISGAIG----PFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRAL 270
               L SG++      F   PLD I+ RL       + S +K + +I KQ+  E    +L
Sbjct: 126 HARRLASGSMAGLCSVFMTYPLDLIRVRLAY---VTDRSRIKMLPVI-KQIYTERASESL 181

Query: 271 ----------------YKGITPRVMRVAPGQAVTFTAYEF 294
                           Y+G TP V+ + P   V+F A++ 
Sbjct: 182 TSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDL 221

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 3   SKQKSSNP---AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIY---KNAVGSGVKAPGFIK 56
           SK++SS P      L+AGG AG+      +P + I+ R+Q+      ++ +    P  I+
Sbjct: 248 SKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIR 307

Query: 57  TGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
               IY+  G+  F+ GL    I +TP +A  F
Sbjct: 308 I---IYKERGWRGFFVGLSIGYIKVTPMVACSF 337

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 41/86 (47%), Gaps = 8/86 (9%)

Query: 216 LIGLISGAIGPFSNAPLDTIKTRLQKD-----KSTKNMSGLKRITIIGKQLIQEEGFRAL 270
           L G I+G+      APLD IK   Q       K + +  GL R    G  +   +G R  
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRA---GAHINAHDGIRGF 88

Query: 271 YKGITPRVMRVAPGQAVTFTAYEFIR 296
           Y+G +  ++R+ P  A+ F AYE IR
Sbjct: 89  YQGHSATLIRIFPYAAIKFIAYEQIR 114

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/244 (19%), Positives = 87/244 (35%), Gaps = 48/244 (19%)

Query: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRM----------------QIYKNA 44
           M   ++    A  L +G  AGL      +PLD I+VR+                QIY   
Sbjct: 117 MIPSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTER 176

Query: 45  VGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEF---------- 94
               + +  ++      + N     FY+G    V+G+ P   + F +++           
Sbjct: 177 ASESLTSKSYVPRWFAHWCN-----FYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGAL 231

Query: 95  --YRTL-LADKE---------TGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQH 142
             Y  L ++D+E         +  + T    +AG  AG+             + RLQ   
Sbjct: 232 SPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRR-RLQVSV 290

Query: 143 LNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSK---LKEF 199
           ++P      ++        I KE G+   + G+S+   +       +F    K   + E+
Sbjct: 291 VSPT-SIHNFQTIPDMIRIIYKERGWRGFFVGLSIGYIKVTPMVACSFFRLRKNEVVSEY 349

Query: 200 LQGY 203
           L+ Y
Sbjct: 350 LRTY 353

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 113/300 (37%), Gaps = 40/300 (13%)

Query: 17  GGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV-----KAPGFIKTGGEIYRNEGFLAFY 71
           G  A  +     +PLD  K  +Q       SG      K    I    +I++  GFL  Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRT-----------LLADKETGKVSTGNTFIAGVGAG 120
           +GL   V     +  I F  Y   R+           L  D +  ++ST      G+ AG
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEG---FSALYRGVSL 177
              A           I  + Q     E A     +++A    + EE     +A ++G  +
Sbjct: 130 ---AMTQVVTNPISVISTRQQLTKDGEDA-----SLKAVIKQIYEESNGDLTAFWKGFKV 181

Query: 178 TAARQATNQGANFTVYSKLKEFL---QGYHNQE----MLPSWETSLIGLISGAIGPFSNA 230
            A   +TN    +  Y KLK  +   +G    +     L + E  L+G+ S  I  F   
Sbjct: 182 -ALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQ 240

Query: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFT 290
           PL   K  LQ   S       K    + + + Q EGF +L+KG+ P+V +    Q + FT
Sbjct: 241 PLIVAKITLQGKGSK-----FKTFQEVLQHIYQNEGFLSLWKGVIPQVSKGVIVQGLLFT 295

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 75/176 (42%), Gaps = 23/176 (13%)

Query: 135 KIRLQAQHLNPVEGAPK----YKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190
           K  +Q QH N   G  K    YKN +     I K+ GF  LY+G++   A         F
Sbjct: 28  KTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATNVAANFVQNFIYF 87

Query: 191 TVYSKLKE--------FLQGYHNQEM--LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240
             YS ++          LQ   + +   L + E   +G+ +GA+      P+  I TR Q
Sbjct: 88  FWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAGAMTQVVTNPISVISTRQQ 147

Query: 241 KDKSTKNMSGLKRITIIGKQLIQEEG--FRALYKGI-TPRVMRVAPGQAVTFTAYE 293
             K  ++ S LK +    KQ+ +E      A +KG     V+   P  A+T+ +Y+
Sbjct: 148 LTKDGEDAS-LKAVI---KQIYEESNGDLTAFWKGFKVALVLSTNP--AITYGSYQ 197

