Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F02596g65864828090.0
ADR356C8064217526e-89
Kwal_26.70526324686962e-82
Scas_663.247374446752e-78
CAGL0E05302g8294516494e-74
YOR329C (SCD5)8725256428e-73
CAGL0E01595g468103750.59
CAGL0J01892g137456721.5
Sklu_2257.3144542702.7
ABR027C113187693.4
YIR006C (PAN1)148054693.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F02596g
         (648 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F02596g 235864..237840 some similarities with sp|P34758 Sac...  1086   0.0  
ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH] (1333929..1...   294   6e-89
Kwal_26.7052                                                          272   2e-82
Scas_663.24                                                           264   2e-78
CAGL0E05302g complement(514064..516553) weakly similar to sp|P34...   254   4e-74
YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy...   251   8e-73
CAGL0E01595g 152176..153582 similar to sp|Q08271 Saccharomyces c...    33   0.59 
CAGL0J01892g 185011..189135 similar to sp|P32521 Saccharomyces c...    32   1.5  
Sklu_2257.3 YIR006C, Contig c2257 2908-7245                            32   2.7  
ABR027C [618] [Homologous to ScYKL096W (CWP1) - SH] (443071..446...    31   3.4  
YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein in...    31   3.8  

>KLLA0F02596g 235864..237840 some similarities with sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency singleton, hypothetical start
          Length = 658

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/648 (84%), Positives = 550/648 (84%)

Query: 1   MSFDWLNVPGLDISNDSQXXXXXXXXXXXXXXXXTTADRXXXXXXXXXXXXXXXLRGREG 60
           MSFDWLNVPGLDISNDSQ                TTADR               LRGREG
Sbjct: 1   MSFDWLNVPGLDISNDSQASVSSSSPPPAVSFSFTTADRPQEPSNLQQPQSQQSLRGREG 60

Query: 61  NKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDE 120
           NKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDE
Sbjct: 61  NKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDE 120

Query: 121 RKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYA 180
           RKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYA
Sbjct: 121 RKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYA 180

Query: 181 IIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDFD 240
           IIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDFD
Sbjct: 181 IIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDFD 240

Query: 241 GFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAVT 300
           GFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAVT
Sbjct: 241 GFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAVT 300

Query: 301 APDNAAXXXXXXXXXXXXXXXXXMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREVL 360
           APDNAA                 MEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREVL
Sbjct: 301 APDNAASTESSPSDDSTLDLSLPMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREVL 360

Query: 361 EDMKDSLSHFRQIQKVDSVTQLPXXXXXXXXXXXXGREQALEPLKPTATGSANYLFRQTV 420
           EDMKDSLSHFRQIQKVDSVTQLP            GREQALEPLKPTATGSANYLFRQTV
Sbjct: 361 EDMKDSLSHFRQIQKVDSVTQLPNNMSSYESSNSSGREQALEPLKPTATGSANYLFRQTV 420

Query: 421 PPSHNIDANKNDNHILEPLKPTATGSANEIFKNIFRRSKPAEHLPQQGRTAPFVPPQRKV 480
           PPSHNIDANKNDNHILEPLKPTATGSANEIFKNIFRRSKPAEHLPQQGRTAPFVPPQRKV
Sbjct: 421 PPSHNIDANKNDNHILEPLKPTATGSANEIFKNIFRRSKPAEHLPQQGRTAPFVPPQRKV 480

Query: 481 QFTEAMKPTSTGSANYLMKQQFQDLQEFXXXXXXXXXXXXXXXXXXXXXXXINAFQPPNQ 540
           QFTEAMKPTSTGSANYLMKQQFQDLQEF                       INAFQPPNQ
Sbjct: 481 QFTEAMKPTSTGSANYLMKQQFQDLQEFQPFQSALPSQQQQQQQYLSPRPSINAFQPPNQ 540

