Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E21967g26025613130.0
ACR087C2572479991e-138
CAGL0I00946g2592519801e-135
Sklu_1979.22732559701e-133
Kwal_55.215702412199661e-133
YOR039W (CKB2)2582229441e-130
Scas_699.432562379331e-128
KLLA0A04818g2772214691e-57
CAGL0A00275g2662304376e-53
Kwal_47.174492502264313e-52
Scas_638.72702294281e-51
Sklu_1768.43292054233e-50
YGL019W (CKB1)2782324194e-50
AGR163W2752373977e-47
YJR110W68868625.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21967g
         (256 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   510   0.0  
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   389   e-138
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   382   e-135
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        378   e-133
Kwal_55.21570                                                         376   e-133
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   368   e-130
Scas_699.43                                                           363   e-128
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   185   1e-57
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   172   6e-53
Kwal_47.17449                                                         170   3e-52
Scas_638.7                                                            169   1e-51
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        167   3e-50
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   166   4e-50
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   157   7e-47
YJR110W (YJR110W) [3002] chr10 (633530..635596) Phosphatidylinos...    28   5.9  

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/256 (95%), Positives = 244/256 (95%)

Query: 1   MSIPEESVETTEQPDVVMADALVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEY 60
           MSIPEESVETTEQPDVVMADALVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEY
Sbjct: 1   MSIPEESVETTEQPDVVMADALVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEY 60

Query: 61  ITDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYI 120
           ITDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYI
Sbjct: 61  ITDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYI 120

Query: 121 ITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKS 180
           ITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKS
Sbjct: 121 ITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKS 180

Query: 181 SRHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWXXXXXXX 240
           SRHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRW       
Sbjct: 181 SRHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWQELQRLK 240

Query: 241 XXXXXITKGINLNESG 256
                ITKGINLNESG
Sbjct: 241 LEKLLITKGINLNESG 256

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 202/247 (81%), Gaps = 4/247 (1%)

Query: 10  TTEQPDVVMADALVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLIN 69
           T E  DV MADA+  N     + S +YVE WIDLFLGKKGHEYFCD+DTEYITDRFNLIN
Sbjct: 11  TAETADVEMADAVETN----STGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLIN 66

Query: 70  LQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKM 129
           LQKTVSKFT V+QYMVD+L++  +E+MS  +L QLE D RKLYGLIHARYIIT KGLQKM
Sbjct: 67  LQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKM 126

Query: 130 LQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGA 189
           LQKY+ ADF RCPR HCN QPLLPVGLHD+PGIDCVKLYCPSCEDLY PKSSRHS+IDGA
Sbjct: 127 LQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGA 186

Query: 190 YFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWXXXXXXXXXXXXITKG 249
           YFGTSFPGMFLQ FPE+ PKHPTKRYVPKVFGFDLHKQAQL RW            I KG
Sbjct: 187 YFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRLKLERELIKKG 246

Query: 250 INLNESG 256
           ++L ++G
Sbjct: 247 VDLTKNG 253

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  382 bits (980), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 177/251 (70%), Positives = 200/251 (79%), Gaps = 9/251 (3%)

Query: 15  DVVMADALVVNDQ---------DDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRF 65
           D+ MAD +  N           DD +DS EY + WIDLFLG+KGHEYFCD+D EYITDRF
Sbjct: 5   DIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRF 64

Query: 66  NLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKG 125
           NLINLQKTVSKF+ VVQY+VD+L++ I+E+MS ARLEQLE D RK YGLIHARYIIT KG
Sbjct: 65  NLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKG 124

Query: 126 LQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSA 185
           LQKML KYK ADFGRC R +CN QPLLPVGLHD+PGID VKLYCPSCEDLYNPKSSRHS+
Sbjct: 125 LQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSS 184

Query: 186 IDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWXXXXXXXXXXXX 245
           IDGAYFGTSFPGMFLQ FP+M PKHPT RYVPK+FGF+LHKQAQLTRW            
Sbjct: 185 IDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRL 244

