Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F02684g77973031350.0
AEL233C7934696311e-70
Kwal_47.182467734254431e-45
Scas_699.297166544304e-44
CAGL0H08261g7343324031e-40
CAGL0M08954g8504344006e-40
YOR019W7303023834e-38
Scas_660.307743023755e-37
YDR475C8762652954e-27
CAGL0F07975g7701951463e-09
Kwal_14.10286802051293e-07
Scas_595.137661881266e-07
KLLA0E15642g7662171212e-06
YGR237C7852141204e-06
ADL147W62642960.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F02684g
         (767 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F02684g 242962..245301 some similarities with sgd|S0005545 ...  1212   0.0  
AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH] (1...   247   1e-70
Kwal_47.18246                                                         175   1e-45
Scas_699.29                                                           170   4e-44
CAGL0H08261g 810168..812372 weakly similar to tr|Q99248 Saccharo...   159   1e-40
CAGL0M08954g 890764..893316 weakly similar to tr|Q99248 Saccharo...   158   6e-40
YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unkno...   152   4e-38
Scas_660.30                                                           149   5e-37
YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Prote...   118   4e-27
CAGL0F07975g complement(782229..784541) similar to sp|P50089 Sac...    61   3e-09
Kwal_14.1028                                                           54   3e-07
Scas_595.13                                                            53   6e-07
KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089 Saccha...    51   2e-06
YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein...    51   4e-06
ADL147W [1594] [Homologous to ScYGR237C - SH] complement(431887....    42   0.002

>KLLA0F02684g 242962..245301 some similarities with sgd|S0005545
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 779

 Score = 1212 bits (3135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/730 (83%), Positives = 606/730 (83%)

Query: 1   MLEKTDPFYYKRVKFCLCDHCTEGSEELQXXXXXXXXXXXXXXXXXXXGAGEKLVPTVSW 60
           MLEKTDPFYYKRVKFCLCDHCTEGSEELQ                   GAGEKLVPTVSW
Sbjct: 1   MLEKTDPFYYKRVKFCLCDHCTEGSEELQRYKSNYSSDSRSSVDSLLNGAGEKLVPTVSW 60

Query: 61  DTVPIEGVSNEESGYDSDPHNLDYALDRFYXXXXXXXXXXXXXXSSRTHLGITPTLTDRV 120
           DTVPIEGVSNEESGYDSDPHNLDYALDRFY              SSRTHLGITPTLTDRV
Sbjct: 61  DTVPIEGVSNEESGYDSDPHNLDYALDRFYDSDDSHDDIRHGRGSSRTHLGITPTLTDRV 120

Query: 121 RGSSPMRPRQNNDFTFQLDVGGSSNNPKIFFGPNGEIRRRDYPSRPVLFNNALIRTQYHK 180
           RGSSPMRPRQNNDFTFQLDVGGSSNNPKIFFGPNGEIRRRDYPSRPVLFNNALIRTQYHK
Sbjct: 121 RGSSPMRPRQNNDFTFQLDVGGSSNNPKIFFGPNGEIRRRDYPSRPVLFNNALIRTQYHK 180

Query: 181 DWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDLTDAPLVNDNGEMIQKERRASI 240
           DWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDLTDAPLVNDNGEMIQKERRASI
Sbjct: 181 DWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDLTDAPLVNDNGEMIQKERRASI 240

Query: 241 KRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWX 300
           KRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDW 
Sbjct: 241 KRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFGTDDDQPDATWCDGCTVGEVNDLLQRLI 360
                                         EFGTDDDQPDATWCDGCTVGEVNDLLQRLI
Sbjct: 301 TRSGSYTRSRSASRSRSRSRSRMRSVSRTREFGTDDDQPDATWCDGCTVGEVNDLLQRLI 360

Query: 361 EYSTLIMGGKKLKITVEIVIGSTSQILIDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRH 420
           EYSTLIMGGKKLKITVEIVIGSTSQILIDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRH
Sbjct: 361 EYSTLIMGGKKLKITVEIVIGSTSQILIDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRH 420

Query: 421 LAPVLMQYFPIPVFFVAARRMGWFEKKLQRDILFKQRVLPSDKDTDLXXXXXXXXXXXXX 480
           LAPVLMQYFPIPVFFVAARRMGWFEKKLQRDILFKQRVLPSDKDTDL             
Sbjct: 421 LAPVLMQYFPIPVFFVAARRMGWFEKKLQRDILFKQRVLPSDKDTDLDVSSFSVSTTETD 480

Query: 481 XXXXXXXXXXXXXXXXXNLSLGNREKTVKQIQKLRHNYRCLVXXXXXXXXXXTGLPTPEQ 540
                            NLSLGNREKTVKQIQKLRHNYRCLV          TGLPTPEQ
Sbjct: 481 DTENEDTDDDDDVETTSNLSLGNREKTVKQIQKLRHNYRCLVDKKLKLLDEDTGLPTPEQ 540