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 122/311 (39%), Gaps = 51/311 (16%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           +LI G   GL+  +   P D +K R+Q  ++   +  K    I+T  +++R         
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQ--QDKTSTLWKTLKSIETPSQLWRGALPSCIRT 67

Query: 73  GLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGV-------GAGITEAX 125
            +G+ +  +T   +IR       + +   K TG  STG++++  +          +T A 
Sbjct: 68  SVGSAMY-LTMLNSIR-------QAISKGKNTG--STGSSYLPQLNMYENMFSGAVTRAL 117

Query: 126 XXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATN 185
                     I+++ +         +Y +   A   I + EG    +RG   TA R A  
Sbjct: 118 TGLITMPITVIKVRYE-----STLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPY 172

Query: 186 QGANFTVYSKLKEFLQGYHNQEMLPS----------WETSLIGLISGA-------IGPFS 228
            G     Y ++K  +       +LPS          + T    LI+G+       I    
Sbjct: 173 AGLYMLFYDRMKVLV-----PTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSI 227

Query: 229 NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVT 288
            AP DT+KTR+Q +      +     T     +  +E  R L+ GI+ R+ R A    + 
Sbjct: 228 TAPFDTVKTRMQLEP-----AKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIA 282

Query: 289 FTAYEFIRKEL 299
           +  YE I K+ 
Sbjct: 283 WGIYEEIVKKF 293

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 11/88 (12%)

Query: 214 TSLIGLISGA-IGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYK 272
           T LIG  SG  +      P D +KTRLQ+DK++     LK I          E    L++
Sbjct: 9   THLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSI----------ETPSQLWR 58

Query: 273 GITPRVMRVAPGQAVTFTAYEFIRKELE 300
           G  P  +R + G A+  T    IR+ + 
Sbjct: 59  GALPSCIRTSVGSAMYLTMLNSIRQAIS 86

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 65/154 (42%), Gaps = 19/154 (12%)

Query: 144 NPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY 203
            PV    K   AV+  Y   +  G +A  +G + T  RQ  N    FT Y+  K  LQ  
Sbjct: 135 TPVARIEKLLPAVKHMY---QTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQAR 191

Query: 204 HNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ----KDKSTKNMSGLKRITIIGK 259
           +++       + + GL +         P+D +KTR+     K +    ++ + RI +   
Sbjct: 192 NDKA-----SSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFV--- 243

Query: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293
               +EG    +KG   R M+V     +TFT YE
Sbjct: 244 ----QEGMATFWKGSIFRFMKVGISGGLTFTVYE 273

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 79/211 (37%), Gaps = 34/211 (16%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRM---------QIYKNAVGSGVKAP------------ 52
           LIAG   G++E L   P + IK  +         ++ KN      KA             
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 53  ---GFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVST 109
                +     +Y+  G  AF +G  A +       +I+F++Y  ++ LL  +       
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARN----DK 194

Query: 110 GNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFS 169
            ++ I G+    T            K R+ +Q+        +YKN +   Y I  +EG +
Sbjct: 195 ASSVITGLATSFT-LVAMTQPIDVVKTRMMSQN-----AKTEYKNTLNCMYRIFVQEGMA 248

Query: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
             ++G      +   + G  FTVY ++   L
Sbjct: 249 TFWKGSIFRFMKVGISGGLTFTVYEQVSLLL 279

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 82/201 (40%), Gaps = 26/201 (12%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           NL+ G  +    GL   P+  IKVR +    A        G  +    I+R+EG   F+K
Sbjct: 107 NLLTGALSRAAVGLVTMPITVIKVRYESTLYAYN------GLAEATRHIWRSEGARGFFK 160

Query: 73  GLGAVVIGITPKMAIRFSSYEFYR---------TLLADKETGKVST-GNTFIAGVGAGIT 122
           G  A  +   P   +    YE  +         TLL   E+GK++   +  + GV A ++
Sbjct: 161 GAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLS 220

Query: 123 E--AXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
              A          K R+Q Q  +PV         VQ    IV EE    L+ G+SL   
Sbjct: 221 ASLATTLTAPFDTIKTRMQLQS-HPV-------GFVQTLRHIVCEERARTLFDGLSLRLC 272

Query: 181 RQATNQGANFTVYSKLKEFLQ 201
           R+A +    + +Y +L + L 
Sbjct: 273 RKAMSACIAWGIYEELLKLLH 293

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/314 (20%), Positives = 118/314 (37%), Gaps = 41/314 (13%)

Query: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAP-GFIKTGGEIYR 63
           +K+     +L++G   GL       PLD +K R+Q    A  S +++    ++T  E++R
Sbjct: 3   EKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQ---QAQASSLRSVLREVRTTRELWR 59

Query: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG-----NTFIAGVG 118
                A    +G+         A+  S   + R+ LA     +  +       ++   + 
Sbjct: 60  GTLPSALRTSIGS---------ALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLT 110

