Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E21945g84783543880.0
ACR088W85085021780.0
Sklu_1979.384784921740.0
Kwal_55.2156687385319410.0
YOR038C (HIR2)87587618390.0
Scas_699.4288588716400.0
CAGL0I00968g99746611221e-138
Scas_702.168163062492e-21
KLLA0A04928g8612382431e-20
AGR168W8254112294e-19
CAGL0E02805g8403922242e-18
YBL008W (HIR1)8404042232e-18
Kwal_47.174658002411938e-15
Kwal_27.10385536150930.006
KLLA0E11143g493105890.017
Scas_657.1341163800.17
Scas_512.3534298780.30
Kwal_26.897544559770.44
YOR104W (PIN2)28288750.68
Kwal_47.1811476361750.74
KLLA0C16643g30276730.95
AER280C51097731.4
CAGL0J01287g61095731.5
Scas_661.1947868721.7
CAGL0K07920g47535703.1
Sklu_2173.251564703.3
Kwal_47.18200268217683.6
CAGL0B03575g41970693.7
YML102W (CAC2)46874694.2
Scas_674.2029776675.1
Kwal_56.2459629476675.2
YDR016C (DAD1)9438625.9
KLLA0C08547g51564676.1
CAGL0J03476g51762676.4
Kwal_26.862842263677.1
Sklu_1659.261358668.8
YBR156C (SLI15)69862669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21945g
         (835 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...  1694   0.0  
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...   843   0.0  
Sklu_1979.3 YOR038C, Contig c1979 4836-7379                           842   0.0  
Kwal_55.21566                                                         752   0.0  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...   712   0.0  
Scas_699.42                                                           636   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...   436   e-138
Scas_702.16                                                           100   2e-21
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    98   1e-20
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    93   4e-19
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    91   2e-18
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    91   2e-18
Kwal_47.17465                                                          79   8e-15
Kwal_27.10385                                                          40   0.006
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    39   0.017
Scas_657.13                                                            35   0.17 
Scas_512.3                                                             35   0.30 
Kwal_26.8975                                                           34   0.44 
YOR104W (PIN2) [4908] chr15 (517642..518490) Protein of unknown ...    33   0.68 
Kwal_47.18114                                                          33   0.74 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    33   0.95 
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    33   1.4  
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    33   1.5  
Scas_661.19                                                            32   1.7  
CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06...    32   3.1  
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            32   3.3  
Kwal_47.18200                                                          31   3.6  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    31   3.7  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    31   4.2  
Scas_674.20                                                            30   5.1  
Kwal_56.24596                                                          30   5.2  
YDR016C (DAD1) [869] chr4 complement(478470..478754) Subunit of ...    28   5.9  
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    30   6.1  
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    30   6.4  
Kwal_26.8628                                                           30   7.1  
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             30   8.8  
YBR156C (SLI15) [341] chr2 complement(551060..553156) Mitotic sp...    30   9.4  

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score = 1694 bits (4388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 825/835 (98%), Positives = 825/835 (98%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60
           MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60

Query: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD 120
           SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD
Sbjct: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD 120

Query: 121 LKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVILQNRS 180
           LKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVILQNRS
Sbjct: 121 LKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVILQNRS 180

Query: 181 VQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVLLDRIQ 240
           VQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVLLDRIQ
Sbjct: 181 VQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVLLDRIQ 240

Query: 241 KFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRI 300
           KFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRI
Sbjct: 241 KFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRI 300

Query: 301 KPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEAAKE 360
           KPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEAAKE
Sbjct: 301 KPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEAAKE 360

Query: 361 IKLLDPLPFKPKAEEPDTKLPPNKTAQQTTTNSKKQPKAAEITTISSTNMEFIQPSYMVP 420
           IKLLDPLPFKPKAEEPDTKLPPNKTAQQTTTNSKKQPKAAEITTISSTNMEFIQPSYMVP
Sbjct: 361 IKLLDPLPFKPKAEEPDTKLPPNKTAQQTTTNSKKQPKAAEITTISSTNMEFIQPSYMVP 420

Query: 421 KDLKRKPVTEDPLLAQXXXXXXXXXXELDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQ 480
           KDLKRKPVTEDPLLAQ          ELDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQ
Sbjct: 421 KDLKRKPVTEDPLLAQNKPANKKAKKELDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQ 480

Query: 481 YSSQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWST 540
           YSSQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWST
Sbjct: 481 YSSQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWST 540

Query: 541 DTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPIND 600
           DTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPIND
Sbjct: 541 DTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPIND 600

Query: 601 VYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWW 660
           VYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWW
Sbjct: 601 VYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWW 660

Query: 661 PYGSQYWNFMSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKNSIINYLETKTNDELT 720
           PYGSQYWNFMSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKNSIINYLETKTNDELT
Sbjct: 661 PYGSQYWNFMSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKNSIINYLETKTNDELT 720

Query: 721 RKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRI 780
           RKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRI
Sbjct: 721 RKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRI 780

Query: 781 AEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCANIRQVQRVTTS 835
           AEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCANIRQVQRVTTS
Sbjct: 781 AEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCANIRQVQRVTTS 835

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/850 (49%), Positives = 579/850 (68%), Gaps = 27/850 (3%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60
           MKLLK P +LHDGQL    V    L ++G   +S +D   L  AA G+  V+EV    ++
Sbjct: 1   MKLLKYPRQLHDGQLLAGCVVGGLLVVVGRDRISAYDCGKLQAAARGELAVREVSAEVEL 60

Query: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD 120
            +   E  ++  R++   + + +V G   + A     + +    +   +        +TD
Sbjct: 61  QV---EVGEDALRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTD 117

Query: 121 LKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVILQNRS 180
           +K D   GL+FVS+S  + + +  +  WE    + L +KP++++ DPLG+LLTV+LQNRS
Sbjct: 118 VKADGA-GLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVVDPLGELLTVVLQNRS 176

Query: 181 VQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVLLDRIQ 240
           V +YQY+  G  ++HQ + Q+VQTNPL Y +TMSPQGD++P++NS+ N +P+A LLDR  
Sbjct: 177 VAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLDRTA 236

Query: 241 KFKIKLSLVGYVADCKILKFSPRIY---SKTKSPTSNDTQTFNLLASSGNEDGNVVVWNT 297
            F ++ +LVGYV  CKIL+FSPR+Y   +K K PT      +NLLASSGNEDG+V+VWNT
Sbjct: 237 GFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQ-----YNLLASSGNEDGSVIVWNT 291

Query: 298 NRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEA 357
            R KPL +A+KV +++I D++W   G GLFAIS DG L IFAF E ELG ++    + + 
Sbjct: 292 KRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKL 351

Query: 358 AKEIKLLDPLPF-KPKA-----EEPDTKLPPNKTAQQTTTNSKKQPKAAEITTISSTNME 411
            + +  L+PLP   PK+      +P     P+  +   + ++K   K    T I+ST+ME
Sbjct: 352 RQSVPRLEPLPPPTPKSLAKSEAKPQQDTKPDAKSSANSVSAKTGKKKIAPTVITSTSME 411

Query: 412 FIQPSYMVPKDLKRKPVTEDPLLAQXXXXXXXXXXELDQIDFLDTNLFLPSVSFSKVRLA 471
           F +PSY VPKDLKR+P  E     +          +++ +DFLDTNL +P++SFSK RLA
Sbjct: 412 FNEPSYTVPKDLKRRPKQET---QRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLA 468