Query: 541 GQFLQPNAGGLVTSPQPQLSSHSNLSSDGYFSSLIXXXXXXXXXXXXXXXNISNGVNLSA 600
           GQFLQPNAGGLVTSPQPQLSSHSNLSSDGYFSSLI               NISNGVNLSA
Sbjct: 541 GQFLQPNAGGLVTSPQPQLSSHSNLSSDGYFSSLITPSPPMMPTSSPQPQNISNGVNLSA 600

Query: 601 AYQQHIPECGSNLNYQVRPNAVSPRPARSQSDNILDDLKALQQQVDQL 648
           AYQQHIPECGSNLNYQVRPNAVSPRPARSQSDNILDDLKALQQQVDQL
Sbjct: 601 AYQQHIPECGSNLNYQVRPNAVSPRPARSQSDNILDDLKALQQQVDQL 648

>ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH]
           (1333929..1336349) [2421 bp, 806 aa]
          Length = 806

 Score =  294 bits (752), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 174/421 (41%), Positives = 229/421 (54%), Gaps = 65/421 (15%)

Query: 1   MSFDWLNVPGLDISNDSQXXXXXXXXXXXXXXXXTTADRXXXXXXXXXXXXXXXLRGREG 60
           MSFDWLNVPGL++ +                                         G E 
Sbjct: 1   MSFDWLNVPGLNVKD-----------------------------------------GPES 19

Query: 61  NKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDE 120
           +  +    T +F  S+ +         +    D    Y ETA++L+VPL++   QL P+E
Sbjct: 20  SAGSAPPPTVSFNFSEEQREDESAGRRTQ---DTQEEYRETAEDLRVPLSLSGSQLAPEE 76

Query: 121 RKAYLRWFRDL-SSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFY 179
            K Y  W++ + S R        +D+F FL NF++ D++KER   IFRTC+ AV+  QFY
Sbjct: 77  LKTYRLWYKCMVSRRRSRTLRLEEDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQFY 136

Query: 180 AIIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDF 239
           AI+R +AH LQ + LPTR MI E+A V  P+SILS +AG E YEEVEEDP +A D +VDF
Sbjct: 137 AIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYEEVEEDPKSAADNRVDF 196

Query: 240 DGFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAV 299
           D FASLLLTGK ++KNIRR+I KR  ++KKV FS+NLVTF  +L  +  +  +  G    
Sbjct: 197 DSFASLLLTGKTVRKNIRRKINKRNGRVKKVSFSENLVTFHEELPEEEAAEDAADGSEDP 256

Query: 300 TAPDNAAXXXXXXXXXXXXXXXXXMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREV 359
             P + +                 M+QLL K++ R   N+ALV E P   QPET EERE 
Sbjct: 257 NEPLDFS---------------MPMDQLLKKMAERKTRNTALVSEAPK--QPETVEEREE 299

Query: 360 LEDMKDSLSHFRQIQKVDSVTQ---LPXXXXXXXXXXXXGREQALEPLKPTATGSANYLF 416
           L DM+DSL+HF+ IQ  D+V Q                 G E ALEPLKPTATGSAN+LF
Sbjct: 300 LADMRDSLNHFKHIQTADNVAQGSFATQYMASVSSNADSGEEPALEPLKPTATGSANHLF 359

Query: 417 R 417
           R
Sbjct: 360 R 360

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 6/47 (12%)

Query: 602 YQQHIPECGSNLNYQVRPNAVSPRPARSQSDNILDDLKALQQQVDQL 648
           +QQH+P    N   Q   +A  P P ++   NI+ DL+ALQQQVD++
Sbjct: 759 HQQHLPH---NNFLQPPQHASQPLPPKT---NIIGDLRALQQQVDRI 799

>Kwal_26.7052
          Length = 632

 Score =  272 bits (696), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 184/468 (39%), Positives = 264/468 (56%), Gaps = 42/468 (8%)

Query: 1   MSFDWLNVPGLDISNDSQXXXXXXXXXXXXXXXXTTADRXXXXXXXXXXXXXXXLRGREG 60
           MSFDWLNVPGL  S+D                    A                 L   E 
Sbjct: 1   MSFDWLNVPGLP-SDDGDY-----------------AGASEPPPSVSFNFGNVSLEPVEQ 42

