Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E21879g33332817090.0
ACR091W32833011471e-158
YDR267C33033010551e-144
Scas_615.1134934710461e-143
Kwal_55.2155935131910381e-141
CAGL0M08646g33733310271e-140
Sklu_1710.12402358231e-110
Kwal_23.53514742731952e-16
Scas_679.288151941929e-16
Scas_631.174742381855e-15
AGR180W8061911803e-14
CAGL0J03476g5171881784e-14
YCR072C5151831775e-14
Scas_720.955153161741e-13
AER263C5131821741e-13
CAGL0I03454g3033041702e-13
YFL009W (CDC4)7792711742e-13
Scas_630.66212551723e-13
YGL137W (SEC27)8892041714e-13
Kwal_23.63245141831704e-13
KLLA0E23529g8262741714e-13
Sklu_2173.25151831695e-13
CAGL0H08932g9022071705e-13
Kwal_47.174658001351697e-13
AGR168W8251881681e-12
YLR222C (UTP13)8171851661e-12
KLLA0C08547g5151821642e-12
AEL246C8152701633e-12
CAGL0M04081g4552611624e-12
AFR199C3342331604e-12
CAGL0G09845g5002201606e-12
CAGL0C03608g6432451607e-12
AEL269C4551761599e-12
KLLA0F06754g3442521571e-11
Scas_707.227302671591e-11
Kwal_23.50357442041591e-11
CAGL0J10340g3382401561e-11
AFL118W8322071563e-11
ADR077C12042941563e-11
CAGL0E02805g8401921563e-11
CAGL0I03718g12012941563e-11
ACR199C2952461515e-11
YNL317W (PFS2)4652611535e-11
KLLA0F04884g12122941537e-11
KLLA0C16643g3022661507e-11
CAGL0L02629g7953391528e-11
CAGL0J08778g2981641499e-11
KLLA0F13244g8141861529e-11
Scas_674.202971641499e-11
YLR208W (SEC13)2971641491e-10
YGL100W (SEH1)3492381501e-10
YDL145C (COP1)12012941521e-10
Scas_624.1112053021511e-10
Kwal_56.2452612102941511e-10
CAGL0C00737g8161501492e-10
Kwal_27.120537552171483e-10
Kwal_56.245962941631444e-10
KLLA0B01958g8902071465e-10
YBL008W (HIR1)8401911466e-10
YCR084C (TUP1)7132761456e-10
Kwal_56.239209372541457e-10
KLLA0D16390g9362521457e-10
Scas_585.84602971447e-10
KLLA0F10263g6822511457e-10
Scas_652.163452011429e-10
Sklu_2160.37601301431e-09
AFL038C3302531411e-09
CAGL0M04279g9403061431e-09
Kwal_23.64297501851422e-09
CAGL0L03201g5792461412e-09
Kwal_23.57696271601412e-09
KLLA0D04840g3032061383e-09
KLLA0E12287g3262221383e-09
Kwal_27.115858231841403e-09
AGL234W6292781393e-09
Sklu_2431.127492731393e-09
Kwal_55.220674512651384e-09
CAGL0E00561g8361871385e-09
ADL082C5691611385e-09
YPR178W (PRP4)4652761376e-09
Scas_704.406081591377e-09
CAGL0G04345g7112541351e-08
Sklu_2114.211402341351e-08
CAGL0L00781g6731591342e-08
YBR198C (TAF5)7982241332e-08
KLLA0E24508g3272401312e-08
YIL046W (MET30)6401601323e-08
Scas_702.168162371323e-08
Scas_713.509831921314e-08
CAGL0M05335g8061741314e-08
ADL184W4492471304e-08
Kwal_14.16113342471286e-08
Scas_629.126711801296e-08
KLLA0D07546g6473011287e-08
YNL006W (LST8)3032571269e-08
KLLA0E07073g4522991271e-07
KLLA0A08822g5822331271e-07
Scas_603.55892281271e-07
KLLA0E04741g4592951261e-07
AGL024W7562681261e-07
YLR129W (DIP2)9432791261e-07
Sklu_2416.54593181242e-07
Kwal_27.122393161861223e-07
Kwal_26.87764332771233e-07
YCR057C (PWP2)9232471243e-07
KLLA0A04928g8612281243e-07
Scas_721.328222181234e-07
Scas_721.73252171206e-07
Scas_465.410022801217e-07
KLLA0F27511g6231581191e-06
KLLA0E18986g9902321191e-06
ACL116W8042411191e-06
YBR175W (SWD3)3151581171e-06
Scas_673.114342521171e-06
YPL151C (PRP46)4511711171e-06
Kwal_56.241637291651182e-06
YGL003C (CDH1)5662371172e-06
Sklu_1963.23141921152e-06
Scas_558.37252471172e-06
KLLA0D02530g7072561172e-06
Kwal_23.62409132161172e-06
Scas_720.457551231163e-06
AGR207C3201871133e-06
CAGL0C01441g10052271154e-06
AFL056C9761241154e-06
YLR429W (CRN1)6512081144e-06
Scas_720.83d9152471144e-06
CAGL0K09284g9112381145e-06
CAGL0A00605g6402311135e-06
AER114W6331871136e-06
AAR057W9221451136e-06
CAGL0K00957g7932921136e-06
Kwal_47.175675902411126e-06
Scas_719.526282371119e-06
CAGL0D02090g2771351099e-06
KLLA0F11231g4341581119e-06
KLLA0C07425g4443021101e-05
Kwal_26.75702181471071e-05
CAGL0H03729g3032581091e-05
Scas_695.153272621091e-05
ACR137W4251751091e-05
Kwal_27.111269962451092e-05
Kwal_33.154757832921082e-05
AGL196C9351611082e-05
YMR116C (ASC1)3191331063e-05
AER448W7142831083e-05
YKR036C (CAF4)6593431083e-05
Scas_571.46012211073e-05
Kwal_14.17105742371073e-05
Sklu_2364.45552241073e-05
AFL014C5572111073e-05
KLLA0C08976g9113001073e-05
Kwal_56.2368511021261073e-05
YDR128W11481261074e-05
CAGL0L10890g4573071054e-05
ADL322C5013261064e-05
YGR200C (ELP2)788821065e-05
Scas_652.73801391045e-05
Sklu_2420.24412591045e-05
YOR272W (YTM1)4602891046e-05
AFL007C5512311046e-05
Scas_442.2*7952311047e-05
Kwal_27.103855361431039e-05
Kwal_56.230354241911039e-05
CAGL0J04818g6542331039e-05
ACR017W4231891021e-04
ABL044C5181511021e-04
KLLA0E11297g5122481021e-04
KLLA0F21406g7052651021e-04
Scas_721.115*3181331001e-04
Scas_693.2211451261022e-04
Kwal_0.212303228992e-04
Kwal_56.238953671291002e-04
AGL190W3701311002e-04
Sklu_2442.2303228992e-04
CAGL0M06193g316204992e-04
AFL022W371142992e-04
CAGL0L02761g419230992e-04
Sklu_2371.4478172992e-04
Sklu_2172.6263224982e-04
Scas_693.36375231992e-04
KLLA0E03982g37275993e-04
CAGL0K00275g715217993e-04
Kwal_33.15591714292993e-04
AER337W445305983e-04
Scas_658.1442178983e-04
KLLA0F19734g1133126993e-04
Scas_670.21595233984e-04
Scas_680.11347203974e-04
YPL183C1013234984e-04
AER255C467261974e-04
CAGL0K07095g371151974e-04
Kwal_56.22345396171965e-04
YMR146C (TIF34)347195966e-04
AAL009C303228956e-04
Scas_718.6*546123966e-04
KLLA0E21263g429270967e-04
CAGL0L06952g347196957e-04
Sklu_2167.5303150947e-04
YBR234C (ARC40)384139958e-04
CAGL0A02772g441281958e-04
AER280C510143950.001
CAGL0K12188g535276950.001
CAGL0L04950g80577940.001
ACR097W467236930.001
Scas_692.25488291930.001
KLLA0F22000g793125940.001
KLLA0F10791g545199930.001
CAGL0B03575g419223930.001
KLLA0B14410g706263940.001
Sklu_2318.1711270930.001
AAR102C591130930.001
KLLA0E23617g417171920.002
ADR176W461132920.002
CAGL0M02277g427159920.002
Sklu_2133.4373169920.002
YMR093W (UTP15)513211920.002
YOR212W (STE4)423238910.002
AEL314W715204920.002
Scas_592.4*318237900.002
YJL112W (MDV1)714244910.003
Sklu_1645.2587182910.003
Kwal_27.12586509176900.004
Kwal_26.8628422180890.004
YDR142C (PEX7)37578890.004
YGR223C44840890.004
YKL213C (DOA1)715259890.005
YDR364C (CDC40)455181890.005
YML102W (CAC2)46886890.005
KLLA0D06787g436142890.005
Sklu_675.130883880.005
Sklu_2317.3368129880.005
AAL119W53791890.005
Sklu_2435.13575152890.005
Kwal_55.21450503318880.005
Kwal_14.1675373139880.006
KLLA0B11077g567144880.006
ADR264C346115870.006
Kwal_34.15818349115870.006
CAGL0B01529g369134870.007
Scas_605.18424242870.007
CAGL0B00748g81289880.007
Scas_684.7511174880.007
CAGL0L09647g42980870.008
Scas_692.2945685870.008
Kwal_56.244781296232870.009
KLLA0F17237g523174870.009
CAGL0K03861g513174870.009
Kwal_47.17827523174860.009
CAGL0J03344g543197860.010
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21879g
         (328 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   662   0.0  
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   446   e-158
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   410   e-144
Scas_615.11                                                           407   e-143
Kwal_55.21559                                                         404   e-141
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   400   e-140
Sklu_1710.1 YDR267C, Contig c1710 17-739                              321   e-110
Kwal_23.5351                                                           80   2e-16
Scas_679.28                                                            79   9e-16
Scas_631.17                                                            76   5e-15
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    74   3e-14
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    73   4e-14
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    73   5e-14
Scas_720.95                                                            72   1e-13
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    72   1e-13
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    70   2e-13
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    72   2e-13
Scas_630.6                                                             71   3e-13
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    70   4e-13
Kwal_23.6324                                                           70   4e-13
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    70   4e-13
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            70   5e-13
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    70   5e-13
Kwal_47.17465                                                          70   7e-13
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    69   1e-12
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    69   1e-12
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    68   2e-12
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    67   3e-12
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    67   4e-12
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    66   4e-12
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    66   6e-12
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    66   7e-12
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    66   9e-12
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    65   1e-11
Scas_707.22                                                            66   1e-11
Kwal_23.5035                                                           66   1e-11
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    65   1e-11
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    65   3e-11
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    65   3e-11
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    65   3e-11
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    65   3e-11
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    63   5e-11
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    64   5e-11
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    64   7e-11
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    62   7e-11
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    63   8e-11
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    62   9e-11
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    63   9e-11
Scas_674.20                                                            62   9e-11
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    62   1e-10
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    62   1e-10
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    63   1e-10
Scas_624.11                                                            63   1e-10
Kwal_56.24526                                                          63   1e-10
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    62   2e-10
Kwal_27.12053                                                          62   3e-10
Kwal_56.24596                                                          60   4e-10
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    61   5e-10
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    61   6e-10
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    60   6e-10
Kwal_56.23920                                                          60   7e-10
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    60   7e-10
Scas_585.8                                                             60   7e-10
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    60   7e-10
Scas_652.16                                                            59   9e-10
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         60   1e-09
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    59   1e-09
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    60   1e-09
Kwal_23.6429                                                           59   2e-09
CAGL0L03201g complement(366795..368534) some similarities with s...    59   2e-09
Kwal_23.5769                                                           59   2e-09
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    58   3e-09
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    58   3e-09
Kwal_27.11585                                                          59   3e-09
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    58   3e-09
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      58   3e-09