Query: 541 YYGKMDSIINATLNFNKELETWGDSADMAEIKRSITGGVRPRVMKKKSMLDFSDLPPKRK 600
           YYGKMDSIINATLNFNKELETWGDSADMAEIKRSITGGVRPRVMKKKSMLDFSDLPPKRK
Sbjct: 541 YYGKMDSIINATLNFNKELETWGDSADMAEIKRSITGGVRPRVMKKKSMLDFSDLPPKRK 600

Query: 601 SKIPTEHENSKETMDFNQNTFKNXXXXXXXXXXXXXXXXXXXXANNGEGGIKFANSVKSK 660
           SKIPTEHENSKETMDFNQNTFKN                    ANNGEGGIKFANSVKSK
Sbjct: 601 SKIPTEHENSKETMDFNQNTFKNKKLPKVVLSSPPPSRPVSPLANNGEGGIKFANSVKSK 660

Query: 661 DGKGAIQRIKSYDPYSQNSDPFDREDSALSLSVVRSHQPKSDSTSLRKVLSTTSLDKKES 720
           DGKGAIQRIKSYDPYSQNSDPFDREDSALSLSVVRSHQPKSDSTSLRKVLSTTSLDKKES
Sbjct: 661 DGKGAIQRIKSYDPYSQNSDPFDREDSALSLSVVRSHQPKSDSTSLRKVLSTTSLDKKES 720

Query: 721 KKGRLLSFLF 730
           KKGRLLSFLF
Sbjct: 721 KKGRLLSFLF 730

>AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH]
           (193752..196133) [2382 bp, 793 aa]
          Length = 793

 Score =  247 bits (631), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 149/469 (31%), Positives = 227/469 (48%), Gaps = 47/469 (10%)

Query: 9   YYKRVKFCLCDHCTEGSEELQXXXXXXXXXXXXXXXXXX--XGAGEKL------------ 54
           +YK V+ C C  C E     +                     G GE +            
Sbjct: 11  WYKDVRLCGCRQCCEAVRRKRQGSSGSCGMGEHGQYLDEGYEGRGEHVRSSSAHSGSGGH 70

Query: 55  -VPTVSWDTVPIEGVSNEESGYDS-DPH------NLDYALDRFYXXXXXXXXXXXXXXSS 106
            VPT+S+DTVPI+G+S EE   D+   H      +LDY L+ +Y                
Sbjct: 71  FVPTISFDTVPIQGISPEEDEQDALHEHQRAYGTSLDYTLEEYYNNEDTSYNHDY----- 125

Query: 107 RTHLGITPTLTDRVRGSSPMRPRQNNDFTFQLDVGGSSNNPKIFFGPNGEIRRRDYPSRP 166
           R+  G    L+  +R  SP R             G  +   K    P+G   R DYPS+ 
Sbjct: 126 RSGGGYAGELSP-LRSLSPSR------------YGSGAQLAKFDVLPDGRRVRIDYPSKS 172

Query: 167 VLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDLTDAPLVN 226
            L +++ +  + H++W+ +W+ R  ++E RK      ++++P ILFP+ KVDL+D P++N
Sbjct: 173 TLLSDSFVLNKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILFPETKVDLSDLPMIN 232

Query: 227 DNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDID 286
           D G      +RA++KR  +VVRTPVG   +PR +L H+SGR+HTW A+DW +     D D
Sbjct: 233 DEGVAYNSNQRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHTWAAVDWVLQNFIADSD 292

Query: 287 YIVIIANIPRRDWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFGTDDDQP-----DA 341
           ++V++AN+PR                                   FG+D  +      D 
Sbjct: 293 HLVVVANLPRLMSRFGYMSRSVSRSRSRSRSRSVRRTTGLNSTSSFGSDVSESMTKNKDE 352

Query: 342 TWCDGCTVGEVNDLLQRLIEYSTLIMGGK-KLKITVEIVIGSTSQILIDSLNAYAPDFFV 400
            WC+G TVG +  +L  LIEY T I+  K  +K+TVE++IG T Q+LI++LN + PD  V
Sbjct: 353 EWCNGYTVGSIETILDHLIEYITFIIPEKLAIKVTVEVMIGKTRQVLIEALNLHCPDLLV 412

Query: 401 IGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQ 449
             ++  K   G ++ H+S+ L  VL  Y+P+PVF V A+RM     +L+
Sbjct: 413 ASTTKYKENDG-LLDHRSKRLTTVLANYYPLPVFVVPAKRMFLLGMQLE 460

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 4/100 (4%)

Query: 508 VKQIQKLRHNYRCLVXXXXXXXXXXTGLPTPEQYYGKMDSIINATLNFNKELETWGDSAD 567
           V ++ ++R  YR  V          + L   E+++ K+D++INA+L FNKELE    S  
Sbjct: 548 VGRVARMRETYRRRVQKRFSKIDSDSTLQADERHFNKLDAVINASLKFNKELEN-SKSPS 606

Query: 568 MAEIKRSITGGVRPRVMKKKSMLDFSDLP---PKRKSKIP 604
           + E++R ITGG +    +KKSMLD  DLP   P+++  IP
Sbjct: 607 ILELQRIITGGEKHTGFRKKSMLDVLDLPSAKPRKQDPIP 646