Query: 119 AGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLT 178
             ++ A           I+++ +          Y    +A   I + EG    ++G + T
Sbjct: 111 GALSRAAVGLVTMPITVIKVRYE-----STLYAYNGLAEATRHIWRSEGARGFFKGAAAT 165

Query: 179 AARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI------------GLISGAIGP 226
             R A   G    +Y + KE L       +L + E+  +              +S ++  
Sbjct: 166 TLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLAT 225

Query: 227 FSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286
              AP DTIKTR+Q            R       ++ EE  R L+ G++ R+ R A    
Sbjct: 226 TLTAPFDTIKTRMQLQSHPVGFVQTLR------HIVCEERARTLFDGLSLRLCRKAMSAC 279

Query: 287 VTFTAYEFIRKELE 300
           + +  YE + K L 
Sbjct: 280 IAWGIYEELLKLLH 293

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 112/279 (40%), Gaps = 26/279 (9%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P+D +K R+Q+      SG+    F K  GE    EG  A   G G  ++G + + A +F
Sbjct: 35  PIDVVKTRIQLEPLKYSSGMVG-SFRKIVGE----EGAAALLTGFGPTLLGYSMQGAFKF 89

Query: 90  SSYEFYRTLLADK---ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPV 146
             YE ++    D    ET        +I         A          +IRL +Q     
Sbjct: 90  GGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQ----- 144

Query: 147 EGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYH- 204
              P + N +   +  I+KEEG  + Y G +    +Q     A F V+        G   
Sbjct: 145 ---PTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHAANAYFGLAG 201

Query: 205 NQEMLPSWETSLIGLISGAIGPFS----NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260
           ++E L +   + I L++G     +    + P DT+ +++ K K     S    +  + KQ
Sbjct: 202 SKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQ 261

Query: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
           L    GF   + G+  R++ V    ++ F  Y  +++ L
Sbjct: 262 L----GFVGSFAGLPTRLVMVGTLTSLQFGIYGKLKQSL 296

 Score = 34.3 bits (77), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 12/86 (13%)

Query: 220 ISGAIGPFSN----APLDTIKTRLQKD--KSTKNMSGLKRITIIGKQLIQEEGFRALYKG 273
           ++GAIG  +      P+D +KTR+Q +  K +  M G  R      +++ EEG  AL  G
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFR------KIVGEEGAAALLTG 73

Query: 274 ITPRVMRVAPGQAVTFTAYEFIRKEL 299
             P ++  +   A  F  YE  +K  
Sbjct: 74  FGPTLLGYSMQGAFKFGGYEVFKKAF 99

>Scas_705.9
          Length = 323

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 111/300 (37%), Gaps = 37/300 (12%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSG---------VKAPGFIKTGGEIYRNE 65
           I G  A  M  +  +PLD  K  +Q    A  +          ++    I+    I+R  
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYR------TLLADKE---TGKVSTGNTFIAG 116
           G    Y+G+   V     +    F  Y F R       LL + +      +ST    I G
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 117 VGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEG-FSALYRGV 175
           VGA    A          ++ L  Q     +    + + ++  Y  V+  G  S+ ++G 
Sbjct: 128 VGA----AALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIY--VESNGKLSSYWKGF 181

Query: 176 SLTAARQATNQGANFTVYSKLKE-FLQGYHNQE-----MLPSWETSLIGLISGAIGPFSN 229
            ++      N    F  Y + K+  L+   N E      L   +  ++G ++  I     
Sbjct: 182 KVSLIL-TVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIIT 240

Query: 230 APLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
            PL   K  LQ+  S       K    + + L +EEG  AL+KG+ P++ +    Q + F
Sbjct: 241 QPLIVAKVSLQRSNS-----KFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVF 295

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 77/186 (41%), Gaps = 23/186 (12%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY--RNEGFLAFY 71
           LI G GA  +  +  +P++ I  + Q   +          F     +IY   N    +++
Sbjct: 124 LIVGVGAAALTQVVNNPIEVILTKQQTTDDK-----DNVDFYSVLKQIYVESNGKLSSYW 178

Query: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADK-------ETGKVSTGNTFIAGVGAGITEA 124
           KG    +I +T   +I F++Y+ ++ +L  +        +G+++    FI G  A I  +
Sbjct: 179 KGFKVSLI-LTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKII-S 236

Query: 125 XXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184
                     K+ LQ  +        K+K+  +    + KEEG  AL++GV     +   
Sbjct: 237 TIITQPLIVAKVSLQRSN-------SKFKHFEEVLRYLYKEEGVLALWKGVGPQLTKGVL 289

Query: 185 NQGANF 190
            QG  F
Sbjct: 290 VQGLVF 295

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 10/96 (10%)

Query: 213 ETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGL----KRI----TIIG--KQLI 262
           E+++ G I+  +      PLD  KT +Q +   K    L    KRI     +I    ++ 
Sbjct: 5   ESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIF 64

