Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E21923g37837219700.0
Kwal_55.2156337235412611e-174
YDR268W (MSW1)37936512411e-171
ACR089C38935711761e-161
Sklu_1979.431429411511e-158
CAGL0M08624g33732911021e-150
Scas_615.1037938010671e-145
KLLA0F15389g397345920.002
Sklu_1679.2409336920.002
AAL148W404352870.009
Kwal_56.22658422195860.012
KLLA0B07733g432209840.023
Scas_502.4446182780.11
CAGL0I07579g425241770.17
YOL097C (WRS1)432192750.29
ADR117W426194730.42
CAGL0H09372g392332720.54
Scas_659.23396231720.64
YGR185C (TYS1)394243691.2
YCR042C (TAF2)140730682.2
AFR724C440209637.5
KLLA0F18700g77056629.7
Kwal_55.20214127570639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21923g
         (372 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   763   0.0  
Kwal_55.21563                                                         490   e-174
YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   482   e-171
ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   457   e-161
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        447   e-158
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   429   e-150
Scas_615.10                                                           415   e-145
KLLA0F15389g complement(1422689..1423882) highly similar to sp|P...    40   0.002
Sklu_1679.2 YGR185C, Contig c1679 2614-3843                            40   0.002
AAL148W [39] [Homologous to ScYGR185C (TYS1) - SH] complement(84...    38   0.009
Kwal_56.22658                                                          38   0.012
KLLA0B07733g 677879..679177 highly similar to sp|Q12109 Saccharo...    37   0.023
Scas_502.4                                                             35   0.11 
CAGL0I07579g complement(730664..731941) highly similar to sp|Q12...    34   0.17 
YOL097C (WRS1) [4723] chr15 complement(136526..137824) Tryptopha...    33   0.29 
ADR117W [1858] [Homologous to ScYOL097C (WRS1) - SH] complement(...    33   0.42 
CAGL0H09372g complement(918777..919955) highly similar to sp|P36...    32   0.54 
Scas_659.23                                                            32   0.64 
YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tR...    31   1.2  
YCR042C (TAF2) [575] chr3 complement(201169..205392) Component o...    31   2.2  
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    29   7.5  
KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...    28   9.7  
Kwal_55.20214                                                          29   9.9  

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MLASSQLVRNKSRILFKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAV 60
           MLASSQLVRNKSRILFKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAV
Sbjct: 1   MLASSQLVRNKSRILFKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAV 60

Query: 61  RVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVF 120
           RVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVF
Sbjct: 61  RVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVF 120

Query: 121 HQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQA 180
           HQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQA
Sbjct: 121 HQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQA 180

Query: 181 ADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPE 240
           ADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPE
Sbjct: 181 ADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPE 240

Query: 241 KKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQ 300
           KKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQ
Sbjct: 241 KKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQ 300

Query: 301 RVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKA 360
           RVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKA
Sbjct: 301 RVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKA 360

Query: 361 REIAAKNITEIK 372
           REIAAKNITEIK
Sbjct: 361 REIAAKNITEIK 372

>Kwal_55.21563
          Length = 372

 Score =  490 bits (1261), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/354 (65%), Positives = 282/354 (79%)

Query: 19  FNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDDGTTLLF 78
            + +VKTT +K+  SDLP NA +FS++QPTGKFHLGNYLGAVRVWKD+ D K   T L+F
Sbjct: 14  LSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMF 73

Query: 79  GTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSL 138
           G ADLHAIT+P P+  + R  R EA+ASILS+G+DP KA++F+QSRV QHTELHWLLS+L
Sbjct: 74  GVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTL 133

Query: 139 ASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQS 198
           A MG LNRMTQWKSKSN+ + SD+ ALG +KLGLFSYPVLQAADILLY+STHVPVGDDQ+
Sbjct: 134 APMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQA 193

Query: 199 QHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITD 258
           QHLELTR L+  FNK YK    P+PTTILAPTK+ILSL + + KMSKSD NQN+ IY+ D
Sbjct: 194 QHLELTRTLAQYFNKLYKRPILPLPTTILAPTKRILSLADIDSKMSKSDQNQNATIYLND 253

Query: 259 EPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIEDVEKDIAHIKDHK 318
           EP+ I KKI++AVTDS S +FY+DP  RPG+SNLIN +SG+QR SI+ VEKDI+    H 
Sbjct: 254 EPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHS 313