Kwal_55.22067                                                          58   4e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    58   5e-09
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    58   5e-09
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    57   6e-09
Scas_704.40                                                            57   7e-09
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    57   1e-08
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          57   1e-08
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    56   2e-08
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    56   2e-08
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    55   2e-08
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    55   3e-08
Scas_702.16                                                            55   3e-08
Scas_713.50                                                            55   4e-08
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    55   4e-08
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    55   4e-08
Kwal_14.1611                                                           54   6e-08
Scas_629.12                                                            54   6e-08
KLLA0D07546g complement(647984..649927) some similarities with s...    54   7e-08
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    53   9e-08
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    54   1e-07
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    54   1e-07
Scas_603.5                                                             54   1e-07
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    53   1e-07
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    53   1e-07
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    53   1e-07
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           52   2e-07
Kwal_27.12239                                                          52   3e-07
Kwal_26.8776                                                           52   3e-07
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    52   3e-07
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    52   3e-07
Scas_721.32                                                            52   4e-07
Scas_721.7                                                             51   6e-07
Scas_465.4                                                             51   7e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    50   1e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    50   1e-06
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    50   1e-06
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    50   1e-06
Scas_673.11                                                            50   1e-06
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    50   1e-06
Kwal_56.24163                                                          50   2e-06
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    50   2e-06
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         49   2e-06
Scas_558.3                                                             50   2e-06
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    50   2e-06
Kwal_23.6240                                                           50   2e-06
Scas_720.45                                                            49   3e-06
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    48   3e-06
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    49   4e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    49   4e-06
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    49   4e-06
Scas_720.83d                                                           49   4e-06
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    49   5e-06
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    48   5e-06
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    48   6e-06
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    48   6e-06
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    48   6e-06
Kwal_47.17567                                                          48   6e-06
Scas_719.52                                                            47   9e-06
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    47   9e-06
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    47   9e-06
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    47   1e-05
Kwal_26.7570                                                           46   1e-05
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    47   1e-05
Scas_695.15                                                            47   1e-05
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    47   1e-05
Kwal_27.11126                                                          47   2e-05
Kwal_33.15475                                                          46   2e-05
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    46   2e-05
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    45   3e-05
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    46   3e-05
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    46   3e-05
Scas_571.4                                                             46   3e-05
Kwal_14.1710                                                           46   3e-05
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         46   3e-05
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    46   3e-05
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    46   3e-05
Kwal_56.23685                                                          46   3e-05
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    46   4e-05
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    45   4e-05
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    45   4e-05
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    45   5e-05
Scas_652.7                                                             45   5e-05
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            45   5e-05
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    45   6e-05
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    45   6e-05
Scas_442.2*                                                            45   7e-05
Kwal_27.10385                                                          44   9e-05
Kwal_56.23035                                                          44   9e-05
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    44   9e-05
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    44   1e-04
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    44   1e-04
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    44   1e-04
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    44   1e-04
Scas_721.115*                                                          43   1e-04
Scas_693.22                                                            44   2e-04
Kwal_0.212                                                             43   2e-04
Kwal_56.23895                                                          43   2e-04
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    43   2e-04
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            43   2e-04
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    43   2e-04
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    43   2e-04
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    43   2e-04
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         43   2e-04
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       42   2e-04
Scas_693.36                                                            43   2e-04
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    43   3e-04
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    43   3e-04
Kwal_33.15591                                                          43   3e-04
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    42   3e-04
Scas_658.1                                                             42   3e-04
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    43   3e-04
Scas_670.21                                                            42   4e-04
Scas_680.11                                                            42   4e-04
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    42   4e-04
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    42   4e-04
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    42   4e-04
Kwal_56.22345                                                          42   5e-04
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    42   6e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    41   6e-04
Scas_718.6*                                                            42   6e-04
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    42   7e-04
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    41   7e-04
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            41   7e-04
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    41   8e-04
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    41   8e-04
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    41   0.001
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    41   0.001
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    41   0.001
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    40   0.001
Scas_692.25                                                            40   0.001
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    41   0.001
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    40   0.001
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    40   0.001
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    41   0.001
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          40   0.001
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    40   0.001
KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces...    40   0.002
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    40   0.002
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    40   0.002
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            40   0.002
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    40   0.002
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    40   0.002
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    40   0.002
Scas_592.4*                                                            39   0.002
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    40   0.003
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          40   0.003
Kwal_27.12586                                                          39   0.004
Kwal_26.8628                                                           39   0.004
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    39   0.004
YGR223C (HSV2) [2172] chr7 complement(940870..942216) Protein of...    39   0.004
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    39   0.005
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    39   0.005
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    39   0.005
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    39   0.005
Sklu_675.1 YMR146C, Contig c675 761-1687                               39   0.005
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            39   0.005
AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH] complement(1...    39   0.005
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         39   0.005
Kwal_55.21450                                                          39   0.005
Kwal_14.1675                                                           39   0.006
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    39   0.006
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    38   0.006
Kwal_34.15818                                                          38   0.006
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    38   0.007
Scas_605.18                                                            38   0.007
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    39   0.007
