Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E23056g81880637240.0
Kwal_33.146297192307594e-89
Scas_697.176942266192e-69
YHR131C8402406051e-66
YNL144C7402305596e-61
AFR049W7172195515e-60
CAGL0G06182g6812274844e-51
Scas_654.225802444353e-45
CAGL0J05830g6072432694e-24
KLLA0A08206g230163810.093
CAGL0M05599g446137810.14
YOR372C (NDD1)55486676.6
AFR604C84550668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E23056g
         (806 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...  1439   0.0  
Kwal_33.14629                                                         296   4e-89
Scas_697.17                                                           243   2e-69
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   237   1e-66
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   219   6e-61
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...   216   5e-60
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...   191   4e-51
Scas_654.22                                                           172   3e-45
CAGL0J05830g complement(552107..553930) some similarities with s...   108   4e-24
KLLA0A08206g 730940..731632 no similarity, hypothetical start          36   0.093
CAGL0M05599g 599520..600860 similar to sp|P38288 Saccharomyces c...    36   0.14 
YOR372C (NDD1) [5147] chr15 complement(1034803..1036467) Protein...    30   6.6  
AFR604C [3796] [Homologous to ScYOL091W (SPO21) - SH] (1527955.....    30   8.9  

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score = 1439 bits (3724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/806 (88%), Positives = 710/806 (88%)

Query: 1   MSSVSVPLRPSHGQWSSSPNSTCIPSCKKESGMKRMNHVKSLSSDTSSDNTGEDISLLDC 60
           MSSVSVPLRPSHGQWSSSPNSTCIPSCKKESGMKRMNHVKSLSSDTSSDNTGEDISLLDC
Sbjct: 1   MSSVSVPLRPSHGQWSSSPNSTCIPSCKKESGMKRMNHVKSLSSDTSSDNTGEDISLLDC 60

Query: 61  HCTSLGASDISLTTNSGSVQEFXXXXXXXXXXXXXXXAKKKLNNVKSTSRVVPRPKPNYE 120
           HCTSLGASDISLTTNSGSVQEF               AKKKLNNVKSTSRVVPRPKPNYE
Sbjct: 61  HCTSLGASDISLTTNSGSVQEFTGTNTSSSTPSTTQTAKKKLNNVKSTSRVVPRPKPNYE 120

Query: 121 KSLEYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEW 180
           KSLEYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEW
Sbjct: 121 KSLEYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEW 180

Query: 181 LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTRF 240
           LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTRF
Sbjct: 181 LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTRF 240

Query: 241 LPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTFV 300
           LPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTFV
Sbjct: 241 LPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTFV 300

Query: 301 LRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVPXXXXXXXXXXX 360
           LRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVP           
Sbjct: 301 LRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVPRRRRRGHRRRR 360

Query: 361 XXNKSNGGTSLGLQRMLQVGTGQSSRAQSPMESRRLSASSIGARAEAHVRPVLASTRSTG 420
             NKSNGGTSLGLQRMLQVGTGQSSRAQSPMESRRLSASSIGARAEAHVRPVLASTRSTG
Sbjct: 361 RRNKSNGGTSLGLQRMLQVGTGQSSRAQSPMESRRLSASSIGARAEAHVRPVLASTRSTG 420

Query: 421 FVLEALTNRPKEADSSRSIKTISAKPTYQRRXXXXXXXXXXXXLATMFHHGKKPVQTHKR 480
           FVLEALTNRPKEADSSRSIKTISAKPTYQRR            LATMFHHGKKPVQTHKR
Sbjct: 421 FVLEALTNRPKEADSSRSIKTISAKPTYQRRSSESSIKGIKSKLATMFHHGKKPVQTHKR 480

Query: 481 QGSVASALNCVIEXXXXXXXXXXXXTNPKSNIDDKNKDSPITPLKRVAGKPLFSTSAGNT 540
           QGSVASALNCVIE            TNPKSNIDDKNKDSPITPLKRVAGKPLFSTSAGNT
Sbjct: 481 QGSVASALNCVIEDDDDSDIDPLTDTNPKSNIDDKNKDSPITPLKRVAGKPLFSTSAGNT 540