Query: 263 QEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKE 298
           ++ G R LY+G++  V          F  Y F+R++
Sbjct: 65  RKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRK 100

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 112/276 (40%), Gaps = 41/276 (14%)

Query: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
           P  T +   Q YK+A+   VK          +YRNEGF   Y GL A ++G      I+ 
Sbjct: 76  PTATKESLEQRYKHALDVIVK----------VYRNEGFGGLYHGLSASLLG----TFIQS 121

Query: 90  SSYEFYRTLL------ADKETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHL 143
            SY F+ TL+        K  G+ +  +T    + + +  A           +  + Q  
Sbjct: 122 FSYFFWYTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTR 181

Query: 144 NPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGY 203
             +EG   +K   +  Y    E+G +  ++ + ++      N    +    KLK+ L  Y
Sbjct: 182 RGLEGDNSFKAIAKEVY---DEDGITGFWKSLKVSLVL-TINPSITYASAEKLKDIL--Y 235

Query: 204 H----------NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR 253
           H          +   L   +  LIG++S  I      PL   K  LQ+  S+K  S  + 
Sbjct: 236 HVEWNAKDLNDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRS-SSKFTSFQEV 294

Query: 254 ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289
           +T     L + EG  AL+KG+ P++ +    Q + F
Sbjct: 295 LTY----LYRHEGAHALWKGLLPQLTKGVIVQGLLF 326

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 84/231 (36%), Gaps = 51/231 (22%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRM----------------QIYKNAVGSGVKAPGFIKT 57
           L +G  AGL    C +PLD I+VR+                QIY       + +  ++  
Sbjct: 156 LCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPK 215

Query: 58  GGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL-----------------A 100
               + N     FY+G    VIG+ P   + F +++ +  +L                 A
Sbjct: 216 WFAQWCN-----FYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDA 270

Query: 101 DK--------ETGKVSTGNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQH---LNPVEGA 149
           D          TGK    NT+   +  G+              IR + Q     NP+E  
Sbjct: 271 DDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEH- 329

Query: 150 PKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL 200
            K+ +  +    I  E G+   + G+S+   +       +F VY ++K ++
Sbjct: 330 -KFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWYM 379

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 79/210 (37%), Gaps = 36/210 (17%)

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNP--VEGAPKYKNAVQACYTIVKEEGFSALY 172
           +G+  G+  +          +I++  Q  NP  V+ A  ++  + A   I   +    ++
Sbjct: 56  SGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 173 RGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPS--WETSLIGLISGAIG----P 226
           +G S T  R        F  Y +++  +        +PS  +ET    L SG++      
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNVI--------IPSKEYETHFRRLCSGSLAGLCSV 167

Query: 227 FSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRAL---------------- 270
           F   PLD I+ RL        +    R+  + KQ+  E    AL                
Sbjct: 168 FCTYPLDLIRVRLAYVTEHHKV----RVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNF 223

Query: 271 YKGITPRVMRVAPGQAVTFTAYEFIRKELE 300
           Y+G  P V+ + P   V+F A++     L 
Sbjct: 224 YRGYIPTVIGMIPYAGVSFFAHDLFHDILR 253

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 4/87 (4%)

Query: 9   NPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGV--KAPGFIKTGGEIYRNEG 66
           N    L+AGG AG+      +P + I+ R+Q+   AV + +  K     +    I+   G
Sbjct: 289 NTWAELLAGGLAGMASQTAAYPFEIIRRRLQV--GAVTNPLEHKFTSMSEMAKIIFHERG 346

Query: 67  FLAFYKGLGAVVIGITPKMAIRFSSYE 93
           +  F+ GL    I +TP +A  F  YE
Sbjct: 347 WRGFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 209 LPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSG-LKRITIIGKQLIQEEGF 267
           L +W   L G ++G     +  P + I+ RLQ    T  +      ++ + K +  E G+
Sbjct: 288 LNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGW 347

Query: 268 RALYKGITPRVMRVAPGQAVTFTAYE 293
           R  + G++   ++V P  A +F  YE
Sbjct: 348 RGFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQI----YKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70
           +AGG AG        PLD IK+  Q     Y    GS     G +  G  I+  +     
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGS---FQGLLNAGVHIWSRDRLRGV 114

Query: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLL 99
           ++G  A ++ I P  A++F +YE  R ++
Sbjct: 115 FQGHSATLLRIFPYAAVKFIAYEQIRNVI 143

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 98/245 (40%), Gaps = 26/245 (10%)

Query: 60  EIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEF-----YRTLLADKETGKVSTGNTFI 114
           +IY+ EG    Y+GL   V+    +    F  Y F     +R  L +++  K +T    +
Sbjct: 84  KIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKNTKFTTIEELL 143

Query: 115 AGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174
            G+ A  T             I  + Q    ++G   +    +  Y   ++      ++G
Sbjct: 144 LGIVAAATSQIFTNPISL---ISARQQTRQGIDGDNDFLTVAKEIYK--EQRSIKGFWKG 198