Query: 319 DFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREIAAKNITEIK 372
           +FK +V++VLVE L   RE+F+ YMK+PDYL KV E GA  A + A K+I EIK
Sbjct: 314 EFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEKSIKEIK 367

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  482 bits (1241), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/365 (61%), Positives = 286/365 (78%), Gaps = 6/365 (1%)

Query: 13  RILFKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDD 72
           +++ KR+ S+V+   FKL    L  NAT+FS+IQPTG FHLGNYLGA RVW D+ +LK  
Sbjct: 9   KLISKRWISTVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQP 68

Query: 73  GTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELH 132
           G  L+FG ADLHAITVPKP+ + FR +R EA+ASIL++G+DPEKA V +QS + QH+ELH
Sbjct: 69  GQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELH 128

Query: 133 WLLSSLASMGSLNRMTQWKSKSNINDQSD------DAALGAIKLGLFSYPVLQAADILLY 186
           WLLS+LASMG LNRMTQWKSKSNI   ++      D+ +G ++LGLFSYPVLQAADILLY
Sbjct: 129 WLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLY 188

Query: 187 KSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKS 246
           KSTHVPVGDDQSQHLELTR L+  FNK YK  +FP P T+LA TKK+LSL  PEKKMSKS
Sbjct: 189 KSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKS 248

Query: 247 DTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIED 306
           D N +SVI++ DEP+ I KKI++A+TDSISD FY+DPV+RPG+SNLIN +SG+QR SIED
Sbjct: 249 DPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIED 308

Query: 307 VEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREIAAK 366
           V +D++   +++DFK +V++V++EEL   R +F +Y+  P YLH V E G  KARE AAK
Sbjct: 309 VVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAK 368

Query: 367 NITEI 371
           N+ +I
Sbjct: 369 NLADI 373

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  457 bits (1176), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 212/357 (59%), Positives = 270/357 (75%), Gaps = 1/357 (0%)

Query: 16  FKRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDDGTT 75
           F R  S+++   +  R   LP  A +FSLIQPTGKFHLGNYLGAVRVW ++++    G  
Sbjct: 29  FVRKASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGK 88

Query: 76  LLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLL 135
            +FGTADLHAIT+PKP+   FR  R EAIAS+L++GIDP K+I+FHQS+V +H EL W L
Sbjct: 89  CIFGTADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYL 148

Query: 136 SSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGD 195
           S+L SMG+LNRMTQWK+K+NI D S +  +GA+KLGLF+YPVLQAAD+LLYKSTH+PVG+
Sbjct: 149 STLTSMGALNRMTQWKTKANIKDTSSEK-VGAVKLGLFTYPVLQAADVLLYKSTHIPVGE 207

Query: 196 DQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIY 255
           DQ Q LELTRQL+  FN  YKT+YF  PTT+L PT+K+LSL NP KKMSKSD NQNS I 
Sbjct: 208 DQVQQLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCIC 267

Query: 256 ITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIEDVEKDIAHIK 315
           +TDEP+ I +KI+ AVTDSI   F +DP  RPG+SNLIN ++G+Q+ +I  VE DIA  K
Sbjct: 268 VTDEPDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFK 327

Query: 316 DHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREIAAKNITEIK 372
           DH  FK +VTD+LV EL   RE+F RYM +  Y+++V  +GA +A  IAAK + E++
Sbjct: 328 DHATFKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAEVR 384

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  447 bits (1151), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 246/294 (83%), Gaps = 1/294 (0%)

Query: 17  KRFNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDDGTTL 76
           KRF ++VKTT + L   D+P  +TIFSLIQPTGKFHLGNYLGAVRVWKD+ D   D + L
Sbjct: 11  KRFLTTVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDLDESKL 70

Query: 77  LFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLS 136
           LFG ADLHAIT+PKPN+ EFR YR EAIASILSIGIDP+KAI+FHQS+V QH ELHW+LS
Sbjct: 71  LFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAELHWILS 130

Query: 137 SLASMGSLNRMTQWKSKSNI-NDQSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGD 195
           ++A +G LNRMTQWKSKSN+  D SD  ALG +KLGLF+YPVLQAADILLY STHVPVGD
Sbjct: 131 TIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTHVPVGD 190

Query: 196 DQSQHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIY 255
           DQSQHLELTR L+  FNK YK  YFP+PTTILAPTKKILSL +P KKMSKSD NQNSVIY
Sbjct: 191 DQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQNSVIY 250