Query: 246 ITKGINLNESG 256
             K ++L++SG
Sbjct: 245 QAKEVDLSKSG 255

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  378 bits (970), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 175/255 (68%), Positives = 203/255 (79%), Gaps = 7/255 (2%)

Query: 9   ETTEQPDVVMADA-------LVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYI 61
           E  ++ DV M D         V     D +DS EYVE+WIDLFLG+KGHEYFCD+DT+YI
Sbjct: 15  EARKEEDVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYI 74

Query: 62  TDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYII 121
           TDRFNLINLQKTVS+FT V+QY+VD+L++  +E MS +RLEQLE+D RKLYGLIHARYII
Sbjct: 75  TDRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYII 134

Query: 122 TAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSS 181
           T KGLQKMLQKY+ ADFGRCPR +CN Q LLPVGLHD+PGIDCVKLYCPSCEDLY PKSS
Sbjct: 135 TVKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSS 194

Query: 182 RHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWXXXXXXXX 241
           RHS+IDGAYFGTSFPGMFLQ FPEM PKHP KRYVP++FGF+LHKQAQL RW        
Sbjct: 195 RHSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKL 254

Query: 242 XXXXITKGINLNESG 256
                 +G+ L+++G
Sbjct: 255 ESQLDKEGVELSKNG 269

>Kwal_55.21570
          Length = 241

 Score =  376 bits (966), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 191/219 (87%), Gaps = 3/219 (1%)

Query: 18  MADALVVN---DQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTV 74
           MAD  +V    D  +GSDS EY E+WIDLFLG+KGHEYFCDIDTEYITDRFNLINLQK+V
Sbjct: 1   MADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSV 60

Query: 75  SKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYK 134
           +KFT V+QYMVD+L++GI+E MS  RLEQLE D RKLYGLIHARY+IT KGLQKMLQKYK
Sbjct: 61  NKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYK 120

Query: 135 AADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTS 194
            ADFGRCPR +CN QPLLPVGLHD+PG DCVKLYC  CEDLY PKSSRHSAIDGAYFGTS
Sbjct: 121 EADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTS 180

Query: 195 FPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRW 233
           FPGMFLQ FPEM PKHP KRYVPK+FGF+LHKQAQ+ RW
Sbjct: 181 FPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARW 219

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  368 bits (944), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 170/222 (76%), Positives = 192/222 (86%)

Query: 35  EYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQYMVDDLEEGIIE 94
           EYV+ WIDLFLG+KGHEYFCD+D EYITDRFNL+NLQKTVSKF+ VVQY+VDDL++ I+E
Sbjct: 33  EYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILE 92

Query: 95  SMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPV 154
           +M+ ARLEQLE+D+RKLYGLIHARYIIT KGLQKM  KYK ADFGRCPR +CN Q LLPV
Sbjct: 93  NMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPV 152

Query: 155 GLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKR 214
           GLHDIPGIDCVKLYCPSCEDLY PKSSRHS+IDGAYFGTSFPGMFLQ FP+M PKHPTKR
Sbjct: 153 GLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKR 212

Query: 215 YVPKVFGFDLHKQAQLTRWXXXXXXXXXXXXITKGINLNESG 256
           YVPK+FGF+LHKQAQLTRW             +K ++L +SG
Sbjct: 213 YVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDLTKSG 254

>Scas_699.43
          Length = 256

 Score =  363 bits (933), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 193/237 (81%), Gaps = 4/237 (1%)

Query: 24  VNDQDDG----SDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTT 79
             D+DD     +DS EYV+ WIDLFLGKKGHEYFCDID +YITDRFNLINLQKTVSKF+ 
Sbjct: 16  TQDEDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQ 75

Query: 80  VVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYKAADFG 139
           VVQY+VD+L+E I+E+MS ARLEQLE D RK YGLIHARYIIT KGLQKML K+K ADFG
Sbjct: 76  VVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFG 135

Query: 140 RCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTSFPGMF 199
           RCPR +CN+QPLLPVGLHD PG+DCVKLYC SCEDLY PKS RHS IDGA+FGTSFPGMF
Sbjct: 136 RCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMF 195