Query: 175 VSLTAARQATNQGANFTVYSKLKEFL----------QGYHNQEMLPSWETSLIGLISGAI 224
           + ++      N    +T Y KLK+ L          +   +   L  ++   +G++S  I
Sbjct: 199 LKVSLML-TINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNFTLGVLSKMI 257

Query: 225 GPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPG 284
                 PL   K  LQ++ S  N S  +++      L + EG R+ +KG++P++ +    
Sbjct: 258 SAIITMPLIISKAWLQRNGS--NFSSFQQVLYY---LYKNEGLRSWWKGLSPQLAKGVLV 312

Query: 285 QAVTF 289
           Q + F
Sbjct: 313 QGLLF 317

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 72/154 (46%), Gaps = 9/154 (5%)

Query: 151 KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKE--FLQGYHNQE- 207
           +Y +   A Y I K+EG   LY+G++ +         + F  YS +++  F     N++ 
Sbjct: 74  QYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKN 133

Query: 208 -MLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEE- 265
               + E  L+G+++ A       P+  I  R Q   + + + G      + K++ +E+ 
Sbjct: 134 TKFTTIEELLLGIVAAATSQIFTNPISLISARQQ---TRQGIDGDNDFLTVAKEIYKEQR 190

Query: 266 GFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
             +  +KG+   +M +    ++T+T+YE ++  L
Sbjct: 191 SIKGFWKGLKVSLM-LTINPSITYTSYEKLKDAL 223

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 80/201 (39%), Gaps = 27/201 (13%)

Query: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA-FYK 72
           L+ G  A     +  +P+  I  R Q  +   G       F+    EIY+ +  +  F+K
Sbjct: 142 LLLGIVAAATSQIFTNPISLISARQQTRQGIDGDN----DFLTVAKEIYKEQRSIKGFWK 197

Query: 73  GLG-AVVIGITPKMAIRFSSYEFYRTLLADKET-----------GKVSTGNTFIAGVGAG 120
           GL  ++++ I P  +I ++SYE  +  L   +T            ++S    F  GV + 
Sbjct: 198 GLKVSLMLTINP--SITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQNFTLGVLSK 255

Query: 121 ITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAA 180
           +  A          K  LQ    N       + +  Q  Y + K EG  + ++G+S   A
Sbjct: 256 MISAIITMPLIIS-KAWLQRNGSN-------FSSFQQVLYYLYKNEGLRSWWKGLSPQLA 307

Query: 181 RQATNQGANFTVYSKLKEFLQ 201
           +    QG  F    +L + ++
Sbjct: 308 KGVLVQGLLFMFKGELTKLMK 328

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 75/168 (44%), Gaps = 10/168 (5%)

Query: 137 RLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKL 196
           R++   L   + A +YK A+ A   I   EG + LYRG+  +         + F  Y+ +
Sbjct: 57  RIKPIALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLV 116

Query: 197 KEFL----QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLK 252
           ++      Q         + E  ++G+++ A       P++ + TR Q   +    +G  
Sbjct: 117 RKHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQ---TRGQAAGAA 173

Query: 253 RITIIGKQLIQEEGFRALYKGI-TPRVMRVAPGQAVTFTAYEFIRKEL 299
            +  + +++  E G+R  + G+    V+ V P  ++T+  YE +R+ L
Sbjct: 174 DMRTVAREVHAENGWRGFWAGLKVSLVLTVNP--SITYATYERLREAL 219

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 90/248 (36%), Gaps = 35/248 (14%)

Query: 60  EIYRNEGFLAFYKGLG-AVVIGITPKMAIRFSSYEFYRTLL---------ADKETGKVST 109
            IY  EG    Y+GLG + V G      I+  SY F+ TL+         A     + ST
Sbjct: 81  RIYGAEGVAGLYRGLGSSTVAGF-----IQSFSYFFWYTLVRKHYFRLKQARGGDARFST 135

Query: 110 GNTFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFS 169
               + G+ A  T             +  + Q      GA   +   +  +    E G+ 
Sbjct: 136 PEELVLGIVAAATSQLFVNPINV---VATRQQTRGQAAGAADMRTVAREVHA---ENGWR 189

Query: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFL--------QGYHNQEMLPSWETSLIGLIS 221
             + G+ ++      N    +  Y +L+E L            +  +L   +  ++G++S
Sbjct: 190 GFWAGLKVSLV-LTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVLS 248

Query: 222 GAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRV 281
             +      PL   K  LQ+  S       +    +   L   EG  +L+KG+ P++ + 
Sbjct: 249 KIVSTVLTQPLIIAKASLQRSGSC-----FQDFHQVLHHLYSTEGPLSLWKGLGPQITKG 303