Query: 541 PEKRLGSIASTELEFSKQTELPSQQTPEFDKGDLGSIPIIPHLDEDFSTENDLSAQTGYQ 600
           PEKRLGSIASTELEFSKQTELPSQQTPEFDKGDLGSIPIIPHLDEDFSTENDLSAQTGYQ
Sbjct: 541 PEKRLGSIASTELEFSKQTELPSQQTPEFDKGDLGSIPIIPHLDEDFSTENDLSAQTGYQ 600

Query: 601 NAICSRLELNELQTILNEHNXXXXXXXXXXXXXXXXXXXXXXXXXXGTETAASSNELPTR 660
           NAICSRLELNELQTILNEHN                          GTETAASSNELPTR
Sbjct: 601 NAICSRLELNELQTILNEHNEEDSEEQDQDQEEEEEEEEEEEDEDDGTETAASSNELPTR 660

Query: 661 HARSAASSIYHEEGIFHDSDDDYIYVPTEIHRRRTSSITSNLSNTPYGGDEMKWNPPRKE 720
           HARSAASSIYHEEGIFHDSDDDYIYVPTEIHRRRTSSITSNLSNTPYGGDEMKWNPPRKE
Sbjct: 661 HARSAASSIYHEEGIFHDSDDDYIYVPTEIHRRRTSSITSNLSNTPYGGDEMKWNPPRKE 720

Query: 721 ITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFIXXXXXXXXXXXX 780
           ITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFI            
Sbjct: 721 ITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFISNSDLSSKNKFS 780

Query: 781 XXXXXXTQPALLLSRCKNHYLTPYII 806
                 TQPALLLSRCKNHYLTPYII
Sbjct: 781 LKKLYNTQPALLLSRCKNHYLTPYII 806

>Kwal_33.14629
          Length = 719

 Score =  296 bits (759), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 137/230 (59%), Positives = 182/230 (79%), Gaps = 4/230 (1%)

Query: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEWLNP 183
           + F W+D  P +PPSYKS + +RR+T+P+YETLDD  LPGYSPAV+AITV+S+K EWL+P
Sbjct: 73  DLFSWIDPLPAKPPSYKSSDPSRRVTFPVYETLDDGSLPGYSPAVEAITVVSMKLEWLDP 132

Query: 184 YELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPND-LNSS---KQSTR 239
           Y  S SR+WKNF+MEINSTQLNFY I  +LT  IKNY  G ++F  + L+ S   +    
Sbjct: 133 YTCSPSRSWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYESHHS 192

Query: 240 FLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTF 299
              SL SK+TYQFN++DQ+ I+K I +N+ KYL+++ LF+S+SLQ+ K+GIPTDY +KTF
Sbjct: 193 IFSSLSSKNTYQFNKADQECISKKISNNKSKYLTDNKLFRSYSLQFAKYGIPTDYNRKTF 252

Query: 300 VLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVP 349
           VLR+RCE +QF+++F+HVDDMI W++ LSIGI VSLDL +RE+PTYRTVP
Sbjct: 253 VLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPTYRTVP 302

 Score =  181 bits (458), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 127/220 (57%), Gaps = 9/220 (4%)

Query: 591 NDLSAQTGYQNAICSRLELNELQTILNEHNXXXXXXXXXXXXXXXXXXXXXXXXXXGTET 650
           NDL  QTG+ +    + +LNELQ ++ EHN                            + 
Sbjct: 493 NDLQVQTGFHSNTGLQNDLNELQQVIYEHNEGVEEETEESPVSENNDNDDDD-----DDD 547

Query: 651 AASSNELPTRHARSA--ASSIYHEEGIFHDSDDDYIYVP--TEIHRRRTSSITSNLSNTP 706
           A  ++++ + H  S   A+SIY EEGIFHDS+DDY YV    +  RRR SS+TSNLS+TP
Sbjct: 548 ADDADDIDSVHPNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTP 607

Query: 707 YGGDEMKWNPPRKEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSG 766
           YG  ++KW+PPRKE++RRRYIRDSLRCIKPL  +E W+ K+ + P   P Y+TNNPP+SG
Sbjct: 608 YGSGDVKWHPPRKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPISG 667

Query: 767 FIXXXXXXXXXXXXXXXXXXTQPALLLSRCKNHYLTPYII 806
           F+                  +   ++L +CKNHY  PYI+
Sbjct: 668 FVGGTGKSGKSKASPNKSSKSDKGVILQKCKNHYAKPYIV 707

>Scas_697.17
          Length = 694

 Score =  243 bits (619), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 119/226 (52%), Positives = 164/226 (72%), Gaps = 10/226 (4%)

