Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E21901g35735217070.0
Kwal_55.215613493047931e-104
YOR037W (CYC2)3663167841e-102
ACR090C3663117302e-94
CAGL0I00990g3433215674e-70
Scas_699.413183015299e-65
KLLA0D04488g2962491063e-05
Kwal_47.18159287220957e-04
CAGL0E06424g298245930.001
Kwal_23.5471312245910.002
Sklu_2260.2350114910.002
YML087C312115890.004
KLLA0F27621g281117890.004
Scas_704.43316117890.004
ADL087W287117860.008
YIL043C (CBR1)322114840.017
CAGL0L00847g285114760.15
AFR439C310113740.26
CAGL0B02519g312113710.64
Scas_678.6299242710.66
Kwal_33.1426030886710.67
Sklu_2348.260070710.71
CAGL0G08624g58376710.81
Sklu_2184.231087671.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21901g
         (352 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...   662   0.0  
Kwal_55.21561                                                         310   e-104
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...   306   e-102
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...   285   2e-94
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...   223   4e-70
Scas_699.41                                                           208   9e-65
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    45   3e-05
Kwal_47.18159                                                          41   7e-04
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...    40   0.001
Kwal_23.5471                                                           40   0.002
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                            40   0.002
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...    39   0.004
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...    39   0.004
Scas_704.43                                                            39   0.004
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...    38   0.008
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...    37   0.017
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...    34   0.15 
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    33   0.26 
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...    32   0.64 
Scas_678.6                                                             32   0.66 
Kwal_33.14260                                                          32   0.67 
Sklu_2348.2 YIL121W, Contig c2348 2640-4442 reverse complement         32   0.71 
CAGL0G08624g complement(811931..813682) similar to sp|P40474 Sac...    32   0.81 
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement         30   1.9  

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/352 (92%), Positives = 324/352 (92%)

Query: 1   MKLLLGSIKRLSSSSKTTLPQPSAXXXXXXXXXXXXXXXXXAIGALSWNYYKESLYQREL 60
           MKLLLGSIKRLSSSSKTTLPQPSA                 AIGALSWNYYKESLYQREL
Sbjct: 1   MKLLLGSIKRLSSSSKTTLPQPSAGKSSSLLKTVLLLSGSVAIGALSWNYYKESLYQREL 60

Query: 61  SRDYFXXXXXXXXXXXDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVRSY 120
           SRDYF           DQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVRSY
Sbjct: 61  SRDYFSKYKISKKYSIDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVRSY 120

Query: 121 TPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEY 180
           TPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEY
Sbjct: 121 TPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEY 180

Query: 181 EFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTESPFRGKI 240
           EFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTESPFRGKI
Sbjct: 181 EFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTESPFRGKI 240

Query: 241 GAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGIPSPYPYGGN 300
           GAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGIPSPYPYGGN
Sbjct: 241 GAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGIPSPYPYGGN 300

Query: 301 EPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGWDNSN 352
           EPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGWDNSN
Sbjct: 301 EPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGWDNSN 352

>Kwal_55.21561
          Length = 349

 Score =  310 bits (793), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 205/304 (67%), Gaps = 3/304 (0%)

Query: 50  YYKESLYQRELSRDYFXXXXXXXXXXXDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEV 109
           YYK+     ELS++YF           D +H+++ELTP++ Q  N+W  M S KLWSV+V
Sbjct: 43  YYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQV 102

Query: 110 KQPEIMVVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGH 169
           KQPEIMVVR+YTPLPL    +G  +VL D +N  G L+FY+K+Y+ GEVARW++ LP GH
Sbjct: 103 KQPEIMVVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGH 162

Query: 170 VLELRGPFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
           +LELRGP+++YEFP   +    DRSFLWG +    D    QPFDI  FT GTGI P++Q+
Sbjct: 163 ILELRGPYIDYEFPSMDNGEKLDRSFLWGAKPS-SDKLMIQPFDISAFTAGTGIAPIMQL 221

Query: 230 TLTESPFRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNR-ISIPLQSDPAM 288
            LTE PFRG+I  +HSC+  +ELGPL  IL  L++N+R+EL+  ES++   I   S+  +
Sbjct: 222 LLTEFPFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEVL 281