>Kwal_47.18246
          Length = 773

 Score =  175 bits (443), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/425 (28%), Positives = 201/425 (47%), Gaps = 49/425 (11%)

Query: 51  GEKLVPTVSWDTVPI-EGVSNEE--SGYDSDPHNLDYALDRFYXXXXXXXXXXXXXXSSR 107
           G   VP VS+DTVP+  G + E+   G+ SD H L+Y  + FY                 
Sbjct: 44  GSNFVPGVSFDTVPLLAGTACEDFDEGHCSD-HTLEYTEEEFYDNECSPDF--------- 93

Query: 108 THLGITPTLTDRV-------RGSSPMRPRQNNDFTFQLDVGGSSNN-PKIFFGPNGEIRR 159
               + P+  DR+       R SSP+R +     +    +  + N    I  G +G I R
Sbjct: 94  ----LRPSGNDRLMVPFSHSRSSSPLRGQSGTSMSL---IDSTMNGLDGIHVGADGRITR 146

Query: 160 RDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDL 219
            DYPSRP + N+AL+  + HKD+   W +R E++++R  +    +F FP+ILFP  KV  
Sbjct: 147 TDYPSRPTIVNDALVINRTHKDYSALWLKRKEQIDQRLRSR-EAHFVFPDILFPPEKV-- 203

Query: 220 TDAPLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMA 279
            + PL +    + ++ERR ++     ++   +G   +PRTIL +ISGR+HTWV+LDW + 
Sbjct: 204 ANLPLSDGYTPLSKEERRKAL-----IIGKKIGYPNSPRTILCYISGRKHTWVSLDWLLK 258

Query: 280 ELAEDIDYIVIIANIPRRD--------WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 331
             ++D+D++VII N+P+                                           
Sbjct: 259 RFSQDVDHLVIITNLPKMSNHRSRSRSRSRSTAPRSRSAAPSTHSSSGVSSIQRTLSADG 318

Query: 332 FGTDDDQPDATWCD---GCTVGEVNDLLQRLIEYSTLIM-GGKKLKITVEIVIGSTSQIL 387
            G  +      W +   G    ++ + L  ++ Y T I+   + +K+TVEIVIG   +I+
Sbjct: 319 HGDHNKHVHEHWLEWASGYDADQIKETLNNILRYVTTILPDHRAVKVTVEIVIGKLQKIV 378

Query: 388 IDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKK 447
           +D++N Y PD  V+ SS+      S+V  KS  +   + Q  PIP+  V  ++M   E +
Sbjct: 379 VDAINVYGPDLIVL-SSLRSKPDESLVRWKSNGVNDKICQTLPIPILLVPVKKMLELENE 437

Query: 448 LQRDI 452
           +  +I
Sbjct: 438 VFNEI 442

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 69/154 (44%), Gaps = 34/154 (22%)

Query: 533 TGLPTPEQYYGKMDSIINATLNFNKELETWGDSAD-MAEIKRSITGGV-RPRVMKKKSML 590
           T L + E+   K+DSI NA+L+F  EL+  G S +   E+KR ITG   R  V  KKSML
Sbjct: 540 TRLSSEEKIILKLDSITNASLHFINELDDKGRSTESFEELKRVITGDTNRDTVRAKKSML 599

Query: 591 DFSDLP----PKRKSKIPTEHENSK-ETMDFNQNTFKNXXXXXXXXXXXXXXXXXXXXAN 645
           D  +       K  ++   +  NS+  T+ F++++                         
Sbjct: 600 DVGNSSMLDVGKSSNQTSNKQGNSQVPTIFFDEDSISPVKKSSQ---------------- 643

Query: 646 NGEGGIKFANSVKSKDGKGA------IQRIKSYD 673
                IKFA+SVK  DGK        I+R  SYD
Sbjct: 644 -----IKFASSVKRNDGKEGHTESKPIERSISYD 672

>Scas_699.29
          Length = 716

 Score =  170 bits (430), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 168/654 (25%), Positives = 257/654 (39%), Gaps = 129/654 (19%)

Query: 143 SSNNPK-------IF-FGPNGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKME 194
           SS NPK       +F     G+I R DYPSRP++ N A+I T+    W+ +WR+R + +E
Sbjct: 82  SSKNPKRQKSMNEMFKMAQGGKIVRVDYPSRPMVDNEAMIMTKKQPLWRKKWRERKKIIE 141

Query: 195 ERKETGVSTYFKFPEILFPKVKVDLTDAPLVNDNGEMIQKE-----------------RR 237
            R++    + FK+  ILFP  +           +G  ++K                  + 
Sbjct: 142 ARRKCDGDSVFKYRFILFPHEEKQKEG----KGSGGTLKKRYMGLSNNSSHSSSKTDVKL 197

Query: 238 ASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRR 297
              KR  +V+   +G    PRTI+ HISGR HTWVALDW   EL +D D++VI+AN+PR 
Sbjct: 198 KEQKRQKEVINLKIGDTNLPRTIVCHISGRRHTWVALDWLFKELVQDTDHVVILANLPRM 257