Query: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLD----DNVLPGYSPAVKAITVISLKQE 179
           E+ Q +D+ P  PP+Y  +N N+RI +PI+E       + + P Y PAV+ +T++S+K E
Sbjct: 87  EFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINELPPSYKPAVEELTIVSMKLE 146

Query: 180 WLNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTR 239
           WL+PY++S  R WKN IMEINSTQLNFYHI ESLTS+I+NY    +      + SKQ + 
Sbjct: 147 WLSPYDVSPLRTWKNLIMEINSTQLNFYHIDESLTSHIRNYSNDSS----SSSPSKQRST 202

Query: 240 FLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTF 299
           F  S  +++TY+FN++DQ+ I   I+ N+K YLSND L+KS+SLQ+ KFG+P DY KKT+
Sbjct: 203 F--SFGNRTTYEFNKNDQEQIAFRIKRNKKLYLSNDKLYKSYSLQFAKFGLPIDYKKKTY 260

Query: 300 VLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345
           VLRLRCE +QFL+NFAHVDDMI W++ L++GI V+LDL  R +P Y
Sbjct: 261 VLRLRCESEQFLLNFAHVDDMIMWTMYLNMGISVALDLELRALPDY 306

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 85/148 (57%), Gaps = 12/148 (8%)

Query: 667 SSIYHEEGIFH-DSDDDYIY-------VPTEIHRRRTSSITSNLSNTPYGGDEMKWNPPR 718
           +S+Y EEGIFH +  D+Y Y         +  +RRRTSS+ S +S+ PY  DE+KW PP 
Sbjct: 526 NSVYDEEGIFHYNETDEYEYSYAQSITTNSTSYRRRTSSLISTMSSVPYSSDEIKWTPPL 585

Query: 719 KEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFIXXXXXXXXXX 778
           K   RR+YIR+SLRCI P   + +W++ I + P+ GPK++TNN P++G +          
Sbjct: 586 KITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTCTSYRKK 645

Query: 779 XXXXXXXXTQPALLLSRCKNHYLTPYII 806
                   +     L+R KNHYL  Y++
Sbjct: 646 LLAGCTSGSD----LNRVKNHYLKAYVV 669

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  237 bits (605), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/240 (48%), Positives = 166/240 (69%), Gaps = 14/240 (5%)

Query: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETL----DDNVLPGYSPAVKAITVISLKQE 179
           + ++ +D  P  PPSY  VN N+ + +PI+         ++ P Y+PAV  +T+ISLK E
Sbjct: 72  DLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLE 131

Query: 180 WLNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPND-------LN 232
            L+PYE+SS+R+W+NFI+EINSTQLNFYHI ESLT +I+NY  G T    +       ++
Sbjct: 132 RLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVH 191

Query: 233 SSKQSTRF---LPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFG 289
            S QS      L +L ++S  +F ++DQ+ I+  ++ +  +YL+++ L+KSF+LQ  +FG
Sbjct: 192 RSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARFG 251

Query: 290 IPTDYTKKTFVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTVP 349
           IPTDYTKK+FVLR+ CE +QFL+ F+H+DDMIDWS+ LSIGI VSLDL  RE P YR VP
Sbjct: 252 IPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREYPDYRIVP 311

 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 43/66 (65%)

Query: 696 SSITSNLSNTPYGGDEMKWNPPRKEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGP 755
           SS  S  SN PYG D++KW P  KEI+RRRY+RDSL+CIKP       + K+   P  GP
Sbjct: 676 SSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGP 735

Query: 756 KYETNN 761
            +ET+N
Sbjct: 736 TFETSN 741

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  219 bits (559), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 112/230 (48%), Positives = 155/230 (67%), Gaps = 11/230 (4%)

Query: 129 VDNAPRRPPSYKSVNSNRRITYPIYE----TLDDNVLPGYSPAVKAITVISLKQEWLNPY 184
           +D  P  PP Y   N ++ I YPIYE     L     P Y+P+V+  TV+S+K E L+P+
Sbjct: 92  IDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTPSVEHYTVVSMKMEKLSPF 151

Query: 185 ELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTR----- 239
           E +SSR W NFI++INSTQ+NFY I +SLT +IKNY GG   F +  +S   S R     
Sbjct: 152 ENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGGDM-FDHSHHSKTASDRHHSAR 210