Scas_684.7                                                             39   0.007
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    38   0.008
Scas_692.29                                                            38   0.008
Kwal_56.24478                                                          38   0.009
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    38   0.009
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    38   0.009
Kwal_47.17827                                                          38   0.009
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    38   0.010
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    38   0.010
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    38   0.011
Scas_711.11                                                            38   0.012
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    37   0.012
Kwal_47.19083                                                          37   0.012
Kwal_26.8975                                                           37   0.013
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    38   0.014
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    37   0.014
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    37   0.015
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    37   0.016
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    37   0.017
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    37   0.019
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    37   0.020
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         37   0.021
Scas_512.3                                                             37   0.022
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         37   0.025
Scas_699.5                                                             37   0.026
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    37   0.028
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            37   0.028
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    37   0.029
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    36   0.030
Scas_721.29                                                            36   0.031
Scas_705.2                                                             36   0.033
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    36   0.037
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    36   0.040
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    36   0.042
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    36   0.042
Kwal_33.14971                                                          36   0.042
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    36   0.044
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    36   0.045
Kwal_27.12667                                                          35   0.054
Kwal_55.21144                                                          35   0.068
CAGL0J03564g 338044..341133 similar to sp|P25365 Saccharomyces c...    35   0.079
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    35   0.082
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    35   0.085
Sklu_2139.2 YFR021W, Contig c2139 1540-3165 reverse complement         35   0.087
Scas_649.10                                                            35   0.087
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    35   0.092
Scas_712.34                                                            35   0.092
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         35   0.095
Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement         35   0.096
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    35   0.100
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    34   0.11 
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    33   0.12 
Scas_706.24                                                            34   0.13 
Scas_685.11                                                            34   0.13 
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    34   0.15 
Scas_700.27*                                                           34   0.15 
Scas_607.8                                                             34   0.15 
YGR225W (AMA1) [2174] chr7 (945146..946328,946422..946927) Prote...    34   0.15 
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    34   0.16 
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    34   0.16 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    34   0.16 
Kwal_33.13515                                                          34   0.18 
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    34   0.19 
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...    33   0.20 
YFR021W (ATG18) [1701] chr6 (194800..196302) Protein that plays ...    33   0.20 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      33   0.21 
Kwal_0.356                                                             33   0.21 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    33   0.25 
Kwal_33.15136                                                          33   0.25 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    33   0.26 
Kwal_14.884                                                            33   0.27 
Kwal_47.17572                                                          33   0.27 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    33   0.27 
Kwal_26.7655                                                           33   0.29 
Scas_659.9                                                             33   0.30 
CAGL0K10692g 1039413..1040930 similar to sp|P43601 Saccharomyces...    33   0.31 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    33   0.32 
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    33   0.32 
Scas_655.1                                                             33   0.33 
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    33   0.33 
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    33   0.35 
Kwal_0.40                                                              33   0.35 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    33   0.36 
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    33   0.36 
YPL100W (ATG21) [5343] chr16 (361867..363357) Protein required f...    33   0.38 
CAGL0J03806g 361174..362436 similar to sp|Q12363 Saccharomyces c...    33   0.38 
Kwal_55.22076                                                          33   0.44 
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    32   0.45 
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    33   0.48 
Scas_657.13                                                            32   0.50 
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    32   0.51 
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    32   0.52 
Kwal_27.10573                                                          32   0.55 
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    32   0.57 
Scas_508.1*                                                            32   0.64 
Kwal_23.5962                                                           32   0.65 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    32   0.79 
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    32   0.81 
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    32   0.83 
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    32   0.88 
Scas_719.7*                                                            32   0.96 
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    31   1.0  
KLLA0C02849g 255963..257285 some similarities with sp|P53851 Sac...    32   1.0  
Scas_640.17                                                            31   1.1  
KLLA0E15972g 1419922..1420941 weakly similar to sp|P50079 Saccha...    31   1.2  
Kwal_47.17555                                                          31   1.2  
Kwal_26.9399                                                           31   1.3  
Sklu_1744.5 YGR007W, Contig c1744 4522-5469                            31   1.5  
KLLA0D04664g 397818..399320 similar to sp|P43601 Saccharomyces c...    31   1.6  
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            31   1.6  
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             31   1.6  
Scas_677.32                                                            31   1.9  
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    31   1.9  
Scas_670.22                                                            30   2.0  
Kwal_33.13534                                                          30   2.0  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    31   2.1  
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    30   2.2  
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    30   2.4  
Kwal_26.8953                                                           30   2.5  
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    30   2.5  
Kwal_27.9840                                                           30   2.5  
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    30   2.6  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    30   2.6  
Kwal_27.10785                                                          30   2.7  
Kwal_56.24332                                                          30   2.9  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    30   2.9  
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        30   3.0  
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    30   3.0  
Scas_701.22                                                            30   3.1  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    30   3.3  
Scas_510.5                                                             30   3.4  
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    30   3.7  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         30   3.7  
Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement       30   3.8  
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    29   4.2  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    29   4.2  
Scas_717.68                                                            30   4.3  
Scas_469.3                                                             30   4.5  
AER047C [2552] [Homologous to ScYLR384C (IKI3) - SH] (722964..72...    30   4.9  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    29   5.0  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          29   5.1  
Kwal_56.23207                                                          29   5.5  
YJL129C (TRK1) [2789] chr10 complement(173517..177224) Potassium...    29   5.5  
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    29   5.5  
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    29   5.7  
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    29   6.1  
Scas_397.2                                                             29   6.5  
Scas_700.4                                                             29   6.6  
Kwal_27.12070                                                          28   7.4  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         29   7.4  
CAGL0L08140g 892201..898470 similar to sp|P25356 Saccharomyces c...    29   7.4  
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    29   7.5  
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    28   8.1  
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    28   8.2  
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    28   8.4  
Kwal_27.12212                                                          28   8.9  
Kwal_56.24577                                                          28   9.0  
Scas_589.13                                                            28   9.3  
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       28   9.4  
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    28   9.6  
Scas_544.4                                                             28   10.0 
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    28   10.0 