Query: 256 ITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIEDVEK 309
           + D+PE I+KKIK+AVTDSIS  F +DP  RPG+SNLIN +SG+QR SI +VEK
Sbjct: 251 LNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVEK 304

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  429 bits (1102), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 254/329 (77%), Gaps = 2/329 (0%)

Query: 44  LIQPTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEA 103
           ++QPTGKFHLGNYLGA RVWKD+ D+K  G  L+FG ADLHAIT+PKP+A +F+  R EA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 104 IASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDA 163
           IASIL++G+DP +A + +QS +  H++L+WLLS++A MG LNRMTQWKSKSN+ +  D  
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120

Query: 164 A--LGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFP 221
           A  LG +KLGLF YPVLQAADILLYK+THVPVGDDQ QHLELTR L+  FNK YK + FP
Sbjct: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180

Query: 222 MPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYF 281
           +P T+LAPTKKILSL +  KKMSKSD NQ+ VIY+ D PE I +KIK+A TDSI+D FY+
Sbjct: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240

Query: 282 DPVKRPGISNLINTLSGVQRVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHR 341
           DPV RPG+SNLIN +SG+ +  +  VE+++    +++D K HV++V++EEL   RE+FH+
Sbjct: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300

Query: 342 YMKNPDYLHKVSEDGASKAREIAAKNITE 370
           YM++P +L    + G  +A EIAA  + E
Sbjct: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKE 329

>Scas_615.10
          Length = 379

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 205/380 (53%), Positives = 271/380 (71%), Gaps = 16/380 (4%)

Query: 1   MLASSQLVRNKSRILFKR----FNS--SVKTTGFKLRE--SDLPKNATIFSLIQPTGKFH 52
           MLA   + R+ S     R     NS  +V+ T + L++    LP +ATIFSLIQPTGKFH
Sbjct: 1   MLARRCIPRSTSATRLSRGLASMNSKGTVQNTDYALQDISQTLPSDATIFSLIQPTGKFH 60

Query: 53  LGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASILSIGI 112
           LGNYLGA R+WK I+  K    T +FG ADLHAITVPKP+  EF   R EA+ASILS+GI
Sbjct: 61  LGNYLGATRIWKQISQSKQPTQTAIFGVADLHAITVPKPDPMEFLQCRREALASILSLGI 120

Query: 113 DPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGL 172
           DP+ AI+ +QS V QHT+LHW+LS+  SMG LNRMTQWK+K+  N  S       +KLGL
Sbjct: 121 DPQNAIMMYQSEVPQHTQLHWVLSTFTSMGVLNRMTQWKAKAKSNHMS-------VKLGL 173

Query: 173 FSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTK-YFPMPTTILAPTK 231
           FSYPVLQAADILLYK+THVPVGDDQ Q LEL R ++  FN+FY  + +FP+P TILAPTK
Sbjct: 174 FSYPVLQAADILLYKATHVPVGDDQCQPLELCRSIAQQFNQFYGDENFFPIPRTILAPTK 233

Query: 232 KILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGISN 291
           KILSL +P KKMSKSD N++S IY+ D  ++I KKI++AVTDS++    FDPV RPG+SN
Sbjct: 234 KILSLGDPLKKMSKSDPNKDSNIYVNDAADVIVKKIRKAVTDSVTGPITFDPVNRPGVSN 293

Query: 292 LINTLSGVQRVSIEDVEKDIAHIKDHKDFKQHVTDVLVEELAPSREQFHRYMKNPDYLHK 351
           L+N +SG+ +  +  VE++++H+    +FK +V +++VEEL   RE++ + M  P+YL +
Sbjct: 294 LLNMVSGITQREMSAVEQEVSHLSHLGEFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQ 353

Query: 352 VSEDGASKAREIAAKNITEI 371
           V + GA +AR IA  N+ ++
Sbjct: 354 VGDQGAERARAIAEVNMRQV 373

>KLLA0F15389g complement(1422689..1423882) highly similar to
           sp|P36421 Saccharomyces cerevisiae YGR185c TYS1
           tyrosyl-tRNA synthetase singleton, start by similarity
          Length = 397

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 133/345 (38%), Gaps = 88/345 (25%)

Query: 47  PTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYR------ 100
           PTG+ H G ++   +    + D    G  +    ADLHA       + E   YR      
Sbjct: 46  PTGRPHCGYFVPMTK----LADFLKAGCEVTVLLADLHAFLDNMKASLEVVAYRAKYYEL 101