Query: 200 LQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWXXXXXXXXXXXXITKGINLNESG 256
           LQ FPEM PKHPTK+YVPK+FGF+LHKQAQL RW             T  ++L ++G
Sbjct: 196 LQAFPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRLKLEKKLKTLDVDLTKNG 252

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  185 bits (469), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 134/221 (60%), Gaps = 17/221 (7%)

Query: 24  VNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQY 83
           +   +D SDSG Y E WI  F  + GHEYFC + T++I D FNL  L + V+ +   +  
Sbjct: 4   IEPSNDSSDSGNYEE-WIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDT 62

Query: 84  MVD-----DLEEGIIESMSPARLEQ--------LETDTRKLYGLIHARYIITAKGLQKML 130
           ++D     D EE   ++ S ++ +         +E    +LYGLIHAR+I+T  GLQ M 
Sbjct: 63  ILDLESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMA 122

Query: 131 QKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAY 190
           +K+   +FG CPRYHC    LLP GL D  G   V+LYCPSC+DLY P+SSRH +++GAY
Sbjct: 123 EKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAY 182

Query: 191 FGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA 228
           +GTSFPG+FL+ F E+     K   + Y  K+FGF + K+A
Sbjct: 183 WGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEA 223

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  172 bits (437), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 129/230 (56%), Gaps = 26/230 (11%)

Query: 24  VNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQY 83
           + D     DSG Y E WI  F  + GHEYFC + T++I D FN+ +L + V  +   +  
Sbjct: 5   MEDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDL 63

Query: 84  MVD--------DLEE--------------GIIESMSPARLEQLETDTRKLYGLIHARYII 121
           ++D        D++E              G + S +      +     +LYGLIHARYI+
Sbjct: 64  ILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHARYIL 123

Query: 122 TAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSS 181
           T  GLQ M +K+   DFG CPRY C+   LLP GL D  G   V+LYCPSC+DLY P+SS
Sbjct: 124 TKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSS 183

Query: 182 RHSAIDGAYFGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA 228
           RH  ++GAY+GTSFPG+FL+ F E+     +   + Y  KVFGF ++ QA
Sbjct: 184 RHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233

>Kwal_47.17449
          Length = 250

 Score =  170 bits (431), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 129/226 (57%), Gaps = 11/226 (4%)

Query: 18  MADALVVNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKF 77
           M++ +  N +   SD     + WI  F  + GHEYFC + TE+I D FN+  L + V  +
Sbjct: 1   MSEYVGDNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHY 60

Query: 78  TTVVQYMVD----DLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKY 133
              +  ++D      EEG  +S  P     +E    +LYGL+HARYI+T  GLQ M +K+
Sbjct: 61  RKALDLVLDLEAMSDEEGQ-DSEEPVSRSIVEHAAEQLYGLVHARYILTKPGLQAMAEKF 119

Query: 134 KAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGT 193
              +FG CPRY+C    +LP GL D  G   V+LYCPSC+DLY P+SSRH  ++GA++GT
Sbjct: 120 DHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEGAFWGT 179

Query: 194 SFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA---QLTRW 233
           SFPG+FL+ F E+     +     Y  +VFGF +  +A      RW
Sbjct: 180 SFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARMRW 225

>Scas_638.7
          Length = 270

 Score =  169 bits (428), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 126/229 (55%), Gaps = 28/229 (12%)

Query: 32  DSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQYMVD----- 86
           DSG Y E WI  F  + GHEYFC++ TE+I D FNL +L + V  +   +  ++D     
Sbjct: 18  DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKALDLILDLEAIS 76

Query: 87  ----------------DLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKML 130
                             +E + +         +E    +LYGLIHARYI+T  GLQ M 
Sbjct: 77  EEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMA 136

Query: 131 QKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAY 190
           +K+   +FG CPRYHC    LLP GL D  G   V+LYCPSC+DLY P+SSR   ++GA+
Sbjct: 137 EKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAF 196

Query: 191 FGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA---QLTRW 233
           +GTSFPG+FL+ F E+     +     Y  KVFGF ++ +A   Q  +W
Sbjct: 197 WGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  167 bits (423), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 119/205 (58%), Gaps = 16/205 (7%)