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/328 (100%), Positives = 328/328 (100%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60
           MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV
Sbjct: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD
Sbjct: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
           GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR
Sbjct: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180

Query: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
           IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE
Sbjct: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240

Query: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYET 300
           WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYET
Sbjct: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYET 300

Query: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328
           NMVKWVEYGSKDVILLITAGDDGHVNVW
Sbjct: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  446 bits (1147), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 224/330 (67%), Positives = 265/330 (80%), Gaps = 9/330 (2%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60
           M  L L++SL LH D+CWSVD++ G ++ATGS DRKIKLVD+R+F+++EELDDTAHKK V
Sbjct: 1   MPNLHLVRSLKLHGDRCWSVDISKG-LLATGSADRKIKLVDVRNFKLVEELDDTAHKKAV 59

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           RSVAWRPH N+LAAGSFD+TVSIWG+DDD Y+ E    TELLA+IEGHENE+K VAWSHD
Sbjct: 60  RSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGE----TELLAVIEGHENEVKSVAWSHD 115

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
           G  LATCSRDKSVWIWEADE+ EEFEC SVLQEHSQDVKH++WH S  LLASSSYDDTVR
Sbjct: 116 GAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVR 175

Query: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW-CLEDDNGEYEQ 239
           IW + DDDWEC AVL+GH GTVW SDFE++ + +RLCSGSDD TVRIW CL DD   +++
Sbjct: 176 IWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDK 235

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-WIVECIHELTHGVY 298
           EWIQE++LP  HTRAVYSV+WS  G IAS GSDG L +YKE + G W V    +  H VY
Sbjct: 236 EWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVY 295

Query: 299 ETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           E N+VKW+    +  +LL+T GDDG VNVW
Sbjct: 296 EINVVKWLALDGR--VLLVTGGDDGCVNVW 323

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 211/330 (63%), Positives = 249/330 (75%), Gaps = 8/330 (2%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIR--SFQIIEELDDTAHKK 58
           MA + L+KSL L+ +K WS D + G I+ATGSTDRKIKLV ++   F +I+ LD+TAHKK
Sbjct: 1   MASINLIKSLKLYKEKIWSFDFSQG-ILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKK 59

Query: 59  TVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS 118
            +RSVAWRPH+++LAAGSFDSTVSIW K++     +   E +LLAIIEGHENE+K VAWS
Sbjct: 60  AIRSVAWRPHTSLLAAGSFDSTVSIWAKEESA---DRTFEMDLLAIIEGHENEVKGVAWS 116

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
           +DG  LATCSRDKSVWIWE DE GEE+ECISVLQEHSQDVKHVIWH S  LLASSSYDDT
Sbjct: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176

Query: 179 VRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYE 238
           VRIWKD DDDWEC AVLNGHEGTVWSSDF+K+    RLCSGSDD TVR+W    D+ + +
Sbjct: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQ 236

Query: 239 QEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVY 298
           QEW+ E+ILP  H R VY+V W   G IAS G+DG L +Y+E +  W V     L HGVY
Sbjct: 237 QEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVY 296

Query: 299 ETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           E N+VKW+E   K   +L T GDDG VN W
Sbjct: 297 EINVVKWLELNGK--TILATGGDDGIVNFW 324

>Scas_615.11
          Length = 349

 Score =  407 bits (1046), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 263/347 (75%), Gaps = 24/347 (6%)

Query: 3   GLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRS-----FQIIEELDDTAHK 57
           G+KL KSL L +DK WS+D ++G ++ATGSTDRKIK++++ +       +++ LDDT HK
Sbjct: 2   GIKLAKSLKLQNDKLWSLDYSHG-LLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60

Query: 58  KTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDE---------NDLETELLAIIEGH 108
           K +R VAWRPHSN+LAAGSFDSTVSIW ++DD   +E         N LE +LLAIIEGH
Sbjct: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGH 120

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
           ENE+K +AWSHDG LL++CSRDKSVWIWE D+ GEE+ECISVLQEHSQDVKHV+WH  LP
Sbjct: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP 180

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNS--NVRLCSGSDDGTVR 226
           LLASSSYDDT+R+WKD DDDWEC AVLNGHEGTVW SDFEK  +  ++RLCSGSDD TVR
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 227 IWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-- 284
           +W   DD+ + +QEWI E+ILPK H R +YSV+WS  G IASTGSDG L +YKE  +G  
Sbjct: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD 300

Query: 285 ---WIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              W V    EL HGVYE N+VKW++      ++L T GDDG VN+W
Sbjct: 301 EHDWEVIAKQELCHGVYEANIVKWIDINGN--MMLATGGDDGCVNLW 345