Query: 298 DWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFGTDDDQP---DATWCDGCTVGEVND 354
                                                  D+P   +  W  G +   V  
Sbjct: 258 VCRSKVAPDTKKII------------------------QDEPKLLEEEWTSGYSENLVAS 293

Query: 355 LLQRLIEYSTLIMG-GKKLKITVEIVIGSTSQILIDSLNAYAPDFFVIGSSIDKYGSGSV 413
            + R++EY +LI+   K +KITVEI IG T ++LID++N Y P+ FV G ++    + ++
Sbjct: 294 RIARILEYISLILPVDKSIKITVEIAIGKTKKVLIDAINIYTPNLFVFG-TLKWSKTENL 352

Query: 414 VVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQRDIL-------FKQR--------- 457
           + +KS  L      ++PIP F V ARRM  FE  LQ           FK+          
Sbjct: 353 ISYKSNILMDTFCVHYPIPTFIVPARRMSKFELSLQEQFANCEQQKSFKKNNHVDKVNKN 412

Query: 458 ----VLPSDKDTDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNL-SLGNREKTVKQIQ 512
               +L       L                               L S  N+  T   + 
Sbjct: 413 QQSIMLAVQSQDSLTAGYESSTETDSLDSVEKTSDDKDDNESVDTLRSYSNQTGTRANLC 472

Query: 513 KLRHNYR-CLVXXXXXXXXXXTGLPTPEQYYGKMDSIINATLNFN------KELETWGDS 565
            +  +YR  ++            L   E+  GK+D II A++          E     ++
Sbjct: 473 NIARDYRHSMLKELNTLEANKKKLTNQERQLGKLDIIIKASIRLVLKTDEIDEQSIATNN 532

Query: 566 ADMAEIKRSITGGVRPRVMKKKSMLDFSDLPPKRKSKIPTEHENSKETMDFNQNTFKNXX 625
            D   +K +ITGG      + +SMLD +   P+ ++K                       
Sbjct: 533 KDYMNLKTTITGGKSRSQSRPRSMLDVNGYDPRAETK----------------------- 569

Query: 626 XXXXXXXXXXXXXXXXXXANNGEGGIKFANSVKSKDGKGAIQRIK------SYDPYSQNS 679
                              + G   I+FA +V  KDGK A+  IK      +  P S+  
Sbjct: 570 ---------QSELGATLYQSRGSSQIRFAGNVNPKDGKSALGTIKKPQSGGASIPSSKYI 620

Query: 680 DPFDREDSALSLSVVRSH---QPKSDSTSLRKVLSTTSL-DKKESKKGRLLSFL 729
             +   D  + L  ++S     P+  S S R   S+ S+ +K + K G  LS  
Sbjct: 621 SDYSYND-VIPLRKIKSTGGLHPRKSSESTRSTASSKSVGEKTKPKSGGFLSLF 673

>CAGL0H08261g 810168..812372 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 734

 Score =  159 bits (403), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/332 (32%), Positives = 164/332 (49%), Gaps = 60/332 (18%)

Query: 138 LDVGGSSNNP--------KIF-FGPNGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQ 188
            D    +NNP         +F +  +G+I R DYP++PV  N  +IR++ +  W   W Q
Sbjct: 114 FDASPLANNPLSLTRSKKSVFNYTADGKIIRSDYPTKPVFVNKIIIRSRTNVHWDERWAQ 173

Query: 189 RVEKMEERKETGVSTYFKFPEILFPKVKVDLTDAPLV-NDNGEMIQKERRASIKRHLKVV 247
           R  K+E   E      F +P+ILFP+VK    + PL+  D+   I KE+R    R  K++
Sbjct: 174 RKSKIEYNMEHK-DEKFMYPDILFPEVK----EKPLIMGDDFVPITKEQR----RRNKIL 224

Query: 248 RTPVGLVKTPRTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXX 307
                    PRT++ +ISGR HTW  LDWA+  LAE+ D++VI+A IP+           
Sbjct: 225 TIKQAHPTLPRTVVCYISGRRHTWAGLDWAVRSLAEN-DHLVIVATIPKMT--------- 274

Query: 308 XXXXXXXXXXXXXXXXXXXXXXXEFGTDDDQP--DATWCDGCTVGEVNDLLQRLIEYSTL 365
                                       D +P  D TW  G T  E++ ++  L EY  +
Sbjct: 275 -------------------------SHRDQEPEVDGTWVSGYTFDEIDTIISDLFEYIKV 309

Query: 366 IMG-GKKLKITVEIVIGSTSQILIDSLNAYAPDFFVIGS-SIDKYGSGSVVVHKSRHLAP 423
           I    K LK+T+EI I  T   LID++N Y+PDF ++G+    +Y   ++V ++  ++  
Sbjct: 310 IKPVHKALKVTIEISIERTKGALIDAINVYSPDFLILGTLKWQRY--ENLVSYRGNNMVD 367

Query: 424 VLMQYFPIPVFFVAARRMGWFEKKLQRDILFK 455
            L   FPIP F V ARR+   EK+++ + L K
Sbjct: 368 KLCTTFPIPTFIVPARRLFMLEKEIEEETLTK 399

>CAGL0M08954g 890764..893316 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 850