Query: 101 -IEAIASILSIGIDPEKAIVFHQSRVSQHTELH-WLLSSLASMGSLNRMTQWKSKSNIND 158
            I+AI   +++ I+  K ++    + S    +  + LS++ S     R     + +++  
Sbjct: 102 VIKAILRSINVPIEKLKFVIGSSYQTSNEYIMDIFKLSNIVSQNDAKR-----AGADVVK 156

Query: 159 QSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTK 218
           Q  +  L  +      YP++QA D                +HL +  Q    F    + K
Sbjct: 157 QVANPLLSGL-----IYPLMQALD---------------EEHLGVDVQ----FGGVDQRK 192

Query: 219 YFPMPTTILAPT--KKILSLLNP-------EKKMSKSDTNQNSVIYITDEPEIIAKKIKR 269
            F +    L     KK   L+NP         KMS SD N  S I + +EP+ + KKI  
Sbjct: 193 IFVLAEENLEKLGYKKRAHLMNPMVPGLGQGGKMSASDPN--SKIDLLEEPKQVKKKINS 250

Query: 270 AVT--------------DSI----------SDSFYFDPVKRPGISNLINTLSG-VQRVSI 304
           A                +S+          SD F FD + RP          G +   S+
Sbjct: 251 AFCAPGVVEDNGLLAFIESVVAPIQELKYGSDHFKFD-INRP------EKFGGPISYTSL 303

Query: 305 EDVEKDIAHIK-DHKDFKQHVTDVLVEELAPSREQFHRYMKNPDY 348
           + +++D    K    D K  V+D + E LAP RE+F     NP++
Sbjct: 304 DQIKQDFKEQKLAPPDLKSGVSDAINELLAPLREEFQN---NPEF 345

>Sklu_1679.2 YGR185C, Contig c1679 2614-3843
          Length = 409

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 138/336 (41%), Gaps = 70/336 (20%)

Query: 47  PTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYR------ 100
           PTG+ H G ++   +    +      G  +    ADLHA         E  NYR      
Sbjct: 50  PTGRPHCGYFVPMTK----LAHFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYEF 105

Query: 101 -IEAIASILSIGIDPEKAIVFHQSRV-SQHTELHWLLSSLASMGSLNRMTQWKSKSNIND 158
            +++I   +++ I+  K +V    ++ +++T   + LS++ S     R     + +++  
Sbjct: 106 VVKSILKSINVPIEKLKFVVGSSYQLEAKYTMDLFRLSNIVSQNDAKR-----AGADVVK 160

Query: 159 QSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGD-DQSQHLELTRQLSNTFNKFYKT 217
           Q  +  L  +      YP++QA D   Y +  V  G  DQ +   L  +        YK 
Sbjct: 161 QVSNPLLSGL-----IYPLMQALD-EEYLAVDVQFGGVDQRKIFVLAEENMQALG--YKK 212

Query: 218 KYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRA------V 271
           +       ++ P   ++  L    KMS SD N  S I + +EP+ + KKI  A      V
Sbjct: 213 R-----AHLMNP---MVPGLTQGGKMSASDPN--SKIDVLEEPKQVKKKINSAYCAPGVV 262

Query: 272 TDSISDSF----------------YFD-PVKRPGISNLINTLSG-VQRVSIEDVEKDIAH 313
            D+   SF                YF+ P++RP          G +   S   +++D   
Sbjct: 263 DDNGLLSFIEYVVAPIQELKYGPDYFNFPIERP------EKFGGPITYTSFSQLKEDFKE 316

Query: 314 IK-DHKDFKQHVTDVLVEELAPSREQFHRYMKNPDY 348
            K    D K  V+DV+ + LAP RE+F    KNPD+
Sbjct: 317 QKLAPPDLKTGVSDVINKLLAPIREEF---AKNPDF 349

>AAL148W [39] [Homologous to ScYGR185C (TYS1) - SH]
           complement(84528..85742) [1215 bp, 404 aa]
          Length = 404

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 87/352 (24%), Positives = 135/352 (38%), Gaps = 77/352 (21%)

Query: 47  PTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIE---- 102
           PTGK H G ++   +    +      G  +    ADLHA       + E  NYR+     
Sbjct: 47  PTGKPHCGYFVPMTK----LAHFLRAGCEVTVLLADLHAFLDNMKASLEVVNYRVRYYEF 102