Query: 40  WIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQYMVD----------DLE 89
           WI  F  + GHEYFC + TE+I D FN+  L + +  +   +  ++D          D  
Sbjct: 92  WIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKALDLILDLEAMSDEDDEDDN 151

Query: 90  EGIIE---SMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYKAADFGRCPRYHC 146
           +G  E   S  P     +E    +LYGLIHARYI+T  GLQ M +K+   +FG CPRY+C
Sbjct: 152 DGAAEEDGSGEPVNRSIMEHAAEQLYGLIHARYILTKPGLQSMAEKFDHKEFGTCPRYYC 211

Query: 147 NHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTSFPGMFLQGFPEM 206
               +LP GL D  G   V+LYCPSC+DLY P+SSRH  +DGA++GTSFPG+FL+ F E+
Sbjct: 212 GGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGVFLKHFKEL 271

Query: 207 ---CPKHPTKRYVPKVFGFDLHKQA 228
                +     Y  KVFGF ++ +A
Sbjct: 272 EDYVERKSKDVYELKVFGFKINGEA 296

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  166 bits (419), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 128/232 (55%), Gaps = 33/232 (14%)

Query: 29  DGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQYMVD-- 86
           D  DSG Y E WI  F  + GHEYFC + TE+I D FN+ +L + V  +   +  ++D  
Sbjct: 16  DDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLE 74

Query: 87  --------------------------DLEEGIIESMSPARLEQL-ETDTRKLYGLIHARY 119
                                       +EG   + SP   + + E    +LYGLIHAR+
Sbjct: 75  AMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARF 134

Query: 120 IITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPK 179
           I+T  GLQ M +K+   +FG CPRY+CN   LLP GL D  G   V+LYCPSC+DLY P+
Sbjct: 135 ILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQ 194

Query: 180 SSRHSAIDGAYFGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA 228
           SSR   ++GA++GTSFPG+FL+ F E+     +   + Y  KVFGF ++ +A
Sbjct: 195 SSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  157 bits (397), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 123/237 (51%), Gaps = 33/237 (13%)

Query: 24  VNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQY 83
           + D  D S+S  Y E WI  F  + GHE+FC + TE+I D FNL  L   V  +   +  
Sbjct: 4   MEDVSDVSESSNYDE-WITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDL 62

Query: 84  MVD-----------------------------DLEEGIIESMSPARLEQLETDTRKLYGL 114
           ++D                              + +       P     ++    +LYGL
Sbjct: 63  ILDLESLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGL 122

Query: 115 IHARYIITAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCED 174
           IHARYI+T +GLQ M +K+   +FG CPRY+C    LLP GL D  G + V+LYC SC+D
Sbjct: 123 IHARYILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQD 182

Query: 175 LYNPKSSRHSAIDGAYFGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA 228
           LY P SSRH  ++GA++GTSFPG+FL+ F E+     +     Y  ++FGF + K++
Sbjct: 183 LYLPHSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKES 239

>YJR110W (YJR110W) [3002] chr10 (633530..635596)
           Phosphatidylinositol 3-phosphate phosphatase with
           similarity to protein tyrosine phosphatases, has
           similarity to human myotubularin MTM1 [2067 bp, 688 aa]
          Length = 688

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 1/68 (1%)

Query: 166 KLYCPSCEDLYNP-KSSRHSAIDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDL 224
           KL  P   D+Y+P K  R   +D       +    +    E CP +P+K +VP+     L
Sbjct: 149 KLPSPDSWDIYDPIKEFRRQGLDSKDETCPWRLSTVNEHYEFCPTYPSKLFVPRSTSDIL 208

Query: 225 HKQAQLTR 232
            K A   R
Sbjct: 209 LKHASKFR 216

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.139    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,368,460
Number of extensions: 363144
Number of successful extensions: 849
Number of sequences better than 10.0: 20
Number of HSP's gapped: 840
Number of HSP's successfully gapped: 21
Length of query: 256
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 157
Effective length of database: 13,168,927
Effective search space: 2067521539
Effective search space used: 2067521539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)