Query: 282 APGQAVTF 289
              Q + F
Sbjct: 304 VLVQGLLF 311

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 217 IGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKG 273
           +G ISG +      P D ++ R Q      N  G  R   +   LI   + EG +  YKG
Sbjct: 16  MGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGF-RYKSVSDALITIGKTEGPKGYYKG 74

Query: 274 ITPRVMRVAPGQAVTFTAYEFIRKEL 299
           +T  + +V P  AV++  YE IR+ +
Sbjct: 75  LTANLFKVIPSTAVSWLVYEVIREAM 100

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 13/96 (13%)

Query: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYK---NAVGSGVKA--PGFIKTGGEIYRNE 65
           A+  I+GG A  +     +P D ++ R Q+     N +G   K+     I  G    + E
Sbjct: 15  AMGAISGGVAQTL----VYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIG----KTE 66

Query: 66  GFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD 101
           G   +YKGL A +  + P  A+ +  YE  R  + +
Sbjct: 67  GPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 26.9 bits (58), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 28/62 (45%)

Query: 137 RLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKL 196
           R Q   +   E   +YK+   A  TI K EG    Y+G++    +   +   ++ VY  +
Sbjct: 37  RFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVI 96

Query: 197 KE 198
           +E
Sbjct: 97  RE 98

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/314 (20%), Positives = 115/314 (36%), Gaps = 65/314 (20%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQI--------------------YKNAVGSGVKAPGF 54
           + G  A  M  +  +PLD  K  +Q                     YKN V   +     
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMI----- 62

Query: 55  IKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYR-TLLADKETGKVSTGN-- 111
                 I++ +G L  Y+G+    +    +  + F  Y F R + +  K  G  S  N  
Sbjct: 63  -----NIFKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRD 117

Query: 112 ---------TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTI 162
                      + GV A    +           +  + Q ++  E A K+ N ++  Y  
Sbjct: 118 GPITPSTIEELVLGVAAA---SISQLFTSPMAVVATRQQTVHSAESA-KFTNVIKDIY-- 171

Query: 163 VKEEG--FSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEM--LPSWETSLIG 218
            +E     +A ++G+  T      N    +  + +LKE     H+ +   L + +  ++G
Sbjct: 172 -RENNGDITAFWKGLR-TGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILG 229

Query: 219 LISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKGIT 275
           ++S  I      PL   K  LQ   S        + T   + L+   + EG ++L+KG+ 
Sbjct: 230 VLSKMISTLVTQPLIVAKAMLQSAGS--------KFTTFQEALLYLYKNEGLKSLWKGVL 281

Query: 276 PRVMRVAPGQAVTF 289
           P++ +    Q + F
Sbjct: 282 PQLTKGVIVQGLLF 295

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 76/161 (47%), Gaps = 20/161 (12%)

Query: 151 KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEF--------LQG 202
           +YKN V     I KE+G   LY+G+++T           F  Y+ +++         LQ 
Sbjct: 53  RYKNVVDCMINIFKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQS 112

Query: 203 YHNQE--MLPS-WETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259
             N++  + PS  E  ++G+ + +I     +P+  + TR Q   S ++     + T + K
Sbjct: 113 LKNRDGPITPSTIEELVLGVAAASISQLFTSPMAVVATRQQTVHSAES----AKFTNVIK 168

Query: 260 QLIQEEG--FRALYKGI-TPRVMRVAPGQAVTFTAYEFIRK 297
            + +E      A +KG+ T   + + P  ++T+ +++ +++
Sbjct: 169 DIYRENNGDITAFWKGLRTGLALTINP--SITYASFQRLKE 207

>Scas_613.24
          Length = 177

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 14/87 (16%)

Query: 217 IGLISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYK 272
           + L+SG IG  S+A    PLD +KTR+Q+ K     S +K I    K  IQ       ++
Sbjct: 10  VHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDI----KDPIQ------FWR 59

Query: 273 GITPRVMRVAPGQAVTFTAYEFIRKEL 299
           G  P  +R + G A+  +    +R +L
Sbjct: 60  GTLPSALRTSIGSALYLSCLNIMRTQL 86

 Score = 32.7 bits (73), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYK 72
           NL+ G  A  + G    P+  +KVR   Y++   S       IK   +IY+ EG   F+K
Sbjct: 109 NLLTGAMARGLVGYITMPITILKVR---YESTYYSYKSMNEAIK---DIYKMEGISGFFK 162

Query: 73  GLGAVV-IGITPK 84
           G G  V IGI P+
Sbjct: 163 GFGPTVGIGIPPQ 175

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 5  QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA 44
           KS   +V+L++G   GL   +   PLD +K R+Q +K A
Sbjct: 3  DKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGA 42

>Scas_328.1
          Length = 227

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 7/136 (5%)

Query: 147 EGAPKYKNAVQACYT-IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKE-FLQGYH 204
            GAP+  N +   Y   +  +G   LYRG   +       +G  F +Y  LK   L G  
Sbjct: 73  SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSF 132