Query: 103 AIASIL-SIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSD 161
            + +IL SI +  EK              L +++ S     +   M  ++  SN+  Q+D
Sbjct: 103 VVKAILRSINVPIEK--------------LRFVVGSSYQTSAAYTMDLFRM-SNVVSQND 147

Query: 162 DAALGA---------IKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFN 212
               GA         +  GL  YP++QA D           G DQ +   L  +  N  +
Sbjct: 148 AKRAGADVVKQVSNPLLSGLL-YPLMQALDEEYLGVDAQFGGVDQRKIFVLAEE--NMGS 204

Query: 213 KFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVT 272
             YK +       ++ P    L++     KMS SD N  S I I +EP+++ KKI  A  
Sbjct: 205 LGYKKR-----AHLMNPMVPGLTMGG---KMSASDPN--SKIDILEEPKVVKKKINTAFC 254

Query: 273 D--SISDS-------FYFDPVKR----PGISNLI----NTLSGVQRVSIEDVEKDIAHIK 315
               + D+       +   P++     PG             G   ++    E+     K
Sbjct: 255 SPGEVEDNGLLSFIQYVLGPIQELKNAPGYFEFFIDRPEKFGG--PITYHSFEELRQAFK 312

Query: 316 DHK----DFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREI 363
           D K    D K  V D +   LAP RE+F     NP++     +D A+KA  +
Sbjct: 313 DQKLAPPDLKTGVADAINALLAPIREEF---ANNPEF-----QDVAAKAYPV 356

>Kwal_56.22658
          Length = 422

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 78/195 (40%), Gaps = 50/195 (25%)

Query: 94  KEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSK 153
           K+ +++  +  + I+S+G DP+K  +F               S L  MG     T  +  
Sbjct: 150 KDVKHFARQNASDIISVGFDPKKTFIF---------------SDLEYMGGGFYETVVRVS 194

Query: 154 SNINDQSDDAALGAIK---LGLFSYPVLQAA--------DIL-LYKSTH--VPVGDDQSQ 199
             I   +  A  G      +G F +  +Q A        D+L L + T   +P   DQ  
Sbjct: 195 RQITGSTAKAVFGFTDSDCIGKFHFASIQIASAFPSSYPDVLGLPEKTPCLIPCAIDQDP 254

Query: 200 HLELTRQLSNTFNKFYK-----TKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVI 254
           +  + R ++    KF K     +K+FP             +L     KMS SD    + I
Sbjct: 255 YFRVCRDVAEKL-KFSKPSLIHSKFFP-------------ALQGSTTKMSASD--DTTAI 298

Query: 255 YITDEPEIIAKKIKR 269
           ++TD P+ I KKI +
Sbjct: 299 FMTDTPKQIQKKINK 313

>KLLA0B07733g 677879..679177 highly similar to sp|Q12109
           Saccharomyces cerevisiae YOL097c WRS1 tryptophan--tRNA
           ligase singleton, start by similarity
          Length = 432

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 79/209 (37%), Gaps = 50/209 (23%)

Query: 80  TADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLA 139
           T D   +  PK   K+ + +  +    I+++G +PEK  +F               S L 
Sbjct: 140 TDDEKFLFKPKLTIKDVKKFTKDNAKDIVAVGFNPEKTFIF---------------SDLE 184

Query: 140 SMGSLNRMTQWKSKSNINDQSDDAALGAIK---LGLFSYPVLQAA--------DILLYKS 188
            MG     T  +    I   +  A  G      +G F +  +Q A        D+L    
Sbjct: 185 YMGGGFYETVVRISRQITGSTAKAVFGFTDSDCIGKFHFASIQIASAFPSSFPDVLGLPD 244

Query: 189 ---THVPVGDDQSQHLELTRQLSNTFNKFYK-----TKYFPMPTTILAPTKKILSLLNPE 240
                +P   DQ  +  + R +++   K+ K     +++FP             +L    
Sbjct: 245 KTPCLIPCAIDQDPYFRVCRDVADKL-KYSKPSLLHSRFFP-------------ALQGSS 290

Query: 241 KKMSKSDTNQNSVIYITDEPEIIAKKIKR 269
            KMS SD    S I++TD P+ I KKI +
Sbjct: 291 TKMSASD--DTSAIFMTDTPKQIQKKINK 317

>Scas_502.4
          Length = 446

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 69/182 (37%), Gaps = 50/182 (27%)