Query: 240 -FLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKT 298
             L +  +KSTYQF++ D++ I   I  +E K+LS++ LFKS+SLQ  K G+P DY+ + 
Sbjct: 211 SLLNAFTTKSTYQFDKYDKERICGEIARDEHKFLSDERLFKSYSLQCAKVGLPIDYSSRD 270

Query: 299 FVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYRTV 348
           FVLR+RCE QQFL+ F+HVD++I W++ L++GI +SLDL  REMPTYR+V
Sbjct: 271 FVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLELREMPTYRSV 320

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (54%), Gaps = 18/97 (18%)

Query: 710 DEMKWNPPRKEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFIX 769
           ++ KW P  + ++R+RYI+DSLRCIKPL  D  WV KI   P++ P +ETNNPP+  +  
Sbjct: 637 NDSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAFETNNPPIRVY-- 694

Query: 770 XXXXXXXXXXXXXXXXXTQPALLLSRCKNHYLTPYII 806
                             + +  L   KNHYL PYI+
Sbjct: 695 ----------------SGEDSTDLMHVKNHYLKPYIV 715

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score =  216 bits (551), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 102/219 (46%), Positives = 142/219 (64%), Gaps = 7/219 (3%)

Query: 133 PRRPPSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEWLNPYELSSSRAW 192
           P RPP Y +VN NRRI YPIYE  + N LP Y+PAV  + ++S+KQEW +PYE + SR+W
Sbjct: 71  PARPPPYYAVNPNRRIRYPIYEREETNELPAYAPAVHELALVSVKQEWASPYEPAVSRSW 130

Query: 193 KNFIMEINSTQLNFYHIHESLTSNIKNYYGGPT------NFPNDLNSSKQSTRFLPSLHS 246
           +  +ME+NSTQLNFYH+ E L   ++      T         + L+  +     L +L  
Sbjct: 131 RTLLMELNSTQLNFYHVDEGLLRGLRGRAADSTLGVACAQAVSSLSFGQVKAGTLLAL-G 189

Query: 247 KSTYQFNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKTFVLRLRCE 306
           +   Q + + QQ +    Q + +++L  + L+KS+SLQY  FG+P DYTK++FVLRLRCE
Sbjct: 190 RDERQLSPAHQQHVCARAQRDPERHLCAERLYKSYSLQYATFGVPMDYTKRSFVLRLRCE 249

Query: 307 LQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345
            +QFL+ F  VD +I WSVSLS+GI VSLDL +R+MP Y
Sbjct: 250 TEQFLVCFGTVDMLISWSVSLSVGIGVSLDLDHRKMPAY 288

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 63/133 (47%), Gaps = 34/133 (25%)

Query: 648 TETAASSNE--LPTRHARSAASSIYHEEGIFHD------------------------SDD 681
            ET ASS    LP+ H  +   SIY +EGI+H                         +  
Sbjct: 522 VETGASSESELLPSDHLET---SIYEDEGIYHSDDDDDDDDDDDDDDDGAGSAAADTATQ 578

Query: 682 DYIYVPTEI---HRRRTSSITSNLSNTPYG--GDEMKWNPPRKEITRRRYIRDSLRCIKP 736
           DY      +    R+R  S  S+LS  PYG      KW PP KE TRRR++RDS+RCI+P
Sbjct: 579 DYAARSRALDMEFRQRAHSAASSLSFAPYGYSFSREKWVPPVKESTRRRFVRDSIRCIRP 638

Query: 737 LGFDESWVNKIAL 749
           L  D++W+  + +
Sbjct: 639 LCDDDTWLGALVV 651

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score =  191 bits (484), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/227 (40%), Positives = 138/227 (60%), Gaps = 8/227 (3%)

Query: 125 YFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVL----PGYSPAVKAITVISLKQEW 180
           Y + +D  P  PP Y  VN NR +T+PI+E L    +    P Y P V  + ++S+K EW
Sbjct: 51  YLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEW 110

Query: 181 LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQSTRF 240
           L+P+E S +R+W+ FIMEINSTQ+NFY +       +KNYY     + +   S  +    
Sbjct: 111 LSPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYN--LKYDDGAKSLAKGILS 168

Query: 241 LPSLHSKSTYQFNRSDQQW--ITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTDYTKKT 298
           L +   K+  +   ++  W  +   ++ N  KYLS+  L++SF+LQY + GIPTDY K  
Sbjct: 169 LGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSA 228