Query: 289 EGIPSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGW 348
             I SP  Y    PFT  +  ++PVLSL+CGP  +I+T+SGPKYD  QGPI+G+L  +GW
Sbjct: 282 NLIDSPSQY-LKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGW 340

Query: 349 DNSN 352
            N N
Sbjct: 341 SNQN 344

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score =  306 bits (784), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 148/316 (46%), Positives = 210/316 (66%), Gaps = 9/316 (2%)

Query: 46  LSWNYYKESLYQRELSRDYFXXXXXXXXXXXDQDHYLIELTPLKAQKVNLWKEMNSSKLW 105
           L++ Y  E   + ELS  YF           D  H+L+E+TPL  QKVN+W  M +  LW
Sbjct: 46  LTYRYTSERENKHELSPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLW 105

Query: 106 SVEVKQPEIMVVRSYTPLPLTIE-ENGAVEVLRDEENASGALTFYIKQYKQGEVARWINH 164
           SVE+KQPE+MVVR+YTPLPL     +  +E+L+D +NA G L+FYIK+Y+ GEVARW++H
Sbjct: 106 SVEIKQPEVMVVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHH 165

Query: 165 LPLGHVLELRGPFVEYEFPDTADEITRDRSFLW-------GNEDCVKDNYKYQPFDILFF 217
           LP GH++E+RGPF++YEFP   +E+ R R  L+       GN       + YQP+DI+ F
Sbjct: 166 LPKGHIIEIRGPFIDYEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMF 225

Query: 218 TGGTGIVPLLQMTLTESPFRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNR 277
           T GTGIV  LQ+ LTESPFRG I  +H+ K++ +LGPL  IL +LQ ++R++L   E++R
Sbjct: 226 TAGTGIVTALQLLLTESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDR 285

Query: 278 ISIPLQSDPAMEGIPSPYPYGGNEPFTSLDSK-VRPVLSLVCGPGGFISTVSGPKYDLVQ 336
            +         + I  PYPY G  PF+++++K + PVL+LVCGP  +IS++SG KYDL Q
Sbjct: 286 QTKQDVLKSIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQ 345

Query: 337 GPIKGILAARGWDNSN 352
           GP+ G+L+  GW++ N
Sbjct: 346 GPVGGLLSKEGWNSDN 361

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score =  285 bits (730), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 143/311 (45%), Positives = 194/311 (62%), Gaps = 4/311 (1%)

Query: 44  GALSWNYYKESLYQRELSRDYFXXXXXXXXXXXDQDHYLIELTPLKAQKVNLWKEMNSSK 103
           G  +  Y++ + Y  ELS++YF           D DHYL+ELTPLK Q+ N+W    +  
Sbjct: 53  GCAAAEYHRRN-YHAELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARN 111

Query: 104 LWSVEVKQPEIMVVRSYTPLPLTIEENG-AVEVLRDEENASGALTFYIKQYKQGEVARWI 162
           LW+VE+KQPEIMVVR YTPLPL  +E+G  +  LRD +N  G L  YIK+Y  GEVARW+
Sbjct: 112 LWAVEIKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWL 171

Query: 163 NHLPLGHVLELRGPFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTG 222
             LP GH++E+RGP+ E+EFP+   +  RDR F      CV    +  PFDI  F  GTG
Sbjct: 172 RKLPKGHIVEVRGPYPEFEFPELDADTKRDREFSGRGRACVAAAARAGPFDIALFAAGTG 231

Query: 223 IVPLLQMTLTESPFRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNR-ISIP 281
           IV  LQ+  TE PF+GKI  ++SCKS  +LGPL  +L +   +DR++LH  ES +  S+ 
Sbjct: 232 IVTALQLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLR 291

Query: 282 LQSDPAMEGIPSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKG 341
           L      + +  P+P+  N PF     K  PVLSLVCGP  +I+ ++GP++ L QGP+ G
Sbjct: 292 LGLSKISDLVSGPFPFSENAPFEQ-RPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTG 350

Query: 342 ILAARGWDNSN 352
           +L  +GWDNSN
Sbjct: 351 LLGTKGWDNSN 361

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score =  223 bits (567), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 182/321 (56%), Gaps = 30/321 (9%)