>Kwal_55.21559
          Length = 351

 Score =  404 bits (1038), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 203/319 (63%), Positives = 251/319 (78%), Gaps = 6/319 (1%)

Query: 13  HDDKCWSVDVNNGGIMATGSTDRKIKLVDIRS--FQIIEELDDTAHKKTVRSVAWRPHSN 70
           H DK WS+D + G +MAT S+DRKIKLV++++  FQ++EELDD+ HKK+VRSV++RPHS+
Sbjct: 32  HTDKLWSIDCSKG-LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSS 90

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
           ILAAGSFDST+SIWGK++D    ++  ETELLAIIEGHENE+K V+WSH G  LA+CSRD
Sbjct: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
           KSVWIWEADE+GEE+EC+SVLQEH+QDVKHV+WH  + LLASSSYDDT+R+WK+  DDWE
Sbjct: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA 250
           C AVLNGH+GTVW SDFEKS S++RL S SDD TVR+W   ++    E  W QE+ILP  
Sbjct: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNV 270

Query: 251 HTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-WIVECIHELTHGVYETNMVKWVEYG 309
           H+RAVYSV+WS  GYIAS GSDG LV+YKE + G W V       HG+YE N+VKW    
Sbjct: 271 HSRAVYSVSWSLDGYIASVGSDGLLVVYKEVKKGEWEVVVQQHEAHGIYEINVVKWATV- 329

Query: 310 SKDVILLITAGDDGHVNVW 328
             D +LL+T GDDG  N+W
Sbjct: 330 -DDSVLLLTGGDDGCANIW 347

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 246/333 (73%), Gaps = 10/333 (3%)

Query: 4   LKLLKSLALHDDKCWSVDVNN-GGIMATGSTDRKIKLVDIRSFQ--IIEELDDTAHKKTV 60
           L+L KSL LH+DK WS+D     G++ATGSTDR IK++ +++ +  +++ LDDT HKK V
Sbjct: 3   LQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAV 62

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           RSVAWRPHS++LAAGSFDST+SIW + D    +   LE ELLAIIEGHENE+K ++WS D
Sbjct: 63  RSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
           G LLATCSRDKSVWIWE DE GEE+ECISVLQEHSQDVKHV+WH    LLASSSYDDTVR
Sbjct: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVR 182

Query: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
           IWKD DDDWEC AVL GHEGT+W SDF K    +RLCSGSDD TVR+W    D+ + +QE
Sbjct: 183 IWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQE 242

Query: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG-----WIVECIHELTH 295
           W+ ES LP AH   +Y V WSP G IAS G+DG L +YKE ++      W +   ++  H
Sbjct: 243 WVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAH 302

Query: 296 GVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            VYE N VKWV    K+  +LITAGDDG VN+W
Sbjct: 303 TVYEINTVKWVNIDGKE--MLITAGDDGRVNLW 333

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  321 bits (823), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 168/235 (71%), Positives = 193/235 (82%), Gaps = 3/235 (1%)

Query: 95  NDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEH 154
           +++ETELLAI+EGHENE+K V+WSH G  LATCSRDKSVWIWEADE GEEFECISVLQEH
Sbjct: 5   SEMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEH 64

Query: 155 SQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNV 214
           SQDVKHV+WH  L LLASSSYDDT+RIWKD DDDW+C AVLNGHEGTVW SDFEKS S++
Sbjct: 65  SQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSL 124

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGR 274
           RLCSGSDD TVRIW   +DN + EQ W  +S+LP AH+RAVYSV+WSP G IASTGSDG 
Sbjct: 125 RLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGL 184

Query: 275 LVIYKESEDG-WIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           L IY+E E+G W +   HEL HGVYETN+VKW +   +   LL+T GDDG VN+W
Sbjct: 185 LAIYQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGE--TLLVTGGDDGCVNIW 237

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 25/124 (20%)

Query: 28  MATGSTDRKIKL-------VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDST 80
           + +GS D  +++        D      ++ +  +AH + V SV+W P   I + GS D  
Sbjct: 126 LCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGS-DGL 184

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHE-----NEIKCVAWSH-DGE-LLATCSRDKSV 133
           ++I+ + ++G             II  HE      E   V W+  DGE LL T   D  V
Sbjct: 185 LAIYQEKEEGK----------WEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCV 234

Query: 134 WIWE 137
            IW+
Sbjct: 235 NIWK 238

>Kwal_23.5351
          Length = 474

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 124/273 (45%), Gaps = 32/273 (11%)

Query: 58  KTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEG-HENEIKCVA 116
           + V  VA  P    LAAGS++  V I           +    E++  ++G H+++I  VA
Sbjct: 183 RPVSQVARSPDGASLAAGSWNGDVKIL----------HPQSLEVVRSLDGAHDDKIGGVA 232

Query: 117 WSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYD 176
           WS D +LLAT   D  V IW             VL+ H   V  V +H S   +AS+S+D
Sbjct: 233 WSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFD 292

Query: 177 DTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGE 236
            T R+W D + + E   +  GH   V+  DF+   S   LCS   D    +W +      
Sbjct: 293 MTWRLW-DVERETE-LQLQEGHAKEVYCLDFQCDGS--LLCSAGLDSVGHVWDMRTG--- 345

Query: 237 YEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGS-DGRLVIYKESEDGWIVECIHELTH 295
                 +  ++ + H + +Y V+WSP G+  +TGS DG + +       W +   ++ + 
Sbjct: 346 ------RSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQV-------WDIRKANKPSS 392

Query: 296 GVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +   ++V  V +  ++   L+++  D  + V+
Sbjct: 393 ILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVF 425

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 120/269 (44%), Gaps = 38/269 (14%)

Query: 4   LKLLKSL-ALHDDK----CWSVDVNNGGIMATGSTDRKIKL--VDIRSFQIIEELDDTAH 56
           L++++SL   HDDK     WS D     ++ATG  D  +K+     +S      +    H
Sbjct: 214 LEVVRSLDGAHDDKIGGVAWSSDSQ---LLATGGADNLVKIWNPQAQSHSEASRVVLRGH 270

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEIKCV 115
           +  V  V + P    +A+ SFD T  +W           D+E E  L + EGH  E+ C+
Sbjct: 271 EARVSKVKFHPSDRFVASASFDMTWRLW-----------DVERETELQLQEGHAKEVYCL 319

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSY 175
            +  DG LL +   D    +W+          + VL+ H++ +  V W  +   +A+ S 
Sbjct: 320 DFQCDGSLLCSAGLDSVGHVWDM----RTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSG 375

Query: 176 DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNG 235
           D TV++W D     +  ++L  H   V   +FEK N N  L S S D T+ ++       
Sbjct: 376 DGTVQVW-DIRKANKPSSIL-AHNSIVSEVNFEKENGNF-LVSSSYDRTIGVFA------ 426

Query: 236 EYEQEWIQESILPKAHTRAVYSVNWSPKG 264
                WI+ + L + HT  + SV+ S  G
Sbjct: 427 --TGSWIKLASL-QGHTDKILSVDISRGG 452