Query: 205 NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264
               LPS+       IS +    ++ PLDT++ R+    ++      K      +Q++ +
Sbjct: 133 ENAFLPSFLLGWAVTISAST---TSYPLDTVRRRMMM--TSGQAVKYKGAIDCFQQIVSQ 187

Query: 265 EGFRALYKGITPRVMR 280
           EG  +L+KG    + R
Sbjct: 188 EGVYSLFKGCGANIFR 203

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 77/190 (40%), Gaps = 28/190 (14%)

Query: 27  CCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGG--------EIYR----NEGFLAFYKGL 74
           C  P+  + +R+   KN +GS  K+   IK+G         ++Y+     +G L  Y+G 
Sbjct: 48  CSFPIVCLFLRLC--KNEIGSDAKS---IKSGAPRKFNGILDVYKKTLFTDGVLGLYRGF 102

Query: 75  GAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTG--NTFIAGVGAGITEAXXXXXXXX 132
              V+GI     + F  Y+  + +L    TG        +F+ G    I+ +        
Sbjct: 103 LPSVVGIMVYRGLYFGLYDSLKPVLL---TGSFENAFLPSFLLGWAVTISASTTSYPLDT 159

Query: 133 XXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTV 192
             +     + +     A KYK A+     IV +EG  +L++G      R     G   ++
Sbjct: 160 VRR-----RMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGV-ISL 213

Query: 193 YSKLKEFLQG 202
           Y +L+  L G
Sbjct: 214 YDQLQLLLFG 223

>Kwal_55.21106
          Length = 328

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 113/308 (36%), Gaps = 46/308 (14%)

Query: 15  IAGGGAGLMEGLCCHPLDTIKVRMQIYKNA--VGS--GVKAPG------------FIKTG 58
           I G  A  +  +  +PLD +K  +Q       +GS  GVK                +   
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 59  GEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE-----FYRTLLADKETGKVSTGNTF 113
            +I++ +G L  Y+GL   +I    +    F  Y      F+R  L     GK ST    
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEEL 127

Query: 114 IAG-VGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALY 172
           + G V A +++           +     Q  +       ++  +   Y+  ++   +  +
Sbjct: 128 LLGIVAAAVSQIFTSPIGVISTR-----QQTSTSGSKGGFREVLHQIYS--EQNNITGFW 180

Query: 173 RGVSLTAARQATNQGANFTVYSKLKEFL-----------QGYHNQEMLPSWETSLIGLIS 221
           RG  ++      N    F  Y KL++             Q       L   +  L+G+ S
Sbjct: 181 RGFKVSLIL-TVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFS 239

Query: 222 GAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRV 281
             I      PL   K  LQ+  S  N    +++ +    L ++EG  +L+KG+ P++ + 
Sbjct: 240 KVISTLITQPLIVSKAYLQRTGS--NFQSFQQVLLY---LYKQEGLISLWKGLAPQLSKG 294

Query: 282 APGQAVTF 289
              Q + F
Sbjct: 295 ILVQGLLF 302

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 70/151 (46%), Gaps = 16/151 (10%)

Query: 151 KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLK------EFLQGYH 204
           +YK+++ A   I K +G   LY+G+  +         + F  YS ++      + L+G  
Sbjct: 59  RYKHSLDALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRL 118

Query: 205 NQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQE 264
            +   P  E  L+G+++ A+     +P+  I TR Q+  ++ +  G + +     Q+  E
Sbjct: 119 GKFSTP--EELLLGIVAAAVSQIFTSPIGVISTR-QQTSTSGSKGGFREVL---HQIYSE 172

Query: 265 E-GFRALYKGI-TPRVMRVAPGQAVTFTAYE 293
           +      ++G     ++ V P  ++TF +YE
Sbjct: 173 QNNITGFWRGFKVSLILTVNP--SITFASYE 201

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 219 LISGAIGPFSNA----PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGI 274
           LI G  G  ++A    PLD +KTR+Q+DK       LK I          +    L++G 
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEI----------DSPLQLWRGT 63

Query: 275 TPRVMRVAPGQAVTFTAYEFIRKEL 299
            P  +R + G A+  +    +R  L
Sbjct: 64  LPSALRTSIGSALYLSCLNLMRSSL 88

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 121/334 (36%), Gaps = 68/334 (20%)

Query: 2   ASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEI 61
           A+K ++S+   +LI G   GL   +   PLD +K R+Q  K A           K   EI
Sbjct: 5   ATKPRNSS---HLIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT--------LWKNLKEI 53

Query: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGN---------- 111
              +  L  ++G     +  +   A+  S     R+ LA +     S  N          
Sbjct: 54  ---DSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSS 110

Query: 112 --------------TFIAGVGAGITEAXXXXXXXXXXKIRLQAQHLNPVEGAPKYKNAVQ 157
                          F  G+   IT            K+R ++   N       Y +  +
Sbjct: 111 SLPRLTMYENLLTGAFARGLVGYIT------MPITVIKVRYESTLYN-------YSSLKE 157