Query: 42  AIGALSWNY-------YKESLYQ-RELSRDYFXXXXXXXXXXXDQDHYLIELTPLKAQKV 93
           A   ++W Y       Y E+  + +ELS + F           D  HYLIELTPLK Q V
Sbjct: 38  ASAFVTWTYKDLIKQKYVETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNV 97

Query: 94  NLWKEMNSSKLWSVEVKQPEIMVVRSYTPLPLTIEENGAVEVLR-DEENASGALTFYIKQ 152
           NLWKE+  + LWS+EVKQPEIMVVR+YTPLPL ++ NG +  L  ++   S  L FYIK 
Sbjct: 98  NLWKELERNILWSIEVKQPEIMVVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKS 157

Query: 153 YKQGEVARWINHLPLGHVLELRGPFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPF 212
           Y  GEVARWI  LP+G  LELRGPF++Y+F +   +  RD      N   + +  K Q  
Sbjct: 158 YNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRD-----ANGSTLIN--KTQLS 210

Query: 213 DILFFTGGTGIVPLLQMTLTE-SPFRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELH 271
           ++ FF GGTGIV  LQ  L     F   +  +HSCKS+ ELG L  ++  L   ++I  H
Sbjct: 211 NVPFFAGGTGIVTALQPILNPYGQFNYNMTLFHSCKSIQELGCLYHLVNGLAQQNKITYH 270

Query: 272 THESNRISIPLQSDPAMEGIPSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPK 331
             E+++    +      + IP P          +LD+      S+VCGP G+I+TV+G K
Sbjct: 271 LFETSKGDNIIDFK---QLIPGPNTSNAG----NLDT------SIVCGPEGYITTVAGAK 317

Query: 332 YDLVQGPIKGILAARGWDNSN 352
           YD  QGPI+G+L  +GWDNSN
Sbjct: 318 YDTSQGPIEGLLGEKGWDNSN 338

>Scas_699.41
          Length = 318

 Score =  208 bits (529), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 166/301 (55%), Gaps = 38/301 (12%)

Query: 59  ELSRDYFXXXXXXXXXXXDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVR 118
           ELS  +F           D  HYL+ELTP   QK N+W+++  + +WSVE+KQPEIMVVR
Sbjct: 44  ELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVR 103

Query: 119 SYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFV 178
           +YTP+PL+  ++    +   ++N +G L FY+KQY  GEVARW++ LP+   +E+RGPF+
Sbjct: 104 NYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFI 163

Query: 179 EYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTESP--- 235
           +Y+F +T                   DN K   FD+  FT G G+V   Q+ L+ S    
Sbjct: 164 DYKFQET-------------------DNTK---FDVSMFTAGAGVVTAFQLLLSPSSKND 201

Query: 236 FRGKIGAYHSCKSLTELGPLNSILTKLQ-DNDRIELHTHESNR---ISIPLQSDPAMEGI 291
           FRG +  +HSC SL ELGPL  I+  LQ DN  I++   ES +   I   L+S   +   
Sbjct: 202 FRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQ 261

Query: 292 PSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGWDNS 351
             P   G         S +R  L+LVCGP GFI TV+G   DL QGP+ GIL   GW   
Sbjct: 262 FKPSQLG--------RSNLRQ-LALVCGPEGFIDTVAGASVDLEQGPVGGILKQNGWPRE 312

Query: 352 N 352
           N
Sbjct: 313 N 313

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 96/249 (38%), Gaps = 66/249 (26%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           V+R YTP    + +NG            G +   +K Y+ G+    +  L     +  +G
Sbjct: 98  VIRPYTP----VSDNGT----------KGKMELVVKHYENGKFTSHLFGLKENDTVSFKG 143

Query: 176 PFVEYEF-PDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMT--LT 232
           P  ++E+ P++ D IT                             GTGI PL Q+   + 
Sbjct: 144 PITKWEWKPNSYDSIT-------------------------LLGAGTGINPLYQLVHHIA 178

Query: 233 ESPFRG-KIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGI 291
           E+P    KI  Y+  K+     P + +L    DN    L     +++ I    D A EG 
Sbjct: 179 ENPEDNTKIHLYYGNKT-----PEDILLKSELDN----LQKKYPDQVKITYFVDKA-EG- 227