Query: 472 HPKIRASFQYSS--QGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVTLC 529
            PK+R +FQY +  Q N V+++KNG G++QKPTSITLT KD E    LFQ F P+FVT+C
Sbjct: 469 TPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTIC 528

Query: 530 SAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNV 589
           + G SFWA  T+ G++YV S +G+ L PPM++GVPVSFLEG GDYLLC+TS+GQ++CWNV
Sbjct: 529 TCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNV 588

Query: 590 NTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAM 649
             GK+ FP+N +Y LLNP +RYSDDVL+RAENITMC  T  GIP+VTLSNGDGYMFD  M
Sbjct: 589 KEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDM 648

Query: 650 EAWMLINDSWWPYGSQYWNF--MSSAGVDLTSNDD--EKKDKYWNAEADILAKEVKNNKN 705
           E W+LINDSWW YGSQYW+F   S AG    + +D  +KK+KYWNA+A+ L +EVK NK 
Sbjct: 649 EIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEVKKNKK 708

Query: 706 SIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKE 765
           S++NYLE+KTNDE+TRKG +++LQRFAK +LMKEGFENLE+++TL+HLEN++LV+ +L E
Sbjct: 709 SVVNYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNE 768

Query: 766 VEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCAN 825
             E  +LLK+YCI +AEMG+ +R    LSWLY+    K   +  ++R  L+K I+++CA+
Sbjct: 769 TNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACAD 828

Query: 826 IRQVQRVTTS 835
           IRQVQRVTTS
Sbjct: 829 IRQVQRVTTS 838

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/849 (49%), Positives = 577/849 (67%), Gaps = 28/849 (3%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60
           MKLLK P +LHDG L  C    ++L  +G + +S+WD++ LL+ A GK+   E+ EL   
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60

Query: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD 120
             +    N E   ++   D ++L  G+DH L   D   ++  +     I   +    ITD
Sbjct: 61  KGNF---NNEKLCYVFATD-KKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITD 116

Query: 121 LKYDKVNGLLF--VSL-SKANSLQIMDSKTWELKSSIELKSKPISIITDPLGQLLTVILQ 177
           +KYD +N +LF  VSL SK N   + + +T    + I L +KP++ I DP+GQ+ T++  
Sbjct: 117 IKYDPLNNILFILVSLTSKKNVAILYEGRTCTRLAEILLPTKPMTGIIDPMGQIFTIVGA 176

Query: 178 NRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVLLD 237
            RS+ IYQY+S G+ KL   + Q+VQ +P+ Y +TMSP  D IP+INSL N+ P+ VLLD
Sbjct: 177 ARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLD 236

Query: 238 RIQKFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNT 297
           R  +FK+  +LVGY + CKILKFSP +Y KT       T  +NLLASSGNE+G+V VWNT
Sbjct: 237 RNNEFKVSTTLVGYDSKCKILKFSPNLYEKT---NKTGTTRYNLLASSGNENGSVAVWNT 293

Query: 298 NRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEA 357
            R +PLF+A+ +  ++I DL W++ G+GLFA+S DG + +FAFQE ELG V+P E   + 
Sbjct: 294 KRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKL 353

Query: 358 AKEIKLLDPLPFKPKAEEPDTKLPPNKTAQQT-------TTNSKKQPKAAEITTISSTNM 410
              IK L+PLP   +  +P   + P  +   +       TT +K   K    TTI ST+M
Sbjct: 354 QASIKKLEPLP--TEELKPSHDIKPKTSGGSSVNLSLNPTTVTKSGKKKVVPTTIQSTSM 411

Query: 411 EFIQPSYMVPKDLKRKPVTEDPLLAQXXXXXXXXXXELDQIDFLDTNLFLPSVSFSKVRL 470
           EF  PSY VPKDLKRKP  E+ ++            ++D +DFLDTN+ +P++SFSK+RL
Sbjct: 412 EFNPPSYSVPKDLKRKPKDEETMV-----NGKKQKKDVDPMDFLDTNILMPNISFSKLRL 466

Query: 471 AHPKIRASFQYS--SQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVTL 528
           A PKIR SFQYS     N + D+KNG GN+QKPTSI+L  K+ E  + +FQ F+PKFVTL
Sbjct: 467 ATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTL 526

Query: 529 CSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWN 588
            SAG SFWA  T+ G +YV S +G+ L PPM++GVP SFLE  G YLLC+TS+GQ+YCW+
Sbjct: 527 SSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWD 586

Query: 589 VNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSA 648
           ++  ++ FP+N VY LLNP+LRYSDD+L+RAENITMC +T  G+P++TLSNGDGYMFD  
Sbjct: 587 IDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCD 646

Query: 649 MEAWMLINDSWWPYGSQYWNFMSSAGVDLT--SNDDEKKDKYWNAEADILAKEVKNNKNS 706
           ME W+LI+DSWW YGSQYW+  ++ GV +T  S+ D+KK++YWN EA+ L   V++NK+S
Sbjct: 647 METWLLISDSWWAYGSQYWDMTNTNGVVVTTGSDKDDKKNRYWNPEAENLVSNVRSNKSS 706

Query: 707 IINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEV 766
           I+NYLE+KTNDEL+RKGR+++LQ+FAK +LMKEGFENLE+++TL+HLEN++LVS +L E 
Sbjct: 707 IVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGED 766

Query: 767 EEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCANI 826
           +E  RLL +YCIR+ EMGY +R +  L WLY+  N K   +    R  L+K I+++CA+I
Sbjct: 767 QEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACADI 826

Query: 827 RQVQRVTTS 835
           RQVQRVT S
Sbjct: 827 RQVQRVTVS 835

>Kwal_55.21566
          Length = 873

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/853 (44%), Positives = 546/853 (64%), Gaps = 34/853 (3%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60
           MKLLK P  LH G++  C    + L   G   + +W    L+ AA G    KEV+E  K 
Sbjct: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVWSCSQLVGAAMGNISAKEVRE--KF 82

Query: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLDLNKDSNSEYKSREIGIFKDNEAITD 120
            + +LE+  E  R LVV  +  L  G+D  +   D   +   +   + +   +    +TD
Sbjct: 83  EIKVLEARLEPLR-LVVGSDACLYVGTDRTVLYADSLLEKGEKTSFQTLYHVEAPACVTD 141

Query: 121 LKYDKVNGLLFVSLSKANS---LQIMDSKTWELK-SSIEL-KSKPISIITDPLGQLLTVI 175
           +K+D   G +FV +++ N    + ++D+     +   I L  SKPI+ + DP GQ+ TVI
Sbjct: 142 VKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLGASKPITGVVDPAGQIFTVI 201

Query: 176 LQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTAVL 235
             +R+V ++QY + G+ KL   +N ++Q +PL Y ++MSPQ D +P++NS+  + P  +L
Sbjct: 202 CADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGSTPAILL 261

Query: 236 LDRIQKFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVW 295
           LDR   FK++ +LVG+   C+I +FSP +Y K +   S    T+NL A+SG + G+VV+W
Sbjct: 262 LDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQK--SGTKVTYNLAATSGFDTGSVVIW 319

Query: 296 NTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVT 355
           NT R+KPL +     +S++TDL+W + G  LFA++ +G L IFAF++ ELG  +P   V 
Sbjct: 320 NTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVD 379

Query: 356 EAAKEIKLLDPLPFKPKAEEPDTK-------LPPNKTAQQTTTNSKKQPKAAEITTISST 408
           +   +   L PLP     E PD         + P  +   T  N K +      TTI S 
Sbjct: 380 KLRSDCATLSPLP---PTEVPDLNQTIKPEIVAPGSSGVITKVNGKNK---VAPTTIRSL 433