Query: 61  NKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDE 120
              +++ +  +  +S  ++  +      H       +Y ET ++LQVPL++ + QLT +E
Sbjct: 43  RSQSITTTKHDRVNSTHEASQVSNRTQDHHGESQLVNYAETKEDLQVPLSLSKSQLTREE 102

Query: 121 RKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYA 180
            + YLRW+  +SSR  ++ I+LDD+F F+ NF + +  KERI  IF+TCR ++N  QF+A
Sbjct: 103 ARTYLRWYGYISSRKEAKLISLDDIFRFMGNFPLAEMAKERIERIFKTCRNSLNIGQFFA 162

Query: 181 IIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDFD 240
           I+RL++  L ++ +P R MI + APV +PKSIL+A   +EVYEEV ED  +  + KVDFD
Sbjct: 163 ILRLISRALTENVMPMRRMISQAAPVPKPKSILAA-GNEEVYEEV-EDSQDGPELKVDFD 220

Query: 241 GFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISR-SGKPAV 299
            FASLLLTG+  +K +RRRI     + K+VRF+  LVTF +    K   + S  +G P  
Sbjct: 221 SFASLLLTGQK-KKKMRRRITNHHKKQKRVRFTDKLVTFQDHAQPKTDENASEGNGVPDD 279

Query: 300 TAPDNAAXXXXXXXXXXXXXXXXXMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREV 359
             P + +                 M+QLL KL++R RNNSALV + PS+ +PE+QEE+EV
Sbjct: 280 NEPLDLS---------------LPMDQLLKKLAAR-RNNSALVSKPPSEQEPESQEEKEV 323

Query: 360 LEDMKDSLSHFRQIQKVDSVTQLPXXXXXXXXXXXXGREQALEPLKPTATGSANYLFRQT 419
           L+DM++SL+HF+QI  VDSV+                 E  LEPLKPTATGSANYLFR +
Sbjct: 324 LDDMRESLNHFQQIHNVDSVSVGGLPAQVSTVQKNAVAENHLEPLKPTATGSANYLFRSS 383

Query: 420 VPPSHNIDANKNDNHILEPLKPTATGSANEIFKNIFRRSKPAEHLPQQ 467
              +  +  ++     L+PLKPTATGSAN +F++  + +  A+  P Q
Sbjct: 384 QQQTPQVTISE----PLQPLKPTATGSANYLFRSSQQSAPAADQKPLQ 427

>Scas_663.24
          Length = 737

 Score =  264 bits (675), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 184/444 (41%), Positives = 255/444 (57%), Gaps = 34/444 (7%)

Query: 83  DGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDERKAYLRWFRDLSSRIHSRPITL 142
           D ++ + S +D  S Y ET+ +L+VPL++ + QLT +E + YLRW+  + ++ H + + L
Sbjct: 72  DTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYIIAKTHGKLVRL 131

Query: 143 DDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYAIIRLVAHGLQQHFLPTRSMIPE 202
            DVF FL NF I D +K RI  IFR+C+ A+N  QF+A++RLV+  L Q+ LPTR MI +
Sbjct: 132 MDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQNVLPTRKMILD 191

Query: 203 KAPVLRPKSI--LSANAGQEVYEEVEEDP------NNATDKKVDFDGFASLLLTGKAIQK 254
           KAP+ +PK I  +S +  QEVYEEV+ED       NN  + KVDFD F SLLLTG+  +K
Sbjct: 192 KAPIPKPKPIITISTDNDQEVYEEVDEDTPNTANGNNNENGKVDFDSFTSLLLTGRTARK 251

Query: 255 NIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAV----TAPDNAAXXXX 310
            IRR+I     + K+VRF+++ +TF      K  S    +   A+    T  +N      
Sbjct: 252 RIRRKIKNAVFKNKRVRFAEH-ITFQE--PPKPNSGNENNNNNAMILNQTTNNNNMDDSS 308

Query: 311 XXXXXXXXXXXXXMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREVLEDMKDSLSHF 370
                        M+QLL +++ R +NNSALV  LP++ Q ET+EE+EVLEDMKDSLSHF
Sbjct: 309 SAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNEQQ-ETEEEKEVLEDMKDSLSHF 367

Query: 371 RQIQKVDSVTQLPXXXXXXXXXXXXG------------REQALEPLKPTATGSANYLFRQ 418
           + I  VDS T LP                          +  L+PLKPTATGSAN+LFRQ
Sbjct: 368 KNITTVDSATLLPDSTSTMQPMYMNNENNALNQNNPSMNQVPLQPLKPTATGSANHLFRQ 427

Query: 419 TVPPSHNIDANKNDNHI-LEPLKPTATGSANEIFKNIFRRSKPAEHLPQQGRTAPFVPPQ 477
               + N +   + N + L+PLKPTATGSAN +F++ F +    +   Q           
Sbjct: 428 EF--AQNTNPISDSNQMPLQPLKPTATGSANYLFRSYFEQPTQNQTTQQAQPPQTN---N 482

Query: 478 RKVQFTEAMKPTSTGSANYLMKQQ 501
                T  + PT+TGSANYLMKQQ
Sbjct: 483 NSNMNTLQLHPTATGSANYLMKQQ 506

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 17/24 (70%), Gaps = 1/24 (4%)

Query: 404 LKPTATGSANYLFRQTVP-PSHNI 426
           L PTATGSANYL +Q  P PS  I
Sbjct: 491 LHPTATGSANYLMKQQGPTPSQGI 514

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 10/11 (90%), Positives = 11/11 (100%)

Query: 1  MSFDWLNVPGL 11
          MSFDWLN+PGL
Sbjct: 1  MSFDWLNIPGL 11

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 484 EAMKPTSTGSANYLMKQQF 502
           + +KPT+TGSAN+L +Q+F
Sbjct: 411 QPLKPTATGSANHLFRQEF 429

>CAGL0E05302g complement(514064..516553) weakly similar to sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency, start by similarity
          Length = 829

 Score =  254 bits (649), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 173/451 (38%), Positives = 251/451 (55%), Gaps = 58/451 (12%)

Query: 73  QDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDERKAYLRWFRDLS 132
           +D +++   I+G  + +   +   SYVET  +L+VPL++ + QLT +E + Y+RW+  ++
Sbjct: 94  EDHKTQKSNINGNRYHNPIHEEEDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYIT 153

Query: 133 SRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYAIIRLVAHGLQQH 192
           +R H + I L DVF FLANF + + +K+RI  IFR+C+ A+N  QF+A++RL+A  + + 
Sbjct: 154 ARTHGKLIKLADVFQFLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLED 213

Query: 193 FLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDP----------NNATDKKVDFDGF 242
            LP+R MI EKAP+ RP+ IL+   G E YEEVEED           N    +KVDFD F
Sbjct: 214 MLPSRKMILEKAPIPRPRPILNKEGGNEFYEEVEEDVPASSGTTTSNNQPPGEKVDFDSF 273

Query: 243 ASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLV-----TFANDLSTKAMSSISRSGKP 297
           ASLLLTGK ++K IRR++     + KKVRF++ +       +  D   K  S+ +     
Sbjct: 274 ASLLLTGKTVRKRIRRKVKNSVFKNKKVRFAEKVTFQDAPHYGKDKQNKDTSTTTDDDSS 333

Query: 298 AVTAPDNAAXXXXXXXXXXXXXXXXXMEQLLAKLSSRNRNNSALVKELPSDTQPETQEER 357
            V+  +                    M+QLL  ++ R +N SALV  +P++ Q ET+EER
Sbjct: 334 YVSTDE-------------PLDLSLPMDQLLKVIAKRKKN-SALVSSVPTEQQ-ETEEER 378

Query: 358 EVLEDMKDSLSHFRQIQKVDSVTQLPXXXXXXXXXXXXGREQALEPLKPTATGSANYLFR 417
           E+L DMKDSLSHF+QIQ  DSVTQ+P            G++  +       TG       
Sbjct: 379 EILSDMKDSLSHFKQIQGPDSVTQIPPLVAQ-------GQQSTIFNTGYKVTGDQ----- 426