Query: 292 PSPYPYGGNEPFTSLD--SKVRPVLS-----LVCGPGGFISTVSGPKYD-LVQGPIKGIL 343
                + G   F + D  S   P  S      VCGP  F+   SGPK     QG + GIL
Sbjct: 228 ----NFEGETGFITKDYLSHQAPKPSEKNQVFVCGPPPFMKAYSGPKVSPQDQGELTGIL 283

Query: 344 AARGWDNSN 352
           A  G+  SN
Sbjct: 284 AELGYSKSN 292

>Kwal_47.18159
          Length = 287

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 86/220 (39%), Gaps = 57/220 (25%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           ++RSYTP  L  +  G  E+L             IK Y+QG V++ I  L +G  +++RG
Sbjct: 92  IMRSYTPTSLDSDSVGFFELL-------------IKSYEQGNVSKMIGELQIGDKIKVRG 138

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQP---FDILFFTGGTGIVPLLQM--T 230
           P                           K  Y Y P    +I    GGTGI P+ Q+  +
Sbjct: 139 P---------------------------KGFYTYTPNMNSEIGMIAGGTGIAPMYQIIKS 171

Query: 231 LTESPF-RGKIGAYHSCKSLTELGPLNSILTKLQDN-DRIELHTHESNRISIPLQSDPAM 288
           +   P  R K+   +  ++  ++     I   ++ N D+ ++H          L   PA 
Sbjct: 172 IHSDPKDRTKVSIIYGSQTEDDILLKKEIDAIVESNPDQFKVHY---------LLDKPAR 222

Query: 289 EGIPSPYPYGGNEPFTS-LDSKVRPVLSLVCGPGGFISTV 327
           +       Y   E     L +    V  LVCGP G +S++
Sbjct: 223 DTWTGGVGYVTAEVMKEHLPAAGDGVQLLVCGPPGMVSSI 262

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 99/245 (40%), Gaps = 65/245 (26%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           V+R YTP+   + E G +E             F IK Y+ G++   +  L     L  +G
Sbjct: 99  VIRPYTPVS-DLSEKGYIE-------------FVIKHYEGGKMTDHLFQLKPKDTLAFQG 144

Query: 176 PFVEYEF-PDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMT--LT 232
           P  ++++ P++ D IT                            GGTGI PL Q+   +T
Sbjct: 145 PIPKWQWKPNSFDTIT-------------------------LLGGGTGITPLYQLVHHIT 179

Query: 233 ESP-FRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGI 291
           ++   + KI  ++  K+     P + +L K  D    +L      +++I    D    G 
Sbjct: 180 QNKEDKTKINLFYGSKT-----PSDILLKKELD----DLQKKYPEQLNIQYFVDKDDTG- 229

Query: 292 PSPYPYGGNEPFTSLD--SKVRP-----VLSLVCGPGGFISTVSGPKYD-LVQGPIKGIL 343
                + GN+ F + D  +K  P         VCGP  F+ ++SG K   + QG + G L
Sbjct: 230 ----KFDGNKGFITKDFLAKNAPGPKEKTQVFVCGPPPFMDSLSGQKKSPMEQGDLTGAL 285

Query: 344 AARGW 348
              G+
Sbjct: 286 KDLGY 290

>Kwal_23.5471
          Length = 312

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 97/245 (39%), Gaps = 66/245 (26%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           V+R YTP+               + +  G + F IK YK G++   +        +  +G
Sbjct: 114 VIRPYTPV--------------SDVSTKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKG 159

Query: 176 PFVEYEF-PDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMT--LT 232
           P +++E+ P++ D IT                             G+GI PL Q+   ++
Sbjct: 160 PIIKWEWKPNSFDSIT-------------------------LIGAGSGITPLYQLLHHIS 194

Query: 233 ESPF-RGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAMEGI 291
           ++P  + KI   +  K+       N IL K    +  E+    ++++ I    D A EG 
Sbjct: 195 QNPEDKTKIHLLYGNKT------PNDILLK---KELEEVQAKYADQVKIHFFVDKA-EG- 243

Query: 292 PSPYPYGGNEPFTSLD--SKVRPVLS-----LVCGPGGFISTVSGPKYD-LVQGPIKGIL 343
               P+ G   F + +   K  P  S      VCGP  F+   SGPK     QG + GIL
Sbjct: 244 ----PFDGEIGFITKEFLEKNVPKASEKNQVFVCGPPPFMQAYSGPKVSPKDQGELTGIL 299