Query: 299 FVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345
             LRLRCE +QFL+ F +VDD+I+WS+ +++GI V+LDL  R++P Y
Sbjct: 229 HALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 60/94 (63%), Gaps = 1/94 (1%)

Query: 668 SIYHEEGIFHDSDDDYIYVPTEIHRRRTSSITSNLSNTPYGGDEMKWNPPRKEITRRRYI 727
           SIY EEG+ H+S+ DY Y    + R R +S  SN+ +     D++KW PP+K ++RRRY+
Sbjct: 520 SIYAEEGLVHESESDYYYEQRRLTRSRAASTASNMISHA-DADDVKWMPPQKILSRRRYV 578

Query: 728 RDSLRCIKPLGFDESWVNKIALAPSMGPKYETNN 761
           +DSLRCIK      SW+ ++   P+  P ++TNN
Sbjct: 579 KDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNN 612

>Scas_654.22
          Length = 580

 Score =  172 bits (435), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 141/244 (57%), Gaps = 29/244 (11%)

Query: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVL----PGYSPAVKAITVISLKQE 179
           E+   +D  P  PP Y ++N +R+I++PIYET  D +     P YSPAV  IT++S+K E
Sbjct: 89  EFLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLE 148

Query: 180 W---LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQ 236
           W   + P   ++ R WK  +ME+NSTQLNFY +   L S +K   G            K 
Sbjct: 149 WESPMAPIRYAAQR-WKIVLMEVNSTQLNFYDVDALLQSQLKKTIG----------PRKN 197

Query: 237 STRFLPS--LHSKSTYQ-FNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTD 293
           ST F  +   +   T+Q + +SD + I ++I+ N+ KYL +  L KS+SLQ+G+ G PTD
Sbjct: 198 STLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPTD 257

Query: 294 YTKKT--------FVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345
            + K           LRLRCE QQFL+ F  +D +I  +V + +GI VSLDL  RE+PTY
Sbjct: 258 LSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPTY 317

Query: 346 RTVP 349
           R VP
Sbjct: 318 RIVP 321

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 75/160 (46%), Gaps = 29/160 (18%)

Query: 649 ETAASSNELPTRHARSAASSIYHEEGIF--HDSDDDYIYVPTEIHRRRTSSITSNLSNTP 706
           +T     +LPT     +A S+Y EEGI+   D +++      +      S I S+     
Sbjct: 427 DTNEDEEDLPT--TNDSAQSVYQEEGIYPDDDDEEEEDEDDGDEDEYYASDIDSD----- 479

Query: 707 YGGDEMKWNPPRKEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSG 766
              D+ KW+P  K+ +RRRY+RDSLRCIK +  +  WV K+   P+  P +ETNN P+  
Sbjct: 480 ---DDYKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPL-- 534

Query: 767 FIXXXXXXXXXXXXXXXXXXTQPALLLSRCKNHYLTPYII 806
           FI                     + +    KNHYL  +++
Sbjct: 535 FI---------------GKGPHASTVYDTTKNHYLKAHVV 559

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 111/243 (45%), Gaps = 59/243 (24%)

Query: 161 LPGYSPAVKAITVISLKQEWLNPYELSSSRAWKNFIMEINSTQLNFY------------- 207
           LPGYSPAV+       K EW +P ++S    W + ++ INSTQLN Y             
Sbjct: 40  LPGYSPAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKS 99

Query: 208 --------------HIHESLTSNIKNY---------YGGPTNFPNDLNSSKQSTRFLPSL 244
                          + E  T   KNY         +  P  F N   +  Q    L + 
Sbjct: 100 LSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDA--LGAR 157

Query: 245 HSKST---YQFNRSDQQWITKMIQSNEKKYLSNDML-FKSFSLQYGKFGIPTDYTKKTF- 299
             +S    + ++ + +++ ++   S +   +S   + FKS+SLQ  K G+PT  ++K   
Sbjct: 158 KKRSNQYDFIYDTNYEEYCSETCDSMD---VSTGFVPFKSYSLQGAKVGMPTSESRKKVY 214

Query: 300 -------------VLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTYR 346
                         LRLR E QQFL+ F H+DDMI WS+ LS+GI+VS DL  RE P YR
Sbjct: 215 IDEENVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYR 274

Query: 347 TVP 349
            VP
Sbjct: 275 IVP 277

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%)