Query: 418 QTVPPSHNIDANKNDNHILEPLKPTATGSANEIFKNIFRRSKPAEHLPQQGRTAPFVPPQ 477
              PP+      +    +LEPLKPTATGSAN + K+    +     +P    + P   P 
Sbjct: 427 ---PPAQTTSQPQEP--VLEPLKPTATGSANHLMKSHMSPNS----IPGAFDSQPVQVP- 476

Query: 478 RKVQFT-----EAMKPTSTGSANYLMKQQFQ 503
             +Q T     E +KPT+TGSANYLMKQQF+
Sbjct: 477 -AIQATSSDVLEPLKPTATGSANYLMKQQFK 506

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (87%)

Query: 1  MSFDWLNVPGLDISND 16
          MSFDWLNVPGL+ + D
Sbjct: 1  MSFDWLNVPGLNTATD 16

>YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy
           suppressor of lethality caused by clathrin deficiency
           [2619 bp, 872 aa]
          Length = 872

 Score =  251 bits (642), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 205/525 (39%), Positives = 283/525 (53%), Gaps = 47/525 (8%)

Query: 1   MSFDWLNVPGLDISNDSQXXXXXXXXXXXXXXX-----XTTADRXXX-XXXXXXXXXXXX 54
           MSFDWLNVPGLD+S+  Q                     T A                  
Sbjct: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60

Query: 55  LRGREGNKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEF 114
           L  R  +  T + + +N    Q K +  +G + + S  D+   Y E+ +++QVPL++ + 
Sbjct: 61  LSYRNNHSNTAADNATNVSSPQ-KDNPPNGEVRTLSGGDV---YAESPEDMQVPLSLSQN 116

Query: 115 QLTPDERKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVN 174
           QLT +E + YLRW+  +  R H + + L+DVF FL NF +   +K+RI  IFR+C+ A+N
Sbjct: 117 QLTHEEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALN 176

Query: 175 EEQFYAIIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNAT- 233
             QF+A++RLV+  +    LP R MI EKAPV +P+ ILS+   +EVYEEVE+D ++A  
Sbjct: 177 IGQFFAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILSSENHEEVYEEVEDDDSSAKT 236

Query: 234 -DKKVDFDGFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSIS 292
            D+KVDFD FASLLLTGK  +K +RRRI     + KKVRFS++ +TF +  +    SS +
Sbjct: 237 GDQKVDFDSFASLLLTGKTTRKRVRRRIKNLNFKSKKVRFSEH-ITFQDPPNLNQESSNN 295

Query: 293 RSGKPAVTAPDNAAXXXXXXXXXXXXXXXXXMEQLLAKLSSRNRNNSALVKELPSDTQPE 352
              +     PD A                  M+QLL +L  R R NS LV  LPS+ Q E
Sbjct: 296 SEAR--KQDPD-AEDEDQDSNNDSPLDFTLPMDQLLKRLYKR-RKNSGLVSSLPSEQQ-E 350

Query: 353 TQEEREVLEDMKDSLSHFRQIQKVDSVTQLPXXX----------XXXXXXXXXGREQALE 402
           T+EE++VLEDMKDSLSHF+QIQ VDS + LP                       ++  LE
Sbjct: 351 TEEEKKVLEDMKDSLSHFKQIQTVDSAS-LPISSVFLQNGNTLPTSNVNNTTVPQQLPLE 409

Query: 403 PLKPTATGSANYLFRQTVPPSHNIDANKNDNHI---LEPLKPTATGSANEIFKNIFRRSK 459
           PLKPTATGSAN+L R+     +N   + ++  I   L+PLKPTATGSAN + +       
Sbjct: 410 PLKPTATGSANHLVRE----EYNQGLHPSNGAIQTGLQPLKPTATGSANYLMR------- 458