Query: 344 AARGW 348
              G+
Sbjct: 300 KDLGF 304

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 45/114 (39%), Gaps = 37/114 (32%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           +VRSYTP  L             + +A+G     IK Y++G +++ I  L +G  +++RG
Sbjct: 91  IVRSYTPTSL-------------DSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRG 137

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
           P   Y +    +                          +    GGTGI P+ Q+
Sbjct: 138 PKGFYTYTANMNS------------------------SLAMVAGGTGIAPMYQI 167

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 46/115 (40%), Gaps = 40/115 (34%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           +VR YTP+              +  N  G L   +K YK G V+++ + L +   +E +G
Sbjct: 120 LVRYYTPV--------------NVPNTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKG 165

Query: 176 PFVEYEF-PDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
           P  E E+  DTA E+                             GG+GI P+LQ+
Sbjct: 166 PLGELEYDQDTATELG-------------------------IIAGGSGITPVLQV 195

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 46/117 (39%), Gaps = 43/117 (36%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           ++RSYTP  L             + +A G     IK Y++G +++    L +G  +++RG
Sbjct: 87  ILRSYTPTSL-------------DSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRG 133

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPF---DILFFTGGTGIVPLLQM 229
           P                           K  Y YQP    +I    GGTGI P+ Q+
Sbjct: 134 P---------------------------KGFYHYQPNMNEEIGMIAGGTGIAPMYQI 163

>Scas_704.43
          Length = 316

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 43/117 (36%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           ++RSYTP  L  E  G+ E+L             +K Y  G ++++I +L +G  + + G
Sbjct: 120 IMRSYTPTSLDSETKGSFELL-------------VKSYPNGNISKFIGNLNIGDEINVCG 166

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQP---FDILFFTGGTGIVPLLQM 229
           P                             NY Y+P     +    GGTGI P+ Q+
Sbjct: 167 P---------------------------AGNYHYEPNCRNKLGMIAGGTGIAPMFQI 196

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 43/117 (36%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           ++RSYTP  L             + +A+G     +K Y++G +++ +  L +G  +++RG
Sbjct: 91  MLRSYTPTSL-------------DSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRG 137

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQP---FDILFFTGGTGIVPLLQM 229
           P                           K  Y Y+P    +I    GGTGI P+ Q+
Sbjct: 138 P---------------------------KGFYHYEPNMYKEIGMIAGGTGISPMYQI 167

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 43/114 (37%), Gaps = 37/114 (32%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           + RSYTP  L  +  G  E+L             +K Y  G V++ I  L +G  ++++G
Sbjct: 126 ITRSYTPTSLDGDTKGNFELL-------------VKSYPTGNVSKMIGELKIGDSIQIKG 172

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
           P   Y +          RS L                      GGTGI P+ Q+
Sbjct: 173 PRGNYHYERNC------RSHLG------------------MIAGGTGIAPMYQI 202

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 44/114 (38%), Gaps = 37/114 (32%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           V RSYTP  L             +E   G     +K Y +G +++ I  + +G  + + G
Sbjct: 90  VSRSYTPTSL-------------DEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISG 136

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
           P   YE+                    V + +K+    +    GGTGI P+ Q+
Sbjct: 137 PRGFYEY--------------------VPNVHKH----LAMVAGGTGITPMFQI 166

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 41/113 (36%), Gaps = 38/113 (33%)

Query: 117 VRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGP 176
           VR YTP+                + A G     +K Y  G+V++W   L  G  +E +GP
Sbjct: 119 VRYYTPI--------------SNKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKGP 164

Query: 177 FVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
              + +                    V + YK     I   TGG+ I P+L +
Sbjct: 165 VGRFSY--------------------VTNAYK----KIGMVTGGSAITPMLSV 193

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 43/113 (38%), Gaps = 38/113 (33%)

Query: 117 VRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGP 176
           VR+Y P+    E+              G +   +K YK G+V+++   +  G  ++ RGP
Sbjct: 121 VRNYNPISTRFEK--------------GHIDLLVKSYKDGKVSKYFASMKPGETVDFRGP 166