 Score =  158 bits (400), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 121/434 (27%), Positives = 198/434 (45%), Gaps = 41/434 (9%)

Query: 50  AGEKLVPTVSWDTVPIEGVSNEESGYDSDPHNL-----DYALDRFYXXXXXXXXXXXXXX 104
           A  K+ P VS++TVP+         Y+ D   +     +Y ++ +Y              
Sbjct: 75  ANAKVRPCVSFNTVPLPSKHTLLDEYEQDFPGVQLFPQEYTMEEYYDDESGYVSEDNQNY 134

Query: 105 SSRTHLGITPTLTDRV------RGSSPMRPRQNNDFTF-----QLDVGGSSNNPKIF-FG 152
                  ITP + +R+      R SSP  P  + ++       ++     +N  K+F   
Sbjct: 135 MLHNSY-ITPEIVERLNKNATTRSSSP--PPLDREYPSAGKQKKMSSKQQANITKMFKIA 191

Query: 153 PNGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILF 212
            NG I R DYPSRP L N+A I  +   DW + WR R   +E+RKE  +S  F++P++LF
Sbjct: 192 KNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWRSRRHTIEQRKE-DLSETFEYPQLLF 250

Query: 213 PKVKVDLTDAPLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWV 272
           P+         ++ ++ + + KE+R   K   K + +  G    PR +L HISG+ HTWV
Sbjct: 251 PQQTKPSEPVIMMGEDYKPLTKEQRKKEKIIHKKIESTSG----PRVVLCHISGKRHTWV 306

Query: 273 ALDWAMAELAEDIDYIVIIANIPR--------RDWXXXXXXXXXXXXXXXXXXXXXXXXX 324
            LDW +  L+ D D+IV++A+IPR                                    
Sbjct: 307 GLDWTIKRLSNDGDHIVVLAHIPRMISSRRLITSASASRSRSRTRSRSRDVNRKAYNKGD 366

Query: 325 XXXXXXEFGTDDD------QPDATWCDGCTVGEVNDLLQRLIEY-STLIMGGKKLKITVE 377
                   G D++      +    W  G +  +V   ++ + +Y + ++   + +KITVE
Sbjct: 367 YEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTMENIFDYIANILPEERSVKITVE 426

Query: 378 IVIGSTSQILIDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVA 437
           +V+G+    +ID+ NAY PD  V  S++    + ++V+ KS  L   L   FP+P+F V 
Sbjct: 427 VVVGAALHTIIDATNAYQPDLMV-ASTLRWERTDNLVLWKSNLLIDKLATVFPLPLFVVP 485

Query: 438 ARRMGWFEKKLQRD 451
           ARRM  FE  L+ +
Sbjct: 486 ARRMFLFEHGLEEE 499

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 92/230 (40%), Gaps = 41/230 (17%)

Query: 502 GNREKTVKQIQKLR-HNYRCLVXXXXXXXXXXTGLPTPEQYYGKMDSIINATLNFNKELE 560
           GN + TV++   L+  +YR               +   E    K+++IIN T+ F+  +E
Sbjct: 603 GNDKLTVREKLHLKARSYRLQTAQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLAIE 662

Query: 561 TWGDSAD------MAEIKRSITGG--VRPRVMKKKSMLDFSDLPPKRKSKIPTEHENSKE 612
             G  +D      + ++KR ITGG  + P+   KKSML   D P   + K       S  
Sbjct: 663 DLGSESDDDDDVGLTKLKRVITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSL----SAT 718

Query: 613 TMDFNQNTFKNXXXXXXXXXXXXXXXXXXXXANNGEGGIKFANSVKSKDGKGAI-QRIKS 671
           T   + N                               IKFA+SVK KDG  A+   +  
Sbjct: 719 TSGVSGNRVPRSSQ------------------------IKFASSVKHKDGNNALGNSVVH 754

Query: 672 YDPYSQNSDPFDREDSALSLSVVRSHQP-KSDSTSLRKVLSTTSLDKKES 720
             P  Q       EDS+  L+ +RS+    S+   L+ + S  SL + +S
Sbjct: 755 TKPQIQVHAA--SEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNSLRRVKS 802

>YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unknown
           function [2193 bp, 730 aa]
          Length = 730

 Score =  152 bits (383), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 154/302 (50%), Gaps = 45/302 (14%)

Query: 154 NGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFP 213
           NG+I RRDYPS PV+ N  L+  ++ K+W   WRQR  ++ ER       +F +PE++F 
Sbjct: 145 NGKIVRRDYPSTPVIVNETLMINRFEKNWIKLWRQRKLQINERLNDK-KKWFTYPELIFS 203

Query: 214 KVKVDLTDAPLV-NDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWV 272
           + ++     PL   D+     KE+    KR  K+++  VG    P+TI+ HI+G++HTWV
Sbjct: 204 EERI----KPLYRGDDSAPCTKEQ----KRKHKILQQKVGYPNNPKTIVCHINGKKHTWV 255

Query: 273 ALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEF 332
           ALDW + + A ++D+IV+I  +P+                                  + 
Sbjct: 256 ALDWTVYKFARNLDHIVVITTLPK----------------------------MISNRKKT 287