Query: 409 NMEFIQPSYMVPKDLKRKPVTEDPLLAQXXXXXXXXXXELDQIDFLDTNLFLPSVSFSKV 468
           +MEFI PSY VPKDLKR+P  +DPL A           +L+ +DFLDT+L +P+VSFSKV
Sbjct: 434 SMEFIAPSYSVPKDLKRRP--KDPLQA---TTNKKQKHDLEPMDFLDTSLLMPTVSFSKV 488

Query: 469 RLAHPKIRASFQY--SSQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFV 526
           RLA PK+R SF Y  S+  +  + +KNG GN+Q PT ITL  K++   K +F+ FLPK +
Sbjct: 489 RLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIFEDFLPKLI 548

Query: 527 TLCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYC 586
           T+C++G +FW+  +D G +YV S SG+ L PPM++GVP SFLE  G++LLC+TSIGQ+YC
Sbjct: 549 TICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYC 608

Query: 587 WNVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFD 646
           WNV+  ++ FP   +Y LL+P LR+SDDVL+RAENITMC +T+ G+PIVTLSNGDGYM+D
Sbjct: 609 WNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYD 668

Query: 647 SAMEAWMLINDSWWPYGSQYWNFMSSAGVDLTSND----DEKKDKYWNAEADILAKEVKN 702
             ME WMLINDSWW YGSQYW+   +      +++     +KK++ WN+EA  L + +K 
Sbjct: 669 KVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKE 728

Query: 703 NKNSIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVSFR 762
           NK+SI+NYLE++TNDEL RKGR+++LQ+FAK +LMKEG+ENLEE++TL+HLENK+LVS R
Sbjct: 729 NKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLR 788

Query: 763 LKEVEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIIS 822
           L E EE  +LL IYCIR++EMGY +R    L WLYD  N K   +   +   L++ I+++
Sbjct: 789 LHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEELLRKILVA 848

Query: 823 CANIRQVQRVTTS 835
           CA+IR VQRVTTS
Sbjct: 849 CADIRHVQRVTTS 861

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/876 (43%), Positives = 549/876 (62%), Gaps = 53/876 (6%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIG-GKYLSIWDSQTLLNAATGKTDVKEVKELEK 59
           M+LLK P  +H+ Q+         + + G G ++  W  Q L++ A  +  +K++K    
Sbjct: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60

Query: 60  MSLDLLESNQEDGRWLVVLDNQRLVYGSDHLL------ACLDLNK-DSNSEYKSREIGIF 112
             +D    +     + +  D + L  GS+H L       C D N  +S  +  S+ +   
Sbjct: 61  FQVD---QDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFEC 117

Query: 113 KDNEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIEL--KSKPISIITDPLGQ 170
           K    ITD+KYD   G+LFV LS  N + +   KT++  S I +   SKPI+ I DP GQ
Sbjct: 118 KSPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQ 177

Query: 171 LLTVILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSL---- 226
             TV+  +RS+ +YQ +  GT KL   + Q VQ  PL YR++MSPQ D++P+INS+    
Sbjct: 178 TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVP 237

Query: 227 HNNVPTAVLLDRIQKFKIKLSLVGYVAD-CKILKFSPRIYSKTKSPTSNDTQTFNLLASS 285
           +N      LLDR   +K+  +LV   ++ C++L +SP  Y K        T+ +NL+A+S
Sbjct: 238 NNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTR-YNLIATS 296

Query: 286 GNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENEL 345
           G+ DG ++VWNT R+KPLF+A +V ++ I D+ W   G  LFAIS D  L  FAFQE +L
Sbjct: 297 GSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDL 356

Query: 346 GDVMP---VEAVTEAAKEI-KLLDPL--------PFKPKAEEPDTKLP-PNKTAQQTTTN 392
           G  +P   ++++ E  K++ KL +PL        P   K EE  +  P PN   +     
Sbjct: 357 GVALPQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGK 416

Query: 393 SKKQPKAAE-----ITTISSTNMEFIQPSYMVPKDLKRKPVTEDPLLAQXXXXXXXXXXE 447
              + K A      I TI ST+MEF  PSY VP+DLKRKP    P  +           E
Sbjct: 417 KPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATP--SNIAPGSKKQKKE 474

Query: 448 LDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQYS--SQGNFVLDIKNGLGNDQKPTSIT 505
           L  IDFLDT L LP+ SFS++RLA PKIR++F+YS  +  N +LD+KNG GN+Q+PT + 
Sbjct: 475 LQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVK 534

Query: 506 LTRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPV 565
           LT K  +  + LFQ F+PK +T+C+AG +FW++ ++ G IY+ S SG+ L  P++LGV +
Sbjct: 535 LTSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSI 594

Query: 566 SFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMC 625
           SFLE  G YLLC+TSIG++YCWN+   K+AFP N +Y LLNP LRYSDD+L+RAENIT+C
Sbjct: 595 SFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLC 654

Query: 626 AVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWWPYGSQYWNFMSSAGVDLTSNDDEKK 685
           ++T +G+P+VTLSNGDGY+FD  ME W+L++D WW YGSQYW+  ++ G+   S+     
Sbjct: 655 SITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGL---SSSKANT 711

Query: 686 DKYWNAEADI--LAKEVKNNKNSIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFEN 743
           D +  +E++I  +  ++KN+  SIIN+LE KTNDEL RKGR+K+LQRFA+ +LMKEGFEN
Sbjct: 712 DSFNGSESNINEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFEN 771

Query: 744 LEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYD----- 798
           +EE++TL+HLENKIL+S RL+E EE  +L+ +YCIR++E+GY DR +    WLYD     
Sbjct: 772 MEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPIS 831

Query: 799 PTNTKFSPLDIDRRRNLIKDIIISCANIRQVQRVTT 834
            T + F+  D D +RNL+K I+I+C +IRQVQRVTT
Sbjct: 832 GTGSAFA--DKDFKRNLLKKILIACGDIRQVQRVTT 865

>Scas_699.42
          Length = 885

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/887 (40%), Positives = 523/887 (58%), Gaps = 67/887 (7%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGG-KYLSIWDSQTLLNAATGKTDVKEVKELEK 59
           M+LLK P  L D  +       + L I+    ++ +W  Q+L+N A  K  +++++E   
Sbjct: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60

Query: 60  MSLDLLESNQEDGRWLVVLDNQRLVYGSDH--LLACLDLNKDSNSEYKSREIGIFKDNEA 117
             +D      +   + V   N  L+  +++  L++   L +D N +++         +  
Sbjct: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120

Query: 118 ITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIE------LKSKPISIITDPLGQL 171
           ITD+K D++N ++ VS+   + + + + +T +L + I+      L  +PI++I DP G  
Sbjct: 121 ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPCGTR 180

Query: 172 LTVILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHN--- 228
            TV+  +RS+ +YQ +  G  KL  +  Q+VQ +PL Y++TM PQGD +P+INS+     
Sbjct: 181 FTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGSTS 240

Query: 229 -NVPTAVLLDRIQKFKIKLSLVG-YVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSG 286
            ++ T VLLD    +KIK ++V    ++ K+LK+SP IY KT         ++NLLA+SG
Sbjct: 241 KDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKV-SYNLLATSG 299

Query: 287 NEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELG 346
            EDG +++WNT R+KPLF+A    +  I D+ W   GL LFAIS D  L  FAFQ+N+LG
Sbjct: 300 TEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLG 359