 Score = 35.0 bits (79), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 20/141 (14%)

Query: 43  RSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELL 102
           RS  ++E      H K +  V+W P+ + +A GS D TV +W  D    N  +       
Sbjct: 346 RSLMVLE-----GHAKPIYGVSWSPNGHHVATGSGDGTVQVW--DIRKANKPSS------ 392

Query: 103 AIIEGHENEIKCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
             I  H + +  V +   +G  L + S D+++ ++        +  ++ LQ H+  +  V
Sbjct: 393 --ILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATG----SWIKLASLQGHTDKILSV 446

Query: 162 IWHQSLPLLASSSYDDTVRIW 182
              +    L SS +D +V+IW
Sbjct: 447 DISRGGANLWSSGWDRSVKIW 467

>Scas_679.28
          Length = 815

 Score = 78.6 bits (192), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 91/194 (46%), Gaps = 23/194 (11%)

Query: 48  IEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIE 106
           + E    AH+K + ++A  P+ +I A  S+D T  IW           DLE  EL A + 
Sbjct: 482 VSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIW-----------DLENGELTATLS 530

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166
            H+  +  VA+    +L+ATCS DK++ IW  D     F  +  L+ H+  V+  ++   
Sbjct: 531 NHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLD----TFSVMKTLEGHTNAVQRCMFINK 586

Query: 167 LPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
              L SS  D  ++IW DC    +C   L+GH+  +W+    + N    + S   DG  +
Sbjct: 587 QLQLVSSGADGLIKIW-DCSTG-DCLKTLDGHDNRIWA--LTEINDGDMIVSADADGVFQ 642

Query: 227 IWCLEDDNGEYEQE 240
            W    D  E E+E
Sbjct: 643 FW---KDCTELEKE 653

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 132/317 (41%), Gaps = 41/317 (12%)

Query: 33  TDRKIKLVDIRSFQIIEELDD-------TAHKKTVRSVAWR-PHSNILAAGSFDSTVSIW 84
           +D+ ++LVDI+S  + E  D          +  T+  + +  P+ + LA  +   T+ I 
Sbjct: 306 SDQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRII 365

Query: 85  GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE 144
                   +E  +  E+    EGHE+ +  +  + DG  +AT S+D +  +W+ + +  +
Sbjct: 366 PVPS-SEQEELPINVEMY---EGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINK 421

Query: 145 FECISVLQEHSQDVKHV----IWHQSLP-LLASSSYDDTVRIWKDCDDDW---ECCAVLN 196
           F+       HS  V  V    +  +  P  L ++S D T++ WK         E C ++ 
Sbjct: 422 FQPYVKFIGHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVK 481

Query: 197 GHEGTVWSSD-----FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAH 251
             E T  + +        S ++    + S D T +IW LE  NGE              H
Sbjct: 482 VSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLE--NGELTATL-------SNH 532

Query: 252 TRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSK 311
            R ++ V +     + +T S  + +        W ++    +      TN V+   + +K
Sbjct: 533 KRGLWDVAFCQYDKLIATCSGDKTIKI------WSLDTFSVMKTLEGHTNAVQRCMFINK 586

Query: 312 DVILLITAGDDGHVNVW 328
             + L+++G DG + +W
Sbjct: 587 Q-LQLVSSGADGLIKIW 602

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 80/181 (44%), Gaps = 14/181 (7%)

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGK-------DDDGYNDENDLETELLAIIEGHE 109
           K + +S   RP   I A  S  +TVS  G        DD         +  L +I    E
Sbjct: 4   KTSYQSTTLRP---IYAGSSAIATVSADGTVLATPILDDIEIISLTTPQRRLHSIANDDE 60

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL 169
            EI  +  + D + L+  S+++ + I++ D+  ++   I    + S     +    +  L
Sbjct: 61  QEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTL 120

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF-EKSNSNV-RLCSGSDDGTVRI 227
           +A    D ++ +  D ++ +     L GH  T+ +  F  ++NSNV  LCSG  +G V++
Sbjct: 121 VALGGTDGSITVV-DIENGF-ITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKV 178

Query: 228 W 228
           W
Sbjct: 179 W 179

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 58/276 (21%), Positives = 105/276 (38%), Gaps = 62/276 (22%)

Query: 5   KLLKSLALHDDKCWSVDVNNGG-IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSV 63
           K+++S+ +    C+ +D ++   ++A G TD  I +VDI +  I   L    H  T+ ++
Sbjct: 98  KIIRSMKM-SSPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLK--GHGATISAL 154

Query: 64  AWRPHSN----ILAAGSFDSTVSIW-------------------GKDDDGYNDENDL--- 97
            +   +N    +L +G  +  V +W                   G D     DE  L   
Sbjct: 155 KFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISG 214

Query: 98  ---------------ETELLAIIEGHENEIKCVAWSHDGE----------LLATCSRDKS 132
                          +  LL  I  H+    C   +H+ +          LL   S +K+
Sbjct: 215 GRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKA 274

Query: 133 VWIWEADEMGEEFECISVLQEHSQDVKHVIWH-QSLPLLASSSYDDTVRIWKDCDDDWEC 191
             I +  +  EE   I VL     D  +++   Q+L L+     D    +  +  D  E 
Sbjct: 275 TMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELV-----DIKSNLLNESSDIIEI 329

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
            + + G+ GT+    F   N + +L   ++  T+RI
Sbjct: 330 ESCIAGNNGTIADMKFVGPNHD-KLALATNSPTLRI 364

>Scas_631.17
          Length = 474

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 111/238 (46%), Gaps = 27/238 (11%)

Query: 97  LETELLAII----EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQ 152
           L+T+ L +I     GH+ +I  +AW+     L + + D  V I   D   +  + ++ LQ
Sbjct: 213 LDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQ 272

Query: 153 EHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNS 212
            H+  V +V +H S   +AS+S+D T R+W D + + E      GH   V+S  F+  N 
Sbjct: 273 GHTGRVVNVDFHPSGRFVASASFDMTWRLW-DIESETE-LQFQEGHGKEVYSLSFQ--ND 328

Query: 213 NVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILP-KAHTRAVYSVNWSPKGY-IASTG 270
              LCSG  D    +W +             +SI+  + H + +YSV+WSP GY IA+ G
Sbjct: 329 GALLCSGGLDNAAIVWDVR----------TGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 271 SDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            DG + I       W +    E T  +   N+V  V +       L++ G D  + ++
Sbjct: 379 GDGVINI-------WDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 109/249 (43%), Gaps = 34/249 (13%)

Query: 39  LVDIRSF----QIIEELDD-TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYND 93
           LV I SF    +II+EL     H   V +V + P    +A+ SFD T  +W         
Sbjct: 252 LVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLW--------- 302

Query: 94  ENDLETEL-LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQ 152
             D+E+E  L   EGH  E+  +++ +DG LL +   D +  +W+        + I  LQ
Sbjct: 303 --DIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDV----RTGKSIMNLQ 356