Query: 333 GTDDDQPDATWCDGCTVGEVNDLLQRLIEYSTLIMGGKKL--KITVEIVIGSTSQILIDS 390
             DD +    W  G     ++  L  + +Y   ++   K+  KIT+EI++G   + L+D 
Sbjct: 288 AKDDTE----WAPGYQKEVIDQKLNDIFDYILQLVKVVKISVKITLEIIVGKIKKSLVDV 343

Query: 391 LNAYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQR 450
           +N + PDF V+  ++    + +++ +KS+ L  V    +PIP F V ++RM  FE  LQR
Sbjct: 344 INVHTPDFLVLA-TLKHERNENLITYKSKKLTDVFPVSYPIPTFVVPSKRMYSFELNLQR 402

Query: 451 DI 452
           ++
Sbjct: 403 EV 404

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 651 IKFANSVKSKDGKGAIQRIKSYDPYSQNSDPFDREDSALSLSVVRSHQPKSDSTSLRKVL 710
           IKFA SVK KDG+ A+ + ++  P  ++S  FD+E+   S           +S  LRKV 
Sbjct: 585 IKFATSVKHKDGRAALGKARNL-PDIRHSISFDKEN---SFDPSDKSSSVDNSIPLRKVK 640

Query: 711 STTSLDK 717
           S  +L K
Sbjct: 641 SAGALRK 647

>Scas_660.30
          Length = 774

 Score =  149 bits (375), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/302 (31%), Positives = 149/302 (49%), Gaps = 15/302 (4%)

Query: 151 FGPNGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEI 210
              NG+I R DYPSRP L N A++  +   DW   W +R  +++ R E      F++   
Sbjct: 139 IAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWEKRKLQIDSRLEKK-EEVFQYSST 197

Query: 211 LFPKVKVDLTDAPLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHT 270
           LF +   +        D    + KE+    KR  KV+R  VG    PRTIL  +SGR HT
Sbjct: 198 LFSQKNKNNNIP-KKEDPYMPLSKEQ----KRKEKVLREAVGFPTIPRTILCLLSGRRHT 252

Query: 271 WVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 330
           WVALDW +  LA+D D +V++AN+P+                                  
Sbjct: 253 WVALDWTIKCLAQDTDQVVVVANLPK--MIDLSKSNKRGSRSRSRTRSQARSRSSEKLYS 310

Query: 331 EFGTDDDQPDATWCDGCTVGEVNDLLQRLIEYSTLIM--GGKKLKITVEIVIGSTSQILI 388
               D+++    W  G +   +   L+ +  Y ++++    K +KITVE+++G T +IL 
Sbjct: 311 TLPEDEEE----WSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKILC 366

Query: 389 DSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKL 448
           + +NAY PD F+I S++    + S+V  KSR L   +   +P+PV+ V A+RM  FE+KL
Sbjct: 367 EVINAYTPD-FIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERKL 425

Query: 449 QR 450
            +
Sbjct: 426 AK 427

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 19/93 (20%)

Query: 543 GKMDSIINATLNFNKELETWGD------SADMAEIK---RSITGGVRPRVMKKKSMLDFS 593
            K+D +I ++L F+ EL+T  D      +A++  +K   + ++GG +P     +SMLD  
Sbjct: 552 SKLDIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGVSGGAKPM----RSMLDVG 607

Query: 594 DLP----PKRKSKIPTEHENSKETMDFNQNTFK 622
            LP     K  S I T+H  SK  + F+ N+ K
Sbjct: 608 PLPKLKLKKTSSPISTQHHKSK--IQFSANSKK 638

>YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Protein
           of unknown function [2631 bp, 876 aa]
          Length = 876

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 130/265 (49%), Gaps = 40/265 (15%)

Query: 51  GEKLVPTVSWDTVPIEGVSN----EESGYDSDPHNLDYALDRFYXXXXXXXXXXXX---- 102
            EK +P VS++TVP   VS+    E+  +     + DY ++ +Y                
Sbjct: 67  NEKYLPCVSFNTVPRSRVSSPLDEEKREFPGVQISADYTMEEYYDDESGFTSDNNADYFS 126

Query: 103 --XXSSRTHLGITPTLTDRVRGSSPMRPRQNNDFTFQLDVGGSSNNPKIF-FGPNGEIRR 159
               SSR     +P      R SSP    + N     + +G      K+F    NG+I R
Sbjct: 127 GNSYSSRREGSASPG-----RYSSPPPASKRN-----IKIG------KMFKISENGKIVR 170

Query: 160 RDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVDL 219
            DYP+ P   N+AL+ ++ + +W+  W ++  +++ R E     +F +P ILFP  K   
Sbjct: 171 EDYPTTPTDINDALVISRAYANWRQLWIKKKNQIDHRLEQK-RDFFNYPTILFPPNKKKS 229

Query: 220 TDA--------PLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTW 271
           ++         P + D    + K    S KR  +V+   VG   TPRTIL HISGR+HTW
Sbjct: 230 SEGATPTIKFNPPIEDGFTPLTK----SQKRKERVLSEKVGFPNTPRTILCHISGRKHTW 285