Query: 347 DVMPVEAVT---EAAKEIKLLDPLPFKPKA---------------------EEPDTKLPP 382
           D + +E VT   +  K++ +L  L    K                      +E  TK P 
Sbjct: 360 DQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPS 419

Query: 383 NKTAQQTTTNSKKQPKAAEITTISSTNMEFIQPSYMVPKDLKRK-PVTED---PLLA-QX 437
           +K       N   Q + + +    STNMEF  PSY VPKDLKRK P  ++   PL   Q 
Sbjct: 420 SKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNVPKDLKRKKPKVKESSTPLNGEQN 479

Query: 438 XXXXXXXXXELDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQYS--SQGNFVLDIKNGL 495
                    +L+ I FLDT L LP+VSFS++RLA PKIR  F Y+  S  N  + IKNG 
Sbjct: 480 PSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGS 539

Query: 496 GNDQKPTSITL------TRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWSTDTGMIYVTS 549
           G++Q P+ ++L       R+ +   K +FQ F+PK+V  C AG SFW   T  G +Y  +
Sbjct: 540 GSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYT 599

Query: 550 ISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPINDVYSLLNPML 609
            SG+ L PPM LGVP++FL+    YLLC+TS+G++YCW+++  K+ FP+  VY LL P +
Sbjct: 600 DSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSI 659

Query: 610 RYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWWPYGSQYWNF 669
           RYSDDVL+R ENITMC VTS+G+P+ TLSNGDGY+FD  ME+W+L++D WW YGSQYW+ 
Sbjct: 660 RYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDS 719

Query: 670 MSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKNSIINYLETKTNDELTRKGRMKHLQ 729
           +++       ND    ++  NAE          NK S+IN +E KTN+EL RKGR+KHLQ
Sbjct: 720 LNND----YKNDSNTLEELKNAE----------NKKSLINMMERKTNEELDRKGRIKHLQ 765

Query: 730 RFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRIAEMGYTDRF 789
           RFAK LLMKEGFEN+EE++TL+HLEN+ILVS +L+E  E   L+  Y  R+ E+GY +R 
Sbjct: 766 RFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGYIERL 825

Query: 790 SQTLSWLYDPTNTKFSPLDIDRRRNLI-KDIIISCANIRQVQRVTTS 835
           +  L W+Y+      S L + + R LI KDI+I+CA++R VQRVT +
Sbjct: 826 NDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTKA 872

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score =  436 bits (1122), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 306/466 (65%), Gaps = 18/466 (3%)

Query: 372 KAEEPDTKLPPNKTAQQTTTNSKK--QPKAAEITTISSTNMEFIQPSYMVPKDLKRKPVT 429
           K  +PD K   ++  +     ++    PK +  T   ST  +F  PSY VPKDLKRKP  
Sbjct: 520 KKTKPDKKSIKSENGESKVNKAQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLKRKP-K 578

Query: 430 EDPLLAQXXXXXXXXXXELDQIDFLDTNLFLPSVSFSKVRLAHPKIRASFQYSSQGN--F 487
           ED L             +L+ +DFLDT L LP+V+FS+VRL+ P IR +   +S  +   
Sbjct: 579 EDAL---GNAVTKRAKKDLEPVDFLDTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKI 635

Query: 488 VLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPKFVTLCSAGSSFWAWSTDTGMIYV 547
           +L+I+NG GN+QKPT + L  K     + LFQ F+PKFV+L ++G  FWA S++ G +Y+
Sbjct: 636 LLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYI 695

Query: 548 TSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAFPINDVYSLLNP 607
            +  G+ + PP+ +GVP+SFLE  G YLLC++SIG++YCWN+ + K+ FP+  ++ LL+P
Sbjct: 696 FNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSP 755

Query: 608 MLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAMEAWMLINDSWWPYGSQYW 667
            +RYSDD+L+RAENITMC+VT+ G PI TLSNGDGYM+D  ME W+L++D WW YGSQYW
Sbjct: 756 SIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYW 815

Query: 668 NFMSSAGVDLTSNDDEKKDKYWNAEADILAKEVKNNKNSIINYLETKTNDELTRKGRMKH 727
                   D T+N +   D          + E+  +K SI+  LE KTN+ELTRKGR+K+
Sbjct: 816 --------DSTNNSNLIPDSSTKPTEGQSSTEI--SKASIVTLLEKKTNNELTRKGRIKN 865

Query: 728 LQRFAKVLLMKEGFENLEEMITLAHLENKILVSFRLKEVEEAIRLLKIYCIRIAEMGYTD 787
           L+RFA+ +LMKEGFEN+EE++TL+HLENK+LV+ RL+E  E  +L+K+Y +++ E+GY D
Sbjct: 866 LRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLEEQHEFKKLIKLYAVKLGELGYVD 925

Query: 788 RFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDIIISCANIRQVQRVT 833
           R     +W+   +N     +    R+ L+K ++ +CA++R VQRVT
Sbjct: 926 RLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTACADLRSVQRVT 971

 Score =  169 bits (427), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 203/386 (52%), Gaps = 20/386 (5%)

Query: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKY--LSIWDSQTLLNAATGKTDVKEVKELE 58
           M+LLK P +   G +T     D +  ++ G    + +W  Q LL+ A  +  ++ +K   
Sbjct: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60

Query: 59  KMSLDLLESNQEDGRWLVVLDNQRLVYGSDHLL----ACLDLNKDSNSEYKSREIGIFKD 114
             + +L   + ED     + D   L  G++H +      L   +  ++  +++ I     
Sbjct: 61  SFTFEL--KDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVS 118

Query: 115 NEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELK--SSIEL--KSKPISIITDPLGQ 170
              ITD+K+D +  +LFV   +   + + D+++   K  +SI L   SKP++ + DP G 
Sbjct: 119 QSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSGA 178

Query: 171 -LLTVILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNN 229
              TV+  +RS+ +Y  +  G  K  + ++Q V   PL Y++TM PQ D +P+INSL  +
Sbjct: 179 GTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKGS 238

Query: 230 VPTA-----VLLDRIQKFKIKLSLV-GYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLA 283
              A     VLL+R + +K+  +LV    ++ K+L  SP++Y K        ++ +NL+A
Sbjct: 239 SGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISR-YNLVA 297

Query: 284 SSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQEN 343
           +S N DG++++WNT R KPLF    + +S I D+ W ++GL LFA+S D  L  FAF ++
Sbjct: 298 TSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQD 357

Query: 344 ELGDVMPVEAVTEAAKEIKLLDPLPF 369
           +LG  +P+E +    +   + +PLP 
Sbjct: 358 DLGKTVPMEEIENIRQSNIIKEPLPI 383

>Scas_702.16
          Length = 816

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 150/306 (49%), Gaps = 29/306 (9%)

Query: 130 LFVSLSKANSLQIMDSKTWE-LKSSIELKSKPISIITDPLGQLLTVILQNRSVQIYQYDS 188
           L VS+    ++ I +  T+E LK     +S    +I DP  +       +R+++I++Y  
Sbjct: 151 LLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFRYHK 210

Query: 189 HGTTK--LHQSINQFVQTNPLP---YRMTMSPQGDVIPMINSLHNNVPTAVLLDRIQKFK 243
            G     +   + +  + +PL     R++ SP G  I   N+ +  V +  +++R   + 
Sbjct: 211 IGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHIAAPNATNGPVSSVAIINR-GTWD 269