Query: 153 EHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNS 212
            H++ +  V W      +A+   D  + IW D     E   +L  H   V    F+KS  
Sbjct: 357 GHAKPIYSVDWSPDGYHIATGGGDGVINIW-DIRKTTETTRLL-AHNNIVTGVRFQKSTG 414

Query: 213 NVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGS 271
           +  +  G D   +RI+    DN      WIQ   L + HT  +  V+ S     I S+G 
Sbjct: 415 HCLVSCGYDK-QIRIYS--SDN------WIQVKTL-EGHTDKILDVDISEDAQLIVSSGW 464

Query: 272 DGRLVIYKE 280
           D  L ++K+
Sbjct: 465 DRSLKLWKQ 473

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 136/312 (43%), Gaps = 40/312 (12%)

Query: 22  VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTV 81
           +++  + ATGS    IK++D ++  +I  +++  H   +  +AW   +  L +G+ D  V
Sbjct: 195 MSDNALCATGSWAGDIKILDTKTLDVISGIEN-GHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 82  SIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
            I   D D       +  EL A ++GH   +  V +   G  +A+ S D +  +W+ +  
Sbjct: 254 KIHSFDPD-----VKIIKELTA-LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESE 307

Query: 142 GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN--GHE 199
            E    +   + H ++V  + +     LL S   D+   +W    D     +++N  GH 
Sbjct: 308 TE----LQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVW----DVRTGKSIMNLQGHA 359

Query: 200 GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVN 259
             ++S D+  S     + +G  DG + IW +             E+    AH   V  V 
Sbjct: 360 KPIYSVDW--SPDGYHIATGGGDGVINIWDIRK---------TTETTRLLAHNNIVTGVR 408

Query: 260 W--SPKGYIASTGSDGRLVIYKESEDGWI-VECIHELTHGVYETNMVKWVEYGSKDVILL 316
           +  S    + S G D ++ IY  S D WI V+ +   T  + + ++       S+D  L+
Sbjct: 409 FQKSTGHCLVSCGYDKQIRIY--SSDNWIQVKTLEGHTDKILDVDI-------SEDAQLI 459

Query: 317 ITAGDDGHVNVW 328
           +++G D  + +W
Sbjct: 460 VSSGWDRSLKLW 471

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 18/173 (10%)

Query: 13  HDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H  + +S+   N+G ++ +G  D    + D+R+ + I  L    H K + SV W P    
Sbjct: 316 HGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQ--GHAKPIYSVDWSPDGYH 373

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD-GELLATCSRD 130
           +A G  D  ++IW   D     E    T LLA    H N +  V +    G  L +C  D
Sbjct: 374 IATGGGDGVINIW---DIRKTTET---TRLLA----HNNIVTGVRFQKSTGHCLVSCGYD 423

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK 183
           K + I+ +D   +    +  L+ H+  +  V   +   L+ SS +D ++++WK
Sbjct: 424 KQIRIYSSDNWIQ----VKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 73.9 bits (180), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 86/191 (45%), Gaps = 21/191 (10%)

Query: 50  ELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHE 109
           E    AH+K + +++  P+ +I A  S+D T  IW  D            E+ A +  H+
Sbjct: 481 EYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTG----------EVEATLANHK 530

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL 169
             +  VA+     LLATCS D+S+ +W      E F  +  L+ H+  V+ V +      
Sbjct: 531 RGLWGVAFCEYDWLLATCSGDRSINLWSL----ESFTVLKTLEGHTNAVQRVSFINGNKQ 586

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           L S+  D  V+IW DC    EC   L+ H   +W+     +N    + +   DG  + W 
Sbjct: 587 LVSTGADGLVKIW-DCSTG-ECVRTLDAHNNRIWA--LAVANDGQLIITADADGVFQFW- 641

Query: 230 LEDDNGEYEQE 240
             +DN E E E
Sbjct: 642 --EDNSEEEHE 650

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 119/279 (42%), Gaps = 38/279 (13%)

Query: 67  PHSNILAAGSFDSTVSIWGKDDDGYNDE-NDLETELLAIIEGHENEIKCVAWSHDGELLA 125
           P  N LA  +   T+ I        + E  ++ETE+    EGH + +  +  + DG  LA
Sbjct: 342 PSLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMY---EGHTDLLNSLDATSDGLWLA 398

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV----IWHQSLP-LLASSSYDDTVR 180
           T S+D SV +W  +E    FE  +    H+  V  +    + +++ P  L ++S D T++
Sbjct: 399 TASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIK 458

Query: 181 IWKDCDDD----WECCAVLNGHEGTVWSSD-----FEKSNSNVRLCSGSDDGTVRIWCLE 231
            WK  + +     E   ++   E T  + +        S ++    + S D T +IW + 
Sbjct: 459 RWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNV- 517

Query: 232 DDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIH 291
            D GE E            H R ++ V +    ++ +T S  R      S + W +E   
Sbjct: 518 -DTGEVEATLAN-------HKRGLWGVAFCEYDWLLATCSGDR------SINLWSLESFT 563

Query: 292 ELTHGVYETNMVKWVEY--GSKDVILLITAGDDGHVNVW 328
            L      TN V+ V +  G+K    L++ G DG V +W
Sbjct: 564 VLKTLEGHTNAVQRVSFINGNKQ---LVSTGADGLVKIW 599

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 19/135 (14%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++AT S DR I L  + SF +++ L+   H   V+ V++   +  L +   D  V IW  
Sbjct: 544 LLATCSGDRSINLWSLESFTVLKTLE--GHTNAVQRVSFINGNKQLVSTGADGLVKIW-- 599

Query: 87  DDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEAD-----E 140
                    D  T E +  ++ H N I  +A ++DG+L+ T   D     WE +     E
Sbjct: 600 ---------DCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEEHE 650

Query: 141 MGEEFECISVLQEHS 155
              E E + V QE S
Sbjct: 651 RNIEQEKLRVEQEQS 665

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 73.2 bits (178), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 89/188 (47%), Gaps = 28/188 (14%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAI-IEGHENEI 112
            H  T+   A+ PH S+ +  G  D+T  IW           D +T+   + + GH N +
Sbjct: 143 GHGATILCSAFAPHTSSRVVTGGGDNTARIW-----------DCDTQTPKVTLNGHRNWV 191

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ------- 165
            CV+WS DGE++AT S D ++ +W+A E G+       L+ HS+ +  + W         
Sbjct: 192 LCVSWSADGEVIATGSMDNTIRLWDA-ESGKPLG--DALRGHSKWITSLTWEPIHLVEPG 248

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
           S P LAS+S D T+RIW        C   L GH  +V      K      L SGS D TV
Sbjct: 249 SKPRLASASKDGTIRIWDSSRR--VCLMTLGGHTNSV---SCVKWGGEGILYSGSHDKTV 303