Query: 711 EMKWNPPRKEITRRRYIRDSLRCIKPLGFDESW 743
           + KWNP +KE TR+RYIR SLRCI+PL  D  W
Sbjct: 536 DTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKW 568

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 35.8 bits (81), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 65/163 (39%), Gaps = 26/163 (15%)

Query: 161 LPGYSPAVKAITVISLKQEWLNPYELSSSRAWKNFIMEINSTQLNFY-HIHESLTSNIKN 219
           LP Y+P        SL+  +L   +   S  W    +EINSTQL     IH      I  
Sbjct: 39  LPPYTP--------SLQISFLLQTQFEHSHRWTPHCVEINSTQLLIRPLIHSHDEKLINK 90

Query: 220 YYGGPTNFPNDLNSSKQSTRFLPSLHSKSTYQFNRSDQQWITKMIQSNEKKYLSNDMLF- 278
           +Y            +  + +       +ST   N+ D      ++ + +  YL  D    
Sbjct: 91  WYSKLDELEYKQYKATSNHQLCHDQLVQSTQVPNQRDH----IVLCTAKGLYLEKDKSLN 146

Query: 279 ---------KSFSLQYGKFGIPTDYTKKTFVLRLRCELQQFLI 312
                    K +SLQ  + G+ TD ++    LR+RCE +QFL+
Sbjct: 147 LIQWNRDPIKKYSLQDCRIGLNTDMSR---CLRIRCEREQFLL 186

>CAGL0M05599g 599520..600860 similar to sp|P38288 Saccharomyces
           cerevisiae YBR162c TOS1, hypothetical start
          Length = 446

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 56/137 (40%), Gaps = 11/137 (8%)

Query: 137 PSYKSVNSNRRITYPIYETLDDNVLPGYSPAVKAITVISLKQEWLNPYELSSSRAWKNFI 196
           P+YK    NR+I Y  +    D    GY+  + AI +++ K      Y LS+   W    
Sbjct: 302 PAYKGFGGNRKIFYFEFSMPSDTNGNGYNQDMPAIWLLNAKIPRTLQYGLSTCSCWATGC 361

Query: 197 MEINSTQL-------NFYHIHESLTSNIKNYYGGPTN----FPNDLNSSKQSTRFLPSLH 245
            E++  ++          HIH+      ++++  PT+         N+S ++   +    
Sbjct: 362 GELDLFEVLSPGSDKMITHIHDGQGGGTQDFFQRPTDGIFRAVVIFNASDKTIHLVQVDS 421

Query: 246 SKSTYQFNRSDQQWITK 262
           + +    N   QQW+ K
Sbjct: 422 APAGGLSNDQVQQWLNK 438

>YOR372C (NDD1) [5147] chr15 complement(1034803..1036467) Protein
           required for nuclear division, positively but indirectly
           affects transcription of a subset of genes required for
           the cell cycle [1665 bp, 554 aa]
          Length = 554

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 18/86 (20%)

Query: 154 ETLDD-NVLPGYSPAVKAITVISLKQEWLNPYELSSSRAWKNFIMEINSTQLNFYHIHES 212
           ETLDD NV P         +V+       + + ++S   +K F+++  ST  NF+H   +
Sbjct: 130 ETLDDINVQPS--------SVLQFGNSLPSEFLVASPEQFKEFLLDSPSTNFNFFHKTPA 181

Query: 213 LTSNIKNYYGGPTNFPNDLNSSKQST 238
            T         P  F  D N ++QST
Sbjct: 182 KT---------PLRFVTDSNGAQQST 198

>AFR604C [3796] [Homologous to ScYOL091W (SPO21) - SH]
           (1527955..1530492) [2538 bp, 845 aa]
          Length = 845

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 564 QQTPEFDKGDLGSIPIIPHLDEDFSTENDLSAQTGYQN-AICSRLELNEL 612
           ++ P FD  D+G I ++ H  + ++T+ +LS +    N A  +R+++ +L
Sbjct: 181 EKEPSFDTTDIGKIDVLDHDADAYATDYELSVKKNEVNYAKLTRIDIKDL 230

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.128    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,682,102
Number of extensions: 1028288
Number of successful extensions: 2555
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2585
Number of HSP's successfully gapped: 39
Length of query: 806
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 696
Effective length of database: 12,788,129
Effective search space: 8900537784
Effective search space used: 8900537784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)