Query: 244 IKLSLVGYVADCKILKFSPRIY--------SKTKSPTSNDTQTFNLLASSGNEDGNVVVW 295
             +SL+G+ A  ++++F+PR++        +K K  +  +    +++A++G +D  VVVW
Sbjct: 270 SNISLIGHDAPTEVVRFNPRLFEVNDGMTPAKRKQDSGPNDSMESIIATAG-QDKTVVVW 328

Query: 296 NTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVT 355
           +T R +P+F A  + N  ITD++W   G  LF  S D  + I  F++NELG ++P+E   
Sbjct: 329 STTRARPIFIAFDIANKSITDMQWTPDGTMLFLTSLDSSITILVFEDNELGKIIPLEKNI 388

Query: 356 EAAKEIKL-LDPLPFKPKAEEPDTKLPPNKTAQQTTTNSKKQPKAAEITTISSTNMEFIQ 414
           E      +  D L F    E+            + T N  K+PK   +++ S+  ++  +
Sbjct: 389 EQLHRYGVDKDSLDFPESVEQ---------LIFEETVNKLKKPK---LSSTSNLQLQEKK 436

Query: 415 PSYMVP 420
           P  ++P
Sbjct: 437 PDSLLP 442

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 486 NF-VLDIKNGLGNDQKPTSITLTRK---DNES-------SKQLFQTFLPKFVTLCSAGSS 534
           NF VL+IKNG+       SI   ++   DN +        K     FLP+ V + + GSS
Sbjct: 634 NFRVLEIKNGVER-----SIQFDKEALYDNPTKLVGYYQGKICLTAFLPE-VVITAVGSS 687

Query: 535 F---WAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNT 591
               W  ST  G +Y+   +GQ   P + +G  +  +     YL+ +T  G  Y W++  
Sbjct: 688 HCQCWCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMINRERYLIALTERGLFYIWDIED 747

Query: 592 GKIA 595
            K+ 
Sbjct: 748 LKLV 751

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 118/238 (49%), Gaps = 16/238 (6%)

Query: 130 LFVSLSKANSLQIMDSKTWELKSSIELKSKPI-SIITDPLGQLLTVILQNRSVQIYQYDS 188
           + VS+    ++ I +  T+E     ++    +  ++ DP  +       +R++++++Y  
Sbjct: 148 IMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHK 207

Query: 189 HGTTK--LHQSINQFVQTNPLP---YRMTMSPQGDVIPMINSLHNNVPTAVLLDRIQKFK 243
            G T   +   I +  + +PL     R++ SP G  I   N+++  V T  +++R   ++
Sbjct: 208 TGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIER-GTWE 266

Query: 244 IKLSLVGYVADCKILKFSPRIYSKTKSPTSNDT---------QTFNLLASSGNEDGNVVV 294
             +SLVG+    ++  F+PRI+ + K  ++ DT            + + +S  +D  + V
Sbjct: 267 SPVSLVGHDQPTEVASFNPRIFKRQKDDSTTDTIDGKKTGISDEVDCIVASSGQDKTLAV 326

Query: 295 WNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVE 352
           W+T++ +PL  A  +    ITD+ W   G  LF  S D  +V+  F++NE G+ +P+E
Sbjct: 327 WSTSKARPLIVAQDICGKSITDMSWTPDGKILFITSLDSSIVVLTFEDNEFGEAIPLE 384

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 92.8 bits (229), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 98/411 (23%), Positives = 179/411 (43%), Gaps = 64/411 (15%)

Query: 1   MKLLKLPSKLHDGQLTQCEV------DDNKLYIIGG--KYLSIWDSQTLLNAATGKTDVK 52
           MK+LKLP   H       E+       D +    GG    + IW    +L  A  K  V 
Sbjct: 1   MKILKLPWLTHQEGQRNYEIYTVDVSSDGQRVATGGLDGKIRIWSVADILVFA--KPKVS 58

Query: 53  EVKELEKMSLDLLESNQEDGRWLVVL---DNQRLVYGSDHLLACL------------DLN 97
                E++   L   ++  G    +    DN+ L  GSD  +  +            D+ 
Sbjct: 59  WPAREEQLRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDME 118

Query: 98  KDSNSEYKSREIGIFKDNEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELK 157
            D    +  R   +  DN+ I D+ +   + +L V++    S+ + +  T+E     ++ 
Sbjct: 119 NDLE-HWNVRRRLVAHDND-IQDICWAPDSSIL-VTVGLDRSIIVWNGSTFEKIKRFDVH 175

Query: 158 SKPI-SIITDPLGQLLTVILQNRSVQIYQYDSHGTTKLHQSINQFV----QTNPLP---Y 209
              +  ++ DP  +       +R+V++++Y  H  T L  +I   +    Q +PL     
Sbjct: 176 QSHVKGVVFDPANKYFATASDDRTVKVFRY--HKGTDLSFTIEHIITEPFQGSPLTTYFR 233

Query: 210 RMTMSPQGDVIPMINSLHNNVPTAVLLDRIQKFKIKLSLVGYVADCKILKFSPRIY---- 265
           R++ SP G  I + N+ +  V T  ++ R   +   +SLVG+    ++  F+PR++    
Sbjct: 234 RLSWSPDGQHIAVPNATNGPVSTVAIISR-GNWDTSVSLVGHDQPTEVACFNPRLFEHND 292

Query: 266 -----------SKTKSPTS---------NDTQTFNLLASSGNEDGNVVVWNTNRIKPLFD 305
                      SK  S  S         +D +  +++A++G +D  + VW+T+R +P+F 
Sbjct: 293 NHERGEEVDGASKDNSAASESSGKRRLKDDDRVDSVIATAG-QDKTLAVWSTSRARPIFV 351

Query: 306 ASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTE 356
           A  + +  +TD+ W   G  LF  S DG++++  F+E ELG  +P+E   E
Sbjct: 352 AYDLTSKSVTDIAWTCDGTALFLTSLDGRIIVITFEEGELGKAIPLEQNVE 402

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 27/182 (14%)

Query: 488 VLDIKNGLGND---------QKPTSITLTRKDNESSKQLFQTFLPKFVTLC--SAGSSFW 536
           +L+I+NG+            + PT I          ++  + FLP+ V  C  S     W
Sbjct: 642 ILEIRNGVERSIQFDREALFENPTKIL----GYHQGERTLEAFLPEVVISCVGSKACQCW 697

Query: 537 AWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGKIAF 596
           A +T +G +Y+    GQ+L P + +G  V  L     +++  T     + W++   K+  
Sbjct: 698 ALATASGSLYIYGNHGQLLVPKISIGHKVIKLIAWQHFVIAFTETCLFWIWDIRAMKLVE 757

Query: 597 PINDVYSLL---NPM---LRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYMFDSAME 650
               V  +L    P    +R S  +L    +  M A + +   +V +S+G  Y++  A+ 
Sbjct: 758 KEISVLPVLVQDQPQCNRVRISRRIL----DFRMLADSHE--LLVEMSDGASYVWKKALG 811

Query: 651 AW 652
            W
Sbjct: 812 CW 813

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/392 (22%), Positives = 178/392 (45%), Gaps = 41/392 (10%)

Query: 1   MKLLKLPSKLHDGQLTQCEV------DDNKLYIIGG--KYLSIWDSQTLLNAATGKTDVK 52
           M+++K P   H  +    E+       D K    GG    + IW    L++AA G++ V 
Sbjct: 1   MRIVKFPWFSHHEESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVD 60

Query: 53  E--VKELEKMSLDLLESN----QEDGRWLVVLDNQR--LVYGSDHLLACLDLNKDSNSEY 104
               + L  MS             DG +L    + R  L++  D          +   E+
Sbjct: 61  RDTHRPLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEH 120