Query: 226 RIWCLEDD 233
           R W ++ +
Sbjct: 304 RAWDMKQN 311

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 21/163 (12%)

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDGELLAT 126
           H  ++   S D T+ +W          N L+ T+ ++ + GH+  +  VA+S DG+ + +
Sbjct: 372 HEELMVTASDDFTMFLW----------NPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVS 421

Query: 127 CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCD 186
            S D S+ +W+    G+E   +S  + H   V  V W     LL S S D T+++W   D
Sbjct: 422 ASFDNSIKLWD----GKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---D 474

Query: 187 DDWECCAV-LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
                 +V L GH+  V++ D+  S    R+CSG  D  +R+W
Sbjct: 475 VKTRKLSVDLPGHQDEVYTVDW--SVDGKRVCSGGKDKMMRLW 515

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 136/325 (41%), Gaps = 61/325 (18%)

Query: 18  WSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-------HSN 70
           WS D   G ++ATGS D  I+L D  S + + +     H K + S+ W P          
Sbjct: 196 WSAD---GEVIATGSMDNTIRLWDAESGKPLGDALR-GHSKWITSLTWEPIHLVEPGSKP 251

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
            LA+ S D T+ IW          +      L  + GH N + CV W  +G +L + S D
Sbjct: 252 RLASASKDGTIRIW----------DSSRRVCLMTLGGHTNSVSCVKWGGEG-ILYSGSHD 300

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
           K+V  W+  + G+   CI++L+ H+  V H+          S S D  +R+      D+ 
Sbjct: 301 KTVRAWDMKQNGK---CINILKSHAHWVNHL----------SLSTDYALRVGA---FDYT 344

Query: 191 CCAVLNGHEGTVWS-SDFEK-SNSNVR----LCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244
                N  E    +  ++EK +  N +    + + SDD T+ +W     N     + I  
Sbjct: 345 GVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLW-----NPLKGTKPISR 399

Query: 245 SILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMV 303
                 H + V  V +SP G YI S   D  + ++ + ++G  +         VY+   V
Sbjct: 400 MT---GHQKLVNHVAFSPDGKYIVSASFDNSIKLW-DGKEGTFLSTFRGHVASVYQ---V 452

Query: 304 KWVEYGSKDVILLITAGDDGHVNVW 328
            W    S D  LL++   D  + VW
Sbjct: 453 AW----SSDCRLLVSCSKDTTLKVW 473

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 17/157 (10%)

Query: 27  IMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWG 85
           +M T S D  + L   ++  + I  +  T H+K V  VA+ P    + + SFD+++ +W 
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRM--TGHQKLVNHVAFSPDGKYIVSASFDNSIKLW- 431

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF 145
              DG       E   L+   GH   +  VAWS D  LL +CS+D ++ +W+        
Sbjct: 432 ---DGK------EGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSV 482

Query: 146 ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +    L  H  +V  V W      + S   D  +R+W
Sbjct: 483 D----LPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 81/209 (38%), Gaps = 32/209 (15%)

Query: 99  TELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
           T   + I GH   I C A++ H    + T   D +  IW+ D    +      L  H   
Sbjct: 135 TRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKV----TLNGHRNW 190

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE-----KSNS 212
           V  V W     ++A+ S D+T+R+W D +        L GH   + S  +E     +  S
Sbjct: 191 VLCVSWSADGEVIATGSMDNTIRLW-DAESGKPLGDALRGHSKWITSLTWEPIHLVEPGS 249

Query: 213 NVRLCSGSDDGTVRIW------CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI 266
             RL S S DGT+RIW      CL    G               HT +V  V W  +G +
Sbjct: 250 KPRLASASKDGTIRIWDSSRRVCLMTLGG---------------HTNSVSCVKWGGEGIL 294

Query: 267 ASTGSDGRLVIYKESEDGWIVECIHELTH 295
            S   D  +  +   ++G  +  +    H
Sbjct: 295 YSGSHDKTVRAWDMKQNGKCINILKSHAH 323

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 119/275 (43%), Gaps = 40/275 (14%)

Query: 7   LKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIR-SFQIIEELDDTAHKKTVRSVAW 65
           L +L  H +    V     GI+ +GS D+ ++  D++ + + I  L   AH        W
Sbjct: 273 LMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAH--------W 324

Query: 66  RPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLA 125
             H ++    S D  + +   D  G    N  E    A+ + +E ++      H+ EL+ 
Sbjct: 325 VNHLSL----STDYALRVGAFDYTGVKPANAKEARDKAL-QNYE-KVARKNGKHE-ELMV 377

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185
           T S D ++++W   +  +    IS +  H + V HV +      + S+S+D+++++W   
Sbjct: 378 TASDDFTMFLWNPLKGTKP---ISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGK 434

Query: 186 DDDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
           +  +   +   GH  +V    WSSD         L S S D T+++W ++      +   
Sbjct: 435 EGTF--LSTFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWDVKTRKLSVD--- 483

Query: 242 IQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
                LP  H   VY+V+WS  G    +G   +++
Sbjct: 484 -----LP-GHQDEVYTVDWSVDGKRVCSGGKDKMM 512

 Score = 35.0 bits (79), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 56/148 (37%), Gaps = 33/148 (22%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           + + GH  T+  S F    S+ R+ +G  D T RIW  +    +         +    H 
Sbjct: 139 SAIAGHGATILCSAFAPHTSS-RVVTGGGDNTARIWDCDTQTPK---------VTLNGHR 188

Query: 253 RAVYSVNWSPKGYIASTGSDGRLVIYKESEDG------------WIVECIHELTHGVYET 300
             V  V+WS  G + +TGS    +   ++E G            WI     E  H     
Sbjct: 189 NWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIH----- 243

Query: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328
                VE GSK    L +A  DG + +W
Sbjct: 244 ----LVEPGSKP--RLASASKDGTIRIW 265

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 72.8 bits (177), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 91/183 (49%), Gaps = 28/183 (15%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            H  T+   A+ PH S+ +  G+ D+T  IW         + D +T +   ++GH N + 
Sbjct: 141 GHGSTILCSAFAPHTSSRMVTGAGDNTARIW---------DCDTQTPM-HTLKGHYNWVL 190

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECIS-VLQEHSQ-------DVKHVIWHQ 165
           CV+WS DGE++AT S D ++ +W+     +  +C+   L+ HS+       +  H++   
Sbjct: 191 CVSWSPDGEVIATGSMDNTIRLWDP----KSGQCLGDALRGHSKWITSLSWEPIHLVKPG 246

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
           S P LASSS D T++IW        C   ++GH  +V      K      L SGS D TV
Sbjct: 247 SKPRLASSSKDGTIKIWDTVSR--VCQYTMSGHTNSV---SCVKWGGQGLLYSGSHDRTV 301

Query: 226 RIW 228
           R+W
Sbjct: 302 RVW 304

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 78/160 (48%), Gaps = 21/160 (13%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           ++   S D T+ +W          N L+ T+