Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F02552g1281266242e-85
Kwal_26.70422261262521e-27
CAGL0A01914g374398602.8
Kwal_56.2367839549576.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F02552g
         (126 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F02552g 230803..231189 weakly similar to sp|P38745 Saccharo...   244   2e-85
Kwal_26.7042                                                          101   1e-27
CAGL0A01914g 190454..201685 highly similar to sp|P38811 Saccharo...    28   2.8  
Kwal_56.23678                                                          27   6.4  

>KLLA0F02552g 230803..231189 weakly similar to sp|P38745
           Saccharomyces cerevisiae YHL017w, start by similarity
          Length = 128

 Score =  244 bits (624), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MGLPVFSSYSLATSSTKDSMISTSVSLTLMIALGSSNFNKDSRTKECKTGLYSSFLEEIC 60
           MGLPVFSSYSLATSSTKDSMISTSVSLTLMIALGSSNFNKDSRTKECKTGLYSSFLEEIC
Sbjct: 1   MGLPVFSSYSLATSSTKDSMISTSVSLTLMIALGSSNFNKDSRTKECKTGLYSSFLEEIC 60

Query: 61  FNSALVFSKMLSNTSSLVPNTFNLILLAIVDFTICCFKAAFFILEAMLLSMALVSLRTRP 120
           FNSALVFSKMLSNTSSLVPNTFNLILLAIVDFTICCFKAAFFILEAMLLSMALVSLRTRP
Sbjct: 61  FNSALVFSKMLSNTSSLVPNTFNLILLAIVDFTICCFKAAFFILEAMLLSMALVSLRTRP 120

Query: 121 VFSISY 126
           VFSISY
Sbjct: 121 VFSISY 126

>Kwal_26.7042
          Length = 226

 Score =  101 bits (252), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 77/126 (61%)

Query: 1   MGLPVFSSYSLATSSTKDSMISTSVSLTLMIALGSSNFNKDSRTKECKTGLYSSFLEEIC 60
           + LP FS YS  T+S  DS    S SLT   A GS + + DS+     TG Y    EE  
Sbjct: 48  VSLPDFSWYSFKTASLTDSASFLSCSLTFNTATGSRSLSNDSKITAFNTGSYFFLFEESF 107

Query: 61  FNSALVFSKMLSNTSSLVPNTFNLILLAIVDFTICCFKAAFFILEAMLLSMALVSLRTRP 120
             S LV SKM S+  SLV +T +LILLAIVD  ICCF AAF +L ++  SM LVSLRTR 
Sbjct: 108 LRSTLVASKMSSSICSLVDSTLSLILLAIVDLVICCFNAAFLVLSSIAESMLLVSLRTRL 167

Query: 121 VFSISY 126
           VFSISY
Sbjct: 168 VFSISY 173

>CAGL0A01914g 190454..201685 highly similar to sp|P38811 Saccharomyces
            cerevisiae YHR099w TRA1, start by similarity
          Length = 3743

 Score = 27.7 bits (60), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 42/98 (42%), Gaps = 16/98 (16%)

Query: 18   DSMISTSV-SLTLMIALGSSNFNKDSRTKECKTGLYSSFLEEICFNSALVFSKMLSNTSS 76
            D M ST++ +  LM AL S  + +D R     T      ++ IC  S L+F   L    S
Sbjct: 1140 DPMFSTNILTKALMSALSS--YKEDVRESSILT------IKRICERSLLIFGSKLVFKYS 1191

Query: 77   LVPNTFNLILLAIVDFTICCFKAAFFILEAMLLSMALV 114
            LVP+          D    CF  AF+   A +L +  +
Sbjct: 1192 LVPDLMK-------DAIHLCFDEAFYNKRAGVLGIGAI 1222

>Kwal_56.23678
          Length = 395

 Score = 26.6 bits (57), Expect = 6.4,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 36  SNFNKDSRTKECKTGLYSSFLEEICFNSALVFSKMLSNTSSLVPNTFNL 84
           +NF+KD    E  T L +    E+C  S L  S +L+    ++ N   L
Sbjct: 64  ANFSKDVSDGENYTILLNQLAPELCSRSPLQTSNLLTRAEQVLQNAEKL 112

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,385,037
Number of extensions: 119298
Number of successful extensions: 550
Number of sequences better than 10.0: 21
Number of HSP's gapped: 550
Number of HSP's successfully gapped: 21
Length of query: 126
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 37
Effective length of database: 13,515,107
Effective search space: 500058959
Effective search space used: 500058959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)