Query: 107 ILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALG 166
           I+++G +PE   +F               S L  MG     T  +    I   +  A  G
Sbjct: 185 IIAVGFNPENTFIF---------------SDLQYMGGGFYETVVRVSRQITGSTAKAVFG 229

Query: 167 AIK---LGLFSYPVLQAA--------DIL-LYKSTH--VPVGDDQSQHLELTRQLSNTFN 212
                 +G F +  +Q A        D+L L   T   +P   DQ  +  + R ++    
Sbjct: 230 FTDSDCIGKFHFASIQIASAFPNSFPDVLGLPDKTQCLIPCAIDQDPYFRVCRDVAEKL- 288

Query: 213 KFYK-----TKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKI 267
           KF K     +K+FP             +L     KMS SD    S I++TD P+ I KKI
Sbjct: 289 KFAKPALLHSKFFP-------------ALQGSTTKMSASD--DTSAIFMTDTPKQIQKKI 333

Query: 268 KR 269
            +
Sbjct: 334 NK 335

>CAGL0I07579g complement(730664..731941) highly similar to sp|Q12109
           Saccharomyces cerevisiae YOL097c WRS1 tryptophan--tRNA
           ligase, hypothetical start
          Length = 425

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 89/241 (36%), Gaps = 52/241 (21%)

Query: 48  TGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIEAIASI 107
           +G  H+G +L      K + D+ D    +   T D   +  PK    + + +  E    I
Sbjct: 109 SGSMHMG-HLVPFMFTKWLQDVFDCALVIEL-TDDEKFLFKPKLTIDDVKGFARENARDI 166

Query: 108 LSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGA 167
           +++G +PE   +F               S L  MG        +    I   +  A  G 
Sbjct: 167 IAVGFNPENTFIF---------------SDLEYMGGAFYENVVRVSRQITGSTAKAVFGF 211

Query: 168 IK---LGLFSYPVLQAA--------DILLY---KSTHVPVGDDQSQHLELTRQLSNTFNK 213
                +G F +  +Q A        D+L         +P   DQ  +  + R +++   K
Sbjct: 212 TDSDCIGKFHFASIQIATAFPSSFPDVLGLPPKTPCLIPCAIDQDPYFRVCRDVADKL-K 270

Query: 214 FYK-----TKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIK 268
           + K     +++FP             +L     KMS SD    S I++TD P+ I KKI 
Sbjct: 271 YSKPALIHSRFFP-------------ALQGSTTKMSASD--DTSAIFMTDTPKQIQKKIN 315

Query: 269 R 269
           +
Sbjct: 316 K 316

>YOL097C (WRS1) [4723] chr15 complement(136526..137824)
           Tryptophanyl-tRNA synthetase, member of the class I
           aminoacyl tRNA synthetase family [1299 bp, 432 aa]
          Length = 432

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 71/192 (36%), Gaps = 50/192 (26%)

Query: 97  RNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNI 156
           +N+  E    I+++G DP+   +F               S L  MG     T  +    I
Sbjct: 160 KNFARENAKDIIAVGFDPKNTFIF---------------SDLQYMGGAFYETVVRVSRQI 204

Query: 157 NDQSDDAALG---AIKLGLFSYPVLQAADILLYKSTHV-----------PVGDDQSQHLE 202
              +  A  G   +  +G F +  +Q A        +V           P   DQ  +  
Sbjct: 205 TGSTAKAVFGFNDSDCIGKFHFASIQIATAFPSSFPNVLGLPDKTPCLIPCAIDQDPYFR 264

Query: 203 LTRQLSNTFNKFYK-----TKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYIT 257
           + R +++   K+ K     +++FP             +L     KMS SD    + I++T
Sbjct: 265 VCRDVADKL-KYSKPALLHSRFFP-------------ALQGSTTKMSASD--DTTAIFMT 308

Query: 258 DEPEIIAKKIKR 269
           D P+ I KKI +
Sbjct: 309 DTPKQIQKKINK 320

>ADR117W [1858] [Homologous to ScYOL097C (WRS1) - SH]
           complement(911631..912911) [1281 bp, 426 aa]
          Length = 426

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 72/194 (37%), Gaps = 54/194 (27%)

Query: 97  RNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNI 156
           +++  E    I+++G  PE   +F               S L  MG     T  +    I
Sbjct: 156 KSFARENCKDIIAVGFKPENTFIF---------------SDLDYMGGGFYETVVRVSRQI 200