Query: 158 ACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG-------YHNQE--- 207
           A   I  +EG    +RG   T  R A   G    +Y K K+ L         ++N E   
Sbjct: 158 AITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGF 217

Query: 208 --MLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEE 265
                +   +   ++S ++     AP DTIKTR+Q + S K  +     T I    ++ E
Sbjct: 218 TTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLEPS-KFTNSFNTFTSI----VKNE 272

Query: 266 GFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299
               L+ G++ R+ R A    + +  YE + K  
Sbjct: 273 NVLKLFSGLSMRLARKAFSAGIAWGIYEELVKRF 306

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 151 KYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKL-KEFL 200
           K+ N+     +IVK E    L+ G+S+  AR+A + G  + +Y +L K F+
Sbjct: 257 KFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIYEELVKRFM 307

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
           G ++GA     +AP+D I TR   D+   +      + +  +  I+E G    + G    
Sbjct: 167 GFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGFGLS 226

Query: 278 VMRVAPGQAVTFTAYEFIR 296
            +R + G A+ FT +E IR
Sbjct: 227 FIRESFGFALYFTTFEMIR 245

>Scas_611.4*
          Length = 299

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 148 GAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQE 207
           G    +N +    TI++E+GF  L+R    +   +  NQ     +YS + +   GY  ++
Sbjct: 177 GTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQ-----LYSLVTDL--GYRRRK 229

Query: 208 MLPSWETSLIGLISGAIGPFSNAPLDTIKTRL 239
            +  WE   I  I G+   F +  LDTI  ++
Sbjct: 230 DI-VWEN--IKSIDGSEDTFCDGNLDTIDLKM 258

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 39/82 (47%)

Query: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPR 277
           G ++G     ++AP+D I TR   +    +      + + G   ++E G    + G    
Sbjct: 163 GFMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGFGLS 222

Query: 278 VMRVAPGQAVTFTAYEFIRKEL 299
           +++ + G AV FT +E ++ ++
Sbjct: 223 LVKESVGFAVYFTTFELLKGQV 244

>Scas_671.1*
          Length = 123

 Score = 30.4 bits (67), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 7/86 (8%)

Query: 215 SLIGLISGAIGPFSNAPLDTIKTRLQ-KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKG 273
           S+  + S ++     AP DTIKTR+Q K K   N      + +I K     E    L+ G
Sbjct: 43  SVSAIASASLATAITAPFDTIKTRMQLKPKVFTNF--FTTLVLITKN----ESIFQLFSG 96

Query: 274 ITPRVMRVAPGQAVTFTAYEFIRKEL 299
           ++ R+ R A    + +  YE + K +
Sbjct: 97  LSMRLTRKALSAGIAWGIYEDLIKRI 122

>Kwal_55.20583
          Length = 1903

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 41   YKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAI 87
            + N + SG++   F    G    +EG   F+KGLG  ++G+  K AI
Sbjct: 1700 FVNGISSGLRGVAFDPYKGA--SSEGVPGFFKGLGKGLVGLPTKTAI 1744

>ACL064C [985] [Homologous to ScYLL040C (VPS13) - SH] (239881..249231)
            [9351 bp, 3116 aa]
          Length = 3116

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 41   YKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAI 87
            + N +GSG+         G     EG   F KGLG  +IG+  K AI
Sbjct: 2912 FMNTIGSGISGVALDPYKGA--SKEGTTGFLKGLGKGIIGLPTKTAI 2956

>YNL122C (YNL122C) [4473] chr14 complement(398023..398370) Protein
           of unknown function [348 bp, 115 aa]
          Length = 115

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 12/71 (16%)

Query: 175 VSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDT 234
           +SL   RQ  +Q  N +V++ LK  L+G +      S++  L G +      F+N    T
Sbjct: 3   ISLHNKRQRGDQNQNMSVFNVLKPLLKGSN------SFKVKLNGFL------FNNVSTIT 50

Query: 235 IKTRLQKDKST 245
           I+T ++  K T
Sbjct: 51  IRTLMKTHKGT 61

>YLL040C (VPS13) [3381] chr12 complement(54210..63644) Protein
            involved in vacuolar sorting [9435 bp, 3144 aa]
          Length = 3144

 Score = 28.9 bits (63), Expect = 6.6,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 39   QIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89
            Q + + +GSG+   G      +  + EG   F KGLG  ++G+  K AI F
Sbjct: 2940 QSFASTLGSGLS--GIALDPYKAMQKEGAAGFLKGLGKGIVGLPTKTAIGF 2988

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,780,148
Number of extensions: 344126
Number of successful extensions: 2540
Number of sequences better than 10.0: 218
Number of HSP's gapped: 1304
Number of HSP's successfully gapped: 557
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)