Query: 105 KSREIGIFKDNEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELKSKPI-SI 163
            +    +   +  I D+ +   + +L V++    S+ + +   +E     ++    +  +
Sbjct: 121 WTVRKRLVAHDNDIQDICWAPDSSIL-VTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGV 179

Query: 164 ITDPLGQLLTVILQNRSVQIYQYDSHGTTKLHQSINQFVQ----TNPLP---YRMTMSPQ 216
           I DP  +       +R++++++Y  H T ++  +I Q +      +PL     R++ SP 
Sbjct: 180 IFDPANKYFATASDDRTMRVFRY--HKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPD 237

Query: 217 GDVIPMINSLHNNVPTAVLLDRIQKFKIKLSLVGYVADCKILKFSPRIYS-----KTKSP 271
           G  I + N+ +  V +  +++R   +   +SL+G+ A  ++ +F+PR++      K K+ 
Sbjct: 238 GQHIAVPNATNGPVSSVAIINR-GTWDSSISLIGHDAPTEVARFNPRLFKSDVEKKAKNA 296

Query: 272 -------TSNDTQTFNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGL 324
                  T N+ +  +++A++G +D ++ +W T+R +P+F A  +    ITD+ W+ +G 
Sbjct: 297 KDELSKDTKNNKKLESIIATAG-QDKSLALWITSRPRPIFVAYDIAQKSITDMAWNPNGN 355

Query: 325 GLFAISQDGQLVIFAFQENELGDVMPVEAVTE 356
            LF  S D  +V+  F  NELG  +P+E   E
Sbjct: 356 ILFVTSLDSSIVMLMFDANELGMPIPIEGNME 387

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 11/116 (9%)

Query: 487 FVLDIKNGLGNDQKPTSITLTRKDN-------ESSKQLFQTFLPKFVT--LCSAGSSFWA 537
           F L+I+NG+    +  S  L   DN          ++  + F+P  +   + S  S +W+
Sbjct: 638 FTLEIRNGVERAIQFDSDALF--DNPTRILGYHEGQRTIEAFIPNVIISGVGSPVSKYWS 695

Query: 538 WSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNVNTGK 593
            +T  G IY+ S +GQ+L P + LG  V       +YLL +T  G  Y W+++  +
Sbjct: 696 LATADGFIYIISYNGQLLIPKINLGQKVVKQVVCSNYLLVLTERGLFYAWDISAKR 751

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/404 (22%), Positives = 180/404 (44%), Gaps = 51/404 (12%)

Query: 1   MKLLKLPSKLHDGQLTQCEV------DDNKLYIIGG--KYLSIWDSQTLLNAATGKTDVK 52
           MK++K P   H  +  + E+       D K    GG    + IW   ++L     ++   
Sbjct: 1   MKVVKFPWLAHREESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTP 60

Query: 53  EVKELEKMSLDLLESNQEDGRWLVVL---DNQRLVYGSDH---LLACLDLNKDSNSEYKS 106
           E+   + + + L   ++  G    V    D + L  GSD    L+  LD  + S   + S
Sbjct: 61  EIPLPQDLQMPLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGS 120

Query: 107 ---------REIGIFKDNEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELKSSIELK 157
                    R+  +  DN+ I D+ +   + +L V++    S+ + +  T+E     ++ 
Sbjct: 121 EHEREHWTVRKRLVAHDND-IQDICWAPDSSIL-VTVGLDRSVIVWNGSTFEKLKRFDVH 178

Query: 158 SKPI-SIITDPLGQLLTVILQNRSVQIYQYDSHG--TTKLHQSINQFVQTNPLP---YRM 211
              +  ++ DP  +       +R+++I++Y   G  +  +   I +  + +PL     R 
Sbjct: 179 QSLVKGVVFDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRP 238

Query: 212 TMSPQGDVIPMINSLHNNVPTAVLLDRIQKFKIKLSLVGYVADCKILKFSPRIYS----- 266
           + SP G  I + N+ +  V +  +++R   +   +SL+G+ A  ++ +F+PR++      
Sbjct: 239 SWSPDGQHIAVPNATNGPVSSMAIVNR-GTWDTNVSLIGHDAPTEVARFNPRLFERNAGV 297

Query: 267 ---KTKSPTS-----NDTQTFNL------LASSGNEDGNVVVWNTNRIKPLFDASKVVNS 312
              K   P +     ND +  +       + ++  +D ++ VW+T+R +P+  A  + N 
Sbjct: 298 KQKKDDDPENALVGQNDDKVHHFDKNIDSVVATAGQDKSLAVWSTSRPRPILVAFDIANK 357

Query: 313 YITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTE 356
            ITD+ W+  G  LF  S D  + +F F+ NELG  +P+E   E
Sbjct: 358 SITDMSWNPDGSLLFVASLDSSITLFKFENNELGKPIPLEKNME 401

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 13/112 (11%)

Query: 488 VLDIKNGLGNDQKPTSITLTRKDN-------ESSKQLFQTFLPKFVTLCSAGSS---FWA 537
           VL+I+NG+    +  S  L   DN       +  K+  +TF+P+ V +C+ GS     W 
Sbjct: 664 VLEIRNGVERSIQFDSEALL--DNPTRILGYQGGKRTIETFIPE-VIICAIGSKDCKCWC 720

Query: 538 WSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNV 589
            ++  G IY+ S +GQ   P + LG  V  +  S  YLL +T  G  + W++
Sbjct: 721 LASANGSIYILSYNGQQRIPKICLGHKVIKMVTSSKYLLVLTERGLFFAWDL 772

>Kwal_47.17465
          Length = 800

 Score = 79.0 bits (193), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 115/241 (47%), Gaps = 48/241 (19%)

Query: 162 SIITDPLGQLLTVILQNRSVQIYQYDSHG--TTKLHQSINQFVQTNPLP---YRMTMSPQ 216
            +I DP  +       +R+V+I++Y   G  +  +   +++  + +P+     R++ SP 
Sbjct: 126 GVIFDPANKYFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWSPD 185

Query: 217 GDVIPMINSLHNNVPTAVLLDRIQKFKIKLSLVGYVADCKILKFSPRIYS---------- 266
           G  I   N+ +  V +  ++ R   +   ++L+G+ +  ++++F+PR++           
Sbjct: 186 GQHIAAPNATNGPVSSVSIIAR-GSWDTSVTLIGHDSPTEVVRFNPRLFQVLEKKTEKNK 244

Query: 267 -KTKSP-TSNDTQTF-----------------------------NLLASSGNEDGNVVVW 295
            + +SP  S +TQ                               +++A++G +D  +VVW
Sbjct: 245 PEVESPLVSPETQNGVKDSQDEAGQRKDGQEEQEQEESVEEKVDSVIATAG-QDKTLVVW 303

Query: 296 NTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVT 355
           +T + +P+F A  + +  ITD+ W+ +G  LF  S DG ++ F F E ELG+ +P+E   
Sbjct: 304 STGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFGEKELGEAIPLERNV 363

Query: 356 E 356
           E
Sbjct: 364 E 364

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 17/115 (14%)

Query: 487 FVLDIKNGLGND---------QKPTSITLTRKDNESSKQLFQTFLPKFVTLCSAGS---S 534
           +V++++NG+            + PT I    K     +++    +P  V +C  GS    
Sbjct: 624 YVMEVRNGVERALQFDREALFEHPTRILAYHK----GERIIDLLIPD-VIICVVGSLKCK 678