Query: 157 NDQSDDAALGAIK---LGLFSYPVLQAADILLYKSTH-------------VPVGDDQSQH 200
              +  A  G      +G F +  +Q A    + S++             +P   DQ  +
Sbjct: 201 TGSTAKAVFGFTDSDCIGKFHFASIQIASA--FPSSYPEVLGLPPKTPCLIPCAIDQDPY 258

Query: 201 LELTRQLSNTFNKFYK-----TKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIY 255
             + R +++   KF K     +K+FP             +L     KMS SD    + I+
Sbjct: 259 FRVCRDVADKL-KFTKPSLLHSKFFP-------------ALQGSTTKMSASD--DTTAIF 302

Query: 256 ITDEPEIIAKKIKR 269
           +TD P+ I KKI +
Sbjct: 303 MTDTPKQIQKKINK 316

>CAGL0H09372g complement(918777..919955) highly similar to sp|P36421
           Saccharomyces cerevisiae YGR185c TYS1, hypothetical
           start
          Length = 392

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 128/332 (38%), Gaps = 77/332 (23%)

Query: 47  PTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYR------ 100
           PTG+ H G ++   +    +      G  +    ADLHA         E  NYR      
Sbjct: 41  PTGRPHCGYFVAMTK----LAHFLKAGVEVTVLLADLHAFLDNMKAPLEVVNYRTKYYEY 96

Query: 101 -IEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQ 159
            ++AI   +++ I+  K +V    ++     L   L  L++M S N     ++ +++  Q
Sbjct: 97  TVKAILKSINVPIEKLKFVVGSSYQLGGDYTLD--LFKLSNMVSQNDAK--RAGADVVKQ 152

Query: 160 SDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKY 219
             +  L  +      YP++QA D                Q L++  Q    F    + K 
Sbjct: 153 VANPLLSGL-----IYPLMQALD---------------EQFLDVDVQ----FGGVDQRKI 188

Query: 220 FPMPTTILA--PTKKILSLLNP-------EKKMSKSDTNQNSVIYITDEPEIIAKKIKRA 270
           F +    L     KK   L+NP         KMS SD N  S I + +EP+ + KKI  A
Sbjct: 189 FVLAEENLPRIGYKKRAHLMNPMVPGLTQGGKMSASDPN--SKIDLLEEPKKVGKKINSA 246

Query: 271 VTDSISD----------SFYFDPVK--RPGIS------NLINTLSG-VQRVSIEDVEKDI 311
              S  D           +  +P++  + G        N      G V   S +D++   
Sbjct: 247 YC-SPGDIENNGLLSFVEYVIEPIQELKKGTGKFEFFINRPEKFGGPVTYTSFKDLQ--- 302

Query: 312 AHIKDHK----DFKQHVTDVLVEELAPSREQF 339
              K+ +    D K  VTD + E LAP RE+F
Sbjct: 303 TAFKEQQLMPVDLKIGVTDAINELLAPIREEF 334

>Scas_659.23
          Length = 396

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 93/231 (40%), Gaps = 28/231 (12%)

Query: 47  PTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYRIE---- 102
           PTGK H G ++   +    + D    G  +    ADLHA         E   YR +    
Sbjct: 44  PTGKPHCGYFVPMTK----LADFLKAGCEVTVLLADLHAFLDNMKAPLEVVQYRAKYYEL 99

Query: 103 AIASIL-SIGIDPEKAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKSNINDQSD 161
            I +IL SI +  EK      S     ++    +  +A++ S N     ++ +++  Q  
Sbjct: 100 TIKAILRSINVPIEKLKFVTGSSYQLTSDYTLDIFRMANIVSQNEAK--RAGADVVKQVA 157

Query: 162 DAALGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTKYFP 221
           +  L  +      YP++QA D           G DQ +   L  +  N  +  YK +   
Sbjct: 158 NPLLSGL-----IYPLMQALDEHFLDCDAQFGGVDQRKIFVLAEE--NLQSLGYKKR--- 207

Query: 222 MPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVT 272
               ++ P   ++  L    KMS SD N  S I + +EP+I+ KKI  A  
Sbjct: 208 --AHLMNP---MVPGLGQGGKMSASDPN--SKIDLLEEPKIVKKKINSAFC 251

>YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tRNA
           synthetase, cytoplasmic, charges its cognate tRNAs with
           tyrosine during protein synthesis [1185 bp, 394 aa]
          Length = 394

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 96/243 (39%), Gaps = 52/243 (21%)