Query: 272 VALDWAMAELAEDIDYIVIIANIPR 296
           VALDWA+  L ++ D+IV++AN+PR
Sbjct: 286 VALDWALRTLIQNTDHIVVLANLPR 310

 Score = 82.0 bits (201), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 4/124 (3%)

Query: 343 WCDGCTVGEVNDLLQRLIEYSTLIM-GGKKLKITVEIVIGSTSQILIDSLNAYAPDFFVI 401
           W  G T  E+   LQ L +Y TLI+   + +K+TVEI+IG T + L++++N Y PDFFV 
Sbjct: 378 WTSGYTQNEIERKLQDLFDYVTLIIPQDRSVKVTVEILIGKTKKTLLEAINIYLPDFFV- 436

Query: 402 GSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQRDILFKQRVLPS 461
            S++    + S+V  KS  L   L   FPIP F V A+RM   E  LQ++  FK+  +  
Sbjct: 437 SSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLEIDLQKE--FKEPEVTK 494

Query: 462 DKDT 465
            K+T
Sbjct: 495 QKNT 498

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 68/156 (43%), Gaps = 27/156 (17%)

Query: 533 TGLPTPEQYYGKMDSIINATLNFNKELETWGDSAD---------------MAEIKRSITG 577
           + +P  +++  K++ I+ ++L F+ E+++  DS +                 E+KR ITG
Sbjct: 604 SSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRAHSMESGFEELKRVITG 663

Query: 578 GVRPR--VMKKKSMLDFSDLPPKRKSKIPTEHENSKETMDFNQNTFKNXXXXXXXXXXXX 635
           G  PR     ++SMLD  D P   +SK  +   +     D ++ +               
Sbjct: 664 GAPPRHVATPQRSMLDVLDNPSSSRSKSKSRSSSKSRIRDKSKPS----------SPTAT 713

Query: 636 XXXXXXXXANNGEGGIKFANSVKSKDGKGAIQRIKS 671
                   + +    IKFA+SVK+ DG  A+  IKS
Sbjct: 714 DINSSASASRSRSPQIKFASSVKNVDGNAALGAIKS 749

>CAGL0F07975g complement(782229..784541) similar to sp|P50089
           Saccharomyces cerevisiae YGR237c, start by similarity
          Length = 770

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 24/195 (12%)

Query: 258 RTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXX 317
           RTI+ +ISGR +TW ++DW +  +A D D++VI++ +P  +                   
Sbjct: 316 RTIMCYISGRRYTWSSVDWYIENVAADGDHLVIVSRVPEFEKELETLCNQEKRKSKLQQR 375

Query: 318 XXXXXXXXXXXXXEF---GTDDDQPDATWCDGCTVG--------EVNDLLQRLIEYSTLI 366
                              T    PDA      T+G           ++ + L++Y    
Sbjct: 376 NSDRSDRISVYSESHTLSSTPSSDPDA--VTPSTIGFRAEAIRDRAREVCRELLDYYAYR 433

Query: 367 MGGKKLKITVEIVIG-STSQILIDSLNAYAPDFFVIGS----SIDKYGSGSVVVHKSRHL 421
           +  K  KITVEIV   ST   +  +   YAP+F +I +    +  K+ +G+V       L
Sbjct: 434 LKDKITKITVEIVKSDSTKDAITGAAGVYAPNFQIISTVSTNTQIKFRNGNV------KL 487

Query: 422 APVLMQYFPIPVFFV 436
              +++++P+P F +
Sbjct: 488 PFFVLKHYPMPTFLI 502

>Kwal_14.1028
          Length = 680

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 84/205 (40%), Gaps = 32/205 (15%)

Query: 258 RTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXX 317
           RTI+  ISGR+HTW A+DW +  LA D DY++I   IP  +                   
Sbjct: 308 RTIICSISGRKHTWSAVDWYVKNLARDGDYLIIATRIPVFEESVKRTPAPQTHLTENYDP 367

Query: 318 XXXXXXXXXXXXXEFGTDDDQPDATWCDGCTVGEVNDLLQR-----LIEYSTLIMGGKKL 372
                              ++  +    G  V ++ D+L R     ++ Y    +  K +
Sbjct: 368 RNKNQSR----------SQERKSSITEQGLLVQDI-DILARQKCNDILNYYLDKLSHKCV 416

Query: 373 KITVEIVI-GSTSQILIDSLNAYAPDFFVIGSSID----KYGSGSVVVHKSRHLAPVLMQ 427
           K+TVEI+   ST   L  ++  Y PD  ++ +       K+ +G V       L   LM+
Sbjct: 417 KVTVEIIKDNSTVFALTSAIALYKPDLKIVSTVSTNLHIKFKNGHV------KLPNFLMR 470

Query: 428 YFPIPVF-----FVAARRMGWFEKK 447
           +F +P +     F+    +G  EKK
Sbjct: 471 HFWVPTYVVPYEFIDPALLGEKEKK 495

>Scas_595.13
          Length = 766

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 18/188 (9%)