Query: 535 FWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQMYCWNV 589
            W  +T  G IY+ +  GQ   P + LG  V  +     Y++ +T  G +Y WN+
Sbjct: 679 CWVLATADGCIYIYTKYGQQKMPKIALGHKVVKMVAVDKYVVILTETGLLYAWNI 733

>Kwal_27.10385
          Length = 536

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 62/150 (41%), Gaps = 23/150 (15%)

Query: 255 CKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSYI 314
           C ++ F+P  Y             + L+ +    D  V+V+++    P+     +  + I
Sbjct: 325 CLVISFNPLYYKLATKTQPYINLPYKLVFAVATSD-EVLVFDSETTSPICVIGNLHYTPI 383

Query: 315 TDLEWDNSGLGLFAISQDGQLVIFAFQENELG------------DV----MPVEAVTE-- 356
           TDL W   GL L   S DG     +F+E  LG            DV    +P E + E  
Sbjct: 384 TDLSWSQDGLMLMVSSTDGFCSYISFKEGTLGSQIGESVVKTANDVKAPEVPPEVLPEVP 443

Query: 357 AAKEIKLLDPLPFKPKAEEPDTKLPPNKTA 386
           A K   +++ LP K KA E    +P  K+A
Sbjct: 444 AKKSASVVNILPVKQKAPE----VPAKKSA 469

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 4/105 (3%)

Query: 257 ILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITD 316
           ++KF+P +Y +T S       T     ++ NE   V+V++T    P+  A  +  + ITD
Sbjct: 324 VVKFNPIMY-ETASEWVKAPYTLVFAVATTNE---VLVYDTQNTSPIAIAGNLHYTPITD 379

Query: 317 LEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEAAKEI 361
           L W   G  L   S DG      F +N+ G  +  +++    KE+
Sbjct: 380 LAWSQDGTLLMISSTDGFCSYIHFTDNDFGTPLKDQSIPILTKEL 424

>Scas_657.13
          Length = 411

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 285 SGNEDGNVVVWNTN--RIKPLFDASKVVNSYITDLEWDNSGLGLF-AISQDGQLVIFAFQ 341
           SG++DG + +WN N     P++  S V +  + D +W N  L +F ++S+D  L +   +
Sbjct: 190 SGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQR 249

Query: 342 ENE 344
           E +
Sbjct: 250 EKD 252

>Scas_512.3
          Length = 534

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 60/298 (20%), Positives = 108/298 (36%), Gaps = 72/298 (24%)

Query: 132 VSLSKANSLQIMDSKTWELKSSIELKSKPISIIT-DPLGQLLTVILQNRSVQIYQ--YDS 188
           VS S  NS+++ D ++ +L  +    +  +  +T DPL + +     +RSV IYQ  +DS
Sbjct: 162 VSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQIIWDS 221

Query: 189 HGTTKLHQSINQFVQTNPLP-------------------------------YRMTMSPQG 217
              T     +   +    LP                                R+T+SP G
Sbjct: 222 DSNTIDKLKLKNRIMKGELPQRDDENDKTKLDYKNLKTSFLFHNESLPSFFRRLTISPCG 281

Query: 218 DVIPMINSLHNNVPTAVLLDRIQKFKIKLSLVGYVADCKILK------------------ 259
            +  +   +  N  T+   D+ +     +S   Y+    I+K                  
Sbjct: 282 SIFCIPAGIFKNHTTSNSNDQGE-----ISNAVYIYTRAIIKQNSNNNRPVMILPFLKKP 336

Query: 260 -----FSPRIYSKTKSPTSNDTQTFNLL-------ASSGNEDGNVVVWNTNRIKPLFDAS 307
                F+P  Y  T        + +  L        ++ NE   V++++T  +KP+    
Sbjct: 337 ALVVSFNPNFYKLTHEEQEGTKKPYLKLPYRLIYAVATSNE---VLIYDTVNVKPISIIG 393

Query: 308 KVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEAVTEAAKEIKLLD 365
            +  + +TDL W   G  L   S DG       +EN  G+ + +E   +     KL++
Sbjct: 394 NLHYTALTDLSWSQDGNMLMVSSTDGFCSYITIEENLFGEKLTIEEREQYINANKLIN 451

>Kwal_26.8975
          Length = 445

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 285 SGNEDGNVVVWNTNRIKPLF------DASKVVNSYITDLEWDNSGLGLFAISQDGQLVI 337
           SG+ DG V VW+     P++      +  K +N  + D++W   GLG+ +  QD ++ I
Sbjct: 379 SGSHDGTVKVWDVRSSAPMYTITREAEVVKGINDKVFDVKW-AKGLGIISGGQDKKIQI 436

>YOR104W (PIN2) [4908] chr15 (517642..518490) Protein of unknown
           function [849 bp, 282 aa]
          Length = 282

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 18/88 (20%)

Query: 530 SAGSSFWAWST--DTGMIYVTSISGQMLFPPMLL----GVPVSFLEGSGDYLLCITSIGQ 583
           S G SF +W T  D     + +I G +L   +++    G+   F +G       +T IGQ
Sbjct: 24  STGKSFRSWDTCMDNKACKIIAIVGIVLACILVIWLIGGLLTCFRQG-------VTGIGQ 76

Query: 584 MYCW-----NVNTGKIAFPINDVYSLLN 606
             CW     N   G    P+N+ +S +N
Sbjct: 77  FICWCCRCSNDRNGNNTMPVNEGFSRVN 104

>Kwal_47.18114
          Length = 763

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 168 LGQLLTVILQNRSVQIYQYDS--------HGTTKLHQSINQFVQTNPL-PYRMTMSPQGD 218
           LG L T+  +N + QI Q+ S         G T +HQS+N    T+ L P R+   P GD
Sbjct: 360 LGGLSTLPAKNPAHQIKQHSSPRELSPETEGHTHIHQSLNGMTTTSTLKPARVPARPVGD 419

Query: 219 V 219
           +
Sbjct: 420 L 420

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 279 FNLLASSGNEDGNVVVW-NTNRIKPLFDASKVVNSYITDLEWDNSGLG--LFAISQDGQL 335
           F ++ +S + DG V++W   N       A +V ++ +  ++W     G  L A S DG++
Sbjct: 66  FGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKV 125

Query: 336 VIFAFQENELGDVMPV 351
            +  F+EN  G   P+
Sbjct: 126 SVVEFKEN--GTTSPI 139

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 257 ILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITD 316
           +++FSP +Y K ++      Q    L  +      VV+++T   KP+     +  + +TD
Sbjct: 324 VVRFSPILY-KIETGVEPWIQLPYKLVFAVATSTEVVIYDTVTTKPIAVVGNLHYTPLTD 382

Query: 317 LEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEA 353
           L W +SG  L   S DG     + +++  G+    EA
Sbjct: 383 LSWSDSGHLLVVSSTDGFCSYISMEDSLFGEPYSSEA 419

>CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces
           cerevisiae YMR092c AIP1, hypothetical start
          Length = 610

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 39/95 (41%), Gaps = 28/95 (29%)

Query: 246 LSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNR------ 299
           +   G+ A+  +++F+P                      SG+E G V+VW+ NR      
Sbjct: 61  VQFTGHGANVSVVRFAP----------------VGAYMCSGDESGKVIVWSWNRDGDGGV 104

Query: 300 ---IKPLFDASKVVNSYITDLEWDNSGLGLFAISQ 331
              +K  F   +V+   +TD+ WD  G  L  + +
Sbjct: 105 ECVVKAEF---QVLAGPVTDISWDFEGKRLCVVGE 136

>Scas_661.19
          Length = 478

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 14/68 (20%)