Query: 47  PTGKFHLGNYLGAVRVWKDITDLKDDGTTLLFGTADLHAITVPKPNAKEFRNYR------ 100
           PTG+ H G ++   +    + D    G  +    ADLHA         E  NYR      
Sbjct: 48  PTGRPHCGYFVPMTK----LADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNYRAKYYEL 103

Query: 101 -IEAIASILSIGIDPEKAIVFHQSRVS-QHTELHWLLSSLASMGSLNRMTQWKSKSNIND 158
            I+AI   +++ I+  K +V    +++  +T   + LS++ S     R     + +++  
Sbjct: 104 TIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKR-----AGADVVK 158

Query: 159 QSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQSQHLELTRQLSNTFNKFYKTK 218
           Q  +  L  +      YP++QA D                Q L++  Q    F    + K
Sbjct: 159 QVANPLLSGL-----IYPLMQALD---------------EQFLDVDCQ----FGGVDQRK 194

Query: 219 YFPMPTTILAPT--KKILSLLNP-------EKKMSKSDTNQNSVIYITDEPEIIAKKIKR 269
            F +    L     KK   L+NP         KMS SD N  S I + +EP+ + KKI  
Sbjct: 195 IFVLAEENLPSLGYKKRAHLMNPMVPGLAQGGKMSASDPN--SKIDLLEEPKQVKKKINS 252

Query: 270 AVT 272
           A  
Sbjct: 253 AFC 255

>YCR042C (TAF2) [575] chr3 complement(201169..205392) Component of
           TAF(II) complex (TBP-associated protein complex),
           required for activated transcription by RNA polymerase
           II [4224 bp, 1407 aa]
          Length = 1407

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 34  DLPKNATIFSLIQPTGKFHLGNYLGAVRVW 63
           DL K   IF +I P    H+G  +GA   W
Sbjct: 361 DLTKKKCIFQIINPVAPHHIGWAIGAFNSW 390

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 39/209 (18%), Positives = 84/209 (40%), Gaps = 30/209 (14%)

Query: 133 WLLSSLASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFS-------YPVLQAADILL 185
           W++      GS   + ++  +  + ++     +  + +GL         +  +++A+ILL
Sbjct: 92  WIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHSQRKIHRDIKSANILL 151

Query: 186 YKSTHVPVGD-DQSQHLELTRQLSNTFNKFYKTKYFPMPTTI---------------LAP 229
             + HV +GD   S  + +TR+     + F  T ++  P  I               L  
Sbjct: 152 TDNGHVKLGDFGVSGQMMVTRKR----DTFVGTPFWMAPEVIDRNKQGYNEMADIWSLGI 207

Query: 230 TKKILSLLNPEKKMSKSDTNQNSVIYITDEPEIIAKKIKRAVTDSISDSFYFDPVKRPGI 289
           T  ++ LL     + K D  +  +     +P  + K+      D ++     DP +RP  
Sbjct: 208 T--VIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTA 265

Query: 290 SNLINTLSGVQRVSIEDVEKDIAHIKDHK 318
           + L+     V+RV + ++   +  +K +K
Sbjct: 266 AELLKH-RFVKRVRLYNLRDQVDLVKRNK 293

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 102 EAIASILSIGIDPE---KAIVFHQSRVSQHTELHWLLSSLASMGSLNRMTQWKSKS 154
           EA+ S+ ++G+D +   KA++     V+   E  W+ S +   G L    +WK +S
Sbjct: 636 EALNSMTAMGLDSKLCRKALILKNGDVNASVE--WVFSHMDDDGELPEAEEWKDQS 689

>Kwal_55.20214
          Length = 1275

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 10/70 (14%)

Query: 141 MGSLNRMTQWKSKSNINDQSDDAALGAIK-------LGLFSYPVL---QAADILLYKSTH 190
           + +LN    W + +N N+  D   L            G+FS  V     AA  L+ K+T 
Sbjct: 129 ISTLNNTKSWSANTNGNESLDSGHLDTKNESVTKDSSGIFSSLVSAAHSAASHLMPKTTE 188

Query: 191 VPVGDDQSQH 200
            P+ DD SQH
Sbjct: 189 KPLTDDVSQH 198

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,357,495
Number of extensions: 551820
Number of successful extensions: 2016
Number of sequences better than 10.0: 46
Number of HSP's gapped: 2040
Number of HSP's successfully gapped: 46
Length of query: 372
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 269
Effective length of database: 13,030,455
Effective search space: 3505192395
Effective search space used: 3505192395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)