Query: 258 RTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXX 317
           RT+  +ISGR  TW  +DW +  +A+D D+++I+  IP  +                   
Sbjct: 337 RTVSCYISGRRFTWATVDWYIENIAKDGDHVIIMTCIPEFE---TLVEKANYQAFRDRLN 393

Query: 318 XXXXXXXXXXXXXEFGTDDDQPDATWCDGCTV----GEVNDLLQRLIEYSTLIMGGKKLK 373
                        +   + D  ++   +G  +     E     ++++ Y    +  KK+K
Sbjct: 394 SDGTSPSISRSSKDSSFNKDGYESKISEGLYIEAIYQEARTKCRQILNYYAKRLENKKVK 453

Query: 374 ITVEIVIGSTSQILIDSLNA-YAPD---FFVIGSSID-KYGSGSVVVHKSRHLAPVLMQY 428
           IT+E+V  ++S+  ++++ A Y P+   F  + ++I  K+ +G+V           +M++
Sbjct: 454 ITIEMVKDNSSKRAVNAIEALYRPNLQLFSTVSTNIQIKFRNGNV------KFPFFIMKH 507

Query: 429 FPIPVFFV 436
           F IPVF V
Sbjct: 508 FFIPVFIV 515

>KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089
           Saccharomyces cerevisiae YGR237c singleton, start by
           similarity
          Length = 766

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 91/217 (41%), Gaps = 37/217 (17%)

Query: 258 RTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXX 317
           RT++  ++GR HTW  +DW + E A D D++V+  N+P  +                   
Sbjct: 328 RTVVCFLNGRRHTWATVDWFIKEAARDGDHLVVATNLPMYE----------ELINMLKKN 377

Query: 318 XXXXXXXXXXXXXEFGTDDDQPDATWCD---------GCTVGEVNDL----LQRLIEYST 364
                        EF  D    + T            G  + E++ L     + ++ Y  
Sbjct: 378 ESSETGSTKTKLEEFTFDGKIKNKTPSAVVQLPFRQVGMIINELDQLTRYKCENMLNYYA 437

Query: 365 LIMGGKKLKITVEIVIGSTSQILIDS-LNAYAPDFFVIGS-----SIDKYGSGSVVVHK- 417
                K +KIT+E+V   +++ L+   ++ Y P+F V+ +     SI K+ +G+V +   
Sbjct: 438 AKCQDKVMKITIELVKELSAKPLVTHVMDLYRPNFHVVSTISTNLSI-KFRNGNVKLPNF 496

Query: 418 -SRHL-APVLMQYFPIPVFFVAARRMGWFEKKLQRDI 452
             RHL  P ++    IP  F+    +G  +K + + +
Sbjct: 497 LYRHLWVPTVI----IPFEFIDPYHLGEAKKPMHKTV 529

>YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein of
           unknown function, has weak similarity to uncharacterized
           C. albicans Orf6.794p [2358 bp, 785 aa]
          Length = 785

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 85/214 (39%), Gaps = 23/214 (10%)

Query: 258 RTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRDWXXXXXXXXXXXXXXXXXX 317
           R +  +ISGR +TW ++DW +  L  + D++VII  IP  +                   
Sbjct: 337 RVVSCYISGRRYTWSSVDWYVENLTRNGDHLVIITTIPEFEAKIDTLAYKEKRRHRLERM 396

Query: 318 XXXXXXXXXXXXXEF-GTDDDQPDATWCDGCTV-GEVNDLLQRLIEYSTLIMGGKKLKIT 375
                           G D   P +T      +  E       ++ Y    +  K ++I+
Sbjct: 397 TSNTSESMTTASHSLIGPDLSSPLSTGIRIEAIHNEAKQTCSDILNYYARRLATKIVRIS 456

Query: 376 VEIVI-GSTSQILIDSLNAYAPDFFVIGSSID----KYGSGSVVVHKSRHLAPVLMQYFP 430
           +E+V   ST   +I + + Y P   VI +       K+ +G V       L   LM++F 
Sbjct: 457 IEMVKENSTRSAIISATSLYRPSLQVISTVSANIQIKFRNGKV------KLPFFLMKHFA 510

Query: 431 IPVFFVAARRMGWFEKKLQRDILFKQRVLPSDKD 464
           +P F V       FE  ++ ++L K RV   DKD
Sbjct: 511 MPAFVVP------FE-FIKPELLIKPRV---DKD 534

>ADL147W [1594] [Homologous to ScYGR237C - SH]
           complement(431887..433767) [1881 bp, 626 aa]
          Length = 626

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 257 PRTILVHISGREHTWVALDWAMAELAEDIDYIVIIANIPRRD 298
           PRT+  ++SGR H+W A+D  +   A   D++VI A +P  D
Sbjct: 245 PRTVACYLSGRRHSWSAVDAYINMFARSGDHLVIWAYLPMYD 286

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,349,399
Number of extensions: 838704
Number of successful extensions: 2213
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2248
Number of HSP's successfully gapped: 43
Length of query: 767
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 658
Effective length of database: 12,822,747
Effective search space: 8437367526
Effective search space used: 8437367526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)