Query: 460 PAEHLPQQGRTAPFVPPQRKVQFT--EAMKPTSTGSANYLMKQQF 502
              H+ Q     P   P+        + +KPT+TGSANYLMKQ  
Sbjct: 459 --SHMEQPQSIKPSSTPETVTNSGGLQPLKPTATGSANYLMKQHI 501

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (80%)

Query: 400 ALEPLKPTATGSANYLFRQTVPPSHN 425
            L+PLKPTATGSANYL +Q + PS N
Sbjct: 481 GLQPLKPTATGSANYLMKQHISPSVN 506

>CAGL0E01595g 152176..153582 similar to sp|Q08271 Saccharomyces
           cerevisiae YOL132w, start by similarity
          Length = 468

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 1/103 (0%)

Query: 203 KAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDFDGFASLLLTGKAIQKNIRRRIMK 262
           +  VL  K + +  +G  VYE  +E PNN    K++ DG   +L     +Q+  ++  + 
Sbjct: 279 EVEVLYSKEMYTVFSGGLVYEYSQE-PNNYGLVKINHDGSVRMLPDFVTLQEKYKKIALP 337

Query: 263 RRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAVTAPDNA 305
            RDQ+ K    +++    N L      ++  SGK     P  A
Sbjct: 338 NRDQLHKELEGQSIGLKRNVLCLDKYENLEISGKTENDIPAKA 380

>CAGL0J01892g 185011..189135 similar to sp|P32521 Saccharomyces
           cerevisiae YIR006c PAN1, hypothetical start
          Length = 1374

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 16/56 (28%)

Query: 398 EQALEPLKPTATGSANYLFRQTVPPSHNIDANKNDNHILEPLKPTATGSANEIFKN 453
           +Q+++PL P  TG     +RQ   P            +LEPLKPTATG  N    N
Sbjct: 147 QQSVQPLLPQQTG----FYRQGNQP------------VLEPLKPTATGFVNSFANN 186

>Sklu_2257.3 YIR006C, Contig c2257 2908-7245
          Length = 1445

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 372 QIQKVDSVTQLPXXXXXXXXXXXXGREQALEPLKPTATGSAN 413
           Q QK  S +Q P            G++Q LEPLKPTATG  N
Sbjct: 131 QTQKTGSYSQQPLQPQQTGFYSQ-GQQQPLEPLKPTATGFVN 171

>ABR027C [618] [Homologous to ScYKL096W (CWP1) - SH]
           (443071..446466) [3396 bp, 1131 aa]
          Length = 1131

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 8/87 (9%)

Query: 400 ALEPLKPTATGSANYLFRQTVPPSHNIDANK-NDNHILEPLKPTATGSANEIFKNIFRRS 458
           A+ P KPT +G         VPP     + K  ++ ++ P KPT +G        +    
Sbjct: 323 AVPPPKPTTSGKPGPSTTAVVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVVPPP 382

Query: 459 KPAEHLPQQGRTAP---FVPPQRKVQF 482
           KP       G+  P    VPP +   F
Sbjct: 383 KPT----TSGKPGPSTTAVPPPKPTTF 405

>YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein
           involved in organization of the actin cytoskeleton and
           in endocytosis, binds to the ARP2/3 complex to stimulate
           actin polymerization [4443 bp, 1480 aa]
          Length = 1480

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 25/54 (46%), Gaps = 15/54 (27%)

Query: 400 ALEPLKPTATGSANYLFRQTVPPSHNIDANKNDNHILEPLKPTATGSANEIFKN 453
           +L+PLKP  TG   YL  Q   P             LEPLKPTATG  N    N
Sbjct: 212 SLQPLKPQQTGF--YLQPQNQAP-------------LEPLKPTATGFVNSFANN 250

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,156,999
Number of extensions: 709364
Number of successful extensions: 2099
Number of sequences better than 10.0: 15
Number of HSP's gapped: 2103
Number of HSP's successfully gapped: 32
Length of query: 648
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 540
Effective length of database: 12,857,365
Effective search space: 6942977100
Effective search space used: 6942977100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)