Query: 177 FVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229
                                G+     + YK    +I    GG+GI P LQM
Sbjct: 167 V--------------------GSLVYKPNTYK----NIGMVCGGSGITPALQM 195

>Scas_678.6
          Length = 299

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 93/242 (38%), Gaps = 58/242 (23%)

Query: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175
           VVR YTP+   +++ G  E++             IK Y  G+++  +  L    V+  +G
Sbjct: 99  VVRPYTPVS-PLDQQGTFELV-------------IKHYNDGKMSSHLFSLKPNDVVSFKG 144

Query: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQMT--LTE 233
           P  ++++                    V +++K     I     GTG  PL Q+   +  
Sbjct: 145 PIKKWQW--------------------VPNSFK----SITLLGAGTGTTPLYQLASHIAR 180

Query: 234 SPF-RGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNRISIPLQSDPAME--- 289
           +P  + KI  ++  K+ ++      IL K + N+  E +  +        + D   E   
Sbjct: 181 NPEDKTKINVFYGNKTSSD------ILLKKEWNELQEKYPDQVKVTYFVDKLDDGKENGV 234

Query: 290 --GIPSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLV-QGPIKGILAAR 346
             G  S      N P    D+ +      +CGP  F+   SG K     QG + G+L   
Sbjct: 235 ELGFISKEFIAKNAPGPKEDTHL-----FICGPPPFMKAYSGEKAKPTDQGELTGLLQEL 289

Query: 347 GW 348
           G+
Sbjct: 290 GY 291

>Kwal_33.14260
          Length = 308

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 35/86 (40%), Gaps = 24/86 (27%)

Query: 144 GALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEYEFPDTADEITRDRSFLWGNEDCV 203
           G     +K Y  G+V+++   L  G  ++ +GP                     G  + V
Sbjct: 130 GYFDIIVKSYADGQVSKYFAGLKAGSAVDFKGPV--------------------GRFNYV 169

Query: 204 KDNYKYQPFDILFFTGGTGIVPLLQM 229
            ++YK     I    GG+GI P+LQ+
Sbjct: 170 VNSYK----QIGMIAGGSGITPMLQI 191

>Sklu_2348.2 YIL121W, Contig c2348 2640-4442 reverse complement
          Length = 600

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 28/70 (40%), Gaps = 7/70 (10%)

Query: 270 LHTHESNRISIPLQSDPAMEGIPSPYPYGGNE-------PFTSLDSKVRPVLSLVCGPGG 322
           L  H SN I     +   +E I  P     N        P++      + +L+++C   G
Sbjct: 30  LEQHASNEIQCTDDNQKVIEQISKPSSANPNNEKTCQEPPYSRFGKSEKSILAVLCASAG 89

Query: 323 FISTVSGPKY 332
             ST+S P Y
Sbjct: 90  LFSTISAPIY 99

>CAGL0G08624g complement(811931..813682) similar to sp|P40474
           Saccharomyces cerevisiae YIL121w, hypothetical start
          Length = 583

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 16/76 (21%)

Query: 263 QDNDRIELHTHESNRISIPL------QSDPAMEGIPSPYPYGGNEPFTSLDSKVRPVLSL 316
           +DND++ + T+E   +  P+      Q++P +   P         P++  D+K +  L L
Sbjct: 36  EDNDKM-IKTNEDEAVKEPIYRTRSNQTEPDIANAP---------PYSRFDAKYKMALVL 85

Query: 317 VCGPGGFISTVSGPKY 332
            C   G  ST++G  Y
Sbjct: 86  QCAYTGLFSTMAGAIY 101

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 34/87 (39%), Gaps = 24/87 (27%)

Query: 143 SGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEYEFPDTADEITRDRSFLWGNEDC 202
           +G     +K Y  G+V+++   L  G ++E +GP   + +   + +              
Sbjct: 131 TGHFDIIVKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSSKA------------- 177

Query: 203 VKDNYKYQPFDILFFTGGTGIVPLLQM 229
                      I    GG+GI P+LQ+
Sbjct: 178 -----------IGMIAGGSGITPMLQV 193

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,356,164
Number of extensions: 482270
Number of successful extensions: 1066
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1045
Number of HSP's successfully gapped: 27
Length of query: 352
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 249
Effective length of database: 13,030,455
Effective search space: 3244583295
Effective search space used: 3244583295
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)