Query: 285 SGNEDGNVVVWN---TNRIK-PLFDASKVVNSY----------ITDLEWDNSGLGLFAIS 330
           SG+ DG++ +W+   TNR+   L   SK  N Y           TDL W N+G  L ++ 
Sbjct: 291 SGDADGSIKLWDLRMTNRLLIELRRFSKASNGYGNGTRAHLQSCTDLCWSNTGDELCSVG 350

Query: 331 QDGQLVIF 338
            DG+  I+
Sbjct: 351 TDGKCYIW 358

>CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06822
           Saccharomyces cerevisiae YPR085c, hypothetical start
          Length = 475

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 285 SGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEW 319
           SG+ DG V +WN    +P+F  SK+ N  + D+++
Sbjct: 37  SGDIDGEVTIWNLITRRPIF-TSKICNEQVVDIQF 70

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 282 LASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGL-------GLFAISQDGQ 334
           L ++G+ D  + +W  N+ +P+ DA +    +IT L W+   L        L + S+DG 
Sbjct: 200 LIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGT 259

Query: 335 LVIF 338
           + I+
Sbjct: 260 IKIW 263

>Kwal_47.18200
          Length = 268

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 79/217 (36%), Gaps = 38/217 (17%)

Query: 171 LLTVILQNRSVQ-IYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNN 229
           + T I Q R++  +  + S  T       +Q  +  PLP  + +S     +P   S+++ 
Sbjct: 11  VFTKIRQTRTLDTLAAFTSRKTASFRGPFSQLPEFTPLPDSILVS-----LPPSCSIYSK 65

Query: 230 VPTAVLLDRIQKFKIKLSLVGYVADCKILKFSPRIYSKTK-----SPTSNDTQTFNLLAS 284
           +    LL    K   K                P I+++T      S  S   +  N +  
Sbjct: 66  LSKINLLTFYSKSGNK----------------PLIHTETNLSSGFSKVSAGEEPVNAMLI 109

Query: 285 SGNEDGNVVVWNTNRIKP---LFDASKVVNSYITDLEWDNS-----GLGLFAISQDGQLV 336
           S     NV+V   +  K    L D    +  Y  DLE+        G G+ AIS  G L 
Sbjct: 110 SSTPISNVLVIELDDYKQGWCLKDPQNSIMCYSGDLEFQRDSQRVLGRGVLAISGQGPLY 169

Query: 337 IFAFQENELGDVMPVEAVTEAA---KEIKLLDPLPFK 370
               +ENE  D+ P   V  +     EI  L P   K
Sbjct: 170 RLHLEENETIDLCPESIVAHSEGIRSEISRLGPHALK 206

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 274 NDTQTFNLLASSGNEDGNVVVWNTN----RIKPLFDASKVVNSYITDLEWDNSGLGLF-A 328
           N  + ++LL  SG++D N+ +W+ +     IKP           I D++W +S   +F +
Sbjct: 188 NANEKYSLL--SGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGS 245

Query: 329 ISQDGQLVIF 338
           +S+D  + +F
Sbjct: 246 VSEDSTMKLF 255

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 3/74 (4%)

Query: 260 FSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEW 319
           FSP  Y   +              ++ NE   V+V++T+ ++PL     +  S ITDL W
Sbjct: 325 FSPVFYETCQKSVLKLPYKLVFAIATTNE---VLVYDTDVLEPLCVVGNIHYSPITDLAW 381

Query: 320 DNSGLGLFAISQDG 333
              G  L   S DG
Sbjct: 382 SEDGSTLLISSTDG 395

>Scas_674.20
          Length = 297

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 279 FNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSY-ITDLEWDNSGLG--LFAISQDGQL 335
           F  + +S + DG V++W     +    A   V+S  +  ++W     G  L A S DG++
Sbjct: 66  FGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLAASSDGKV 125

Query: 336 VIFAFQENELGDVMPV 351
            +  F+EN  G + P+
Sbjct: 126 SVVEFKEN--GTLTPI 139

>Kwal_56.24596
          Length = 294

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 279 FNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSY-ITDLEWDNSGLG--LFAISQDGQL 335
           F ++ +S + DG V++W     +    A   V+S  +  ++W     G  L A S DG++
Sbjct: 66  FGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGKV 125

Query: 336 VIFAFQENELGDVMPV 351
            +  F+EN  G   P+
Sbjct: 126 SVVEFKEN--GTTSPI 139

>YDR016C (DAD1) [869] chr4 complement(478470..478754) Subunit of the
           Dad1p-Duo1p-Dam1p complex
           (Dad1p-Duo1p-Dam1p-Ask1p-Spc19p-Spc34p-Dad2p), involved
           in kinetochore function and required for maintenance of
           spindle integrity during mitosis [285 bp, 94 aa]
          Length = 94

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 4/38 (10%)

Query: 678 TSNDDEK----KDKYWNAEADILAKEVKNNKNSIINYL 711
           TSND+EK     DKY+  + +I+ +E+    NSI+N L
Sbjct: 5   TSNDEEKLISTTDKYFIEQRNIVLQEINETMNSILNGL 42

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 282 LASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGL-------GLFAISQDGQ 334
           L ++G+ D  + +W +++ KP  DA +  + +IT L W+   L        L   S+DG 
Sbjct: 200 LIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGT 259

Query: 335 LVIF 338
           + I+
Sbjct: 260 IKIW 263

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 284 SSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWD-------NSGLGLFAISQDGQLV 336
           ++G+ D  + +W+    KPL DA +  + +IT L W+        S   L + S+DG + 
Sbjct: 204 ATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIR 263

Query: 337 IF 338
           I+
Sbjct: 264 IW 265

>Kwal_26.8628
          Length = 422

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 276 TQTFNLLASSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQL 335
            QT + + +SG  DG V +W+T R +    +  V  S I+ L++ N+G  +   + DG  
Sbjct: 229 AQTSSPIFASGGSDGYVYIWDT-RARAAAQSFFVSESDISTLKFFNNGYAIVTGADDGVA 287

Query: 336 VIF 338
            +F
Sbjct: 288 RMF 290

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 13/58 (22%)

Query: 284 SSGNEDGNVVVWNTNR----------IKPLFDASKVVNSYITDLEWDNSGLGLFAISQ 331
           +SG++ G V+VW  +R          IK  F   +V+   ITD+ WD  G  L  + Q
Sbjct: 78  ASGDDSGKVIVWGWSRDTEEGLITTTIKSEF---QVIAGPITDISWDFEGRRLCVVGQ 132

>YBR156C (SLI15) [341] chr2 complement(551060..553156) Mitotic
           spindle protein required for proper chromosome
           segregation [2097 bp, 698 aa]
          Length = 698

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 5/62 (8%)

Query: 454 LDTNLFLPSVSFSKVRLAHPKIRASFQYS-SQGNFVLDI----KNGLGNDQKPTSITLTR 508
           ++ +L  P  + +K+ +  PK++  ++ S SQ +   D+    +NGL ND+  T  +L R
Sbjct: 67  MEESLISPENTHNKMDVEFPKMKGEYELSNSQNDAAKDVTKTPRNGLHNDKSITPKSLRR 126

Query: 509 KD 510
           K+
Sbjct: 127 KE 128

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,241,742
Number of extensions: 1300523
Number of successful extensions: 4971
Number of sequences better than 10.0: 79
Number of HSP's gapped: 5101
Number of HSP's successfully gapped: 86
Length of query: 835
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 725
Effective length of database: 12,788,129
Effective search space: 9271393525
Effective search space used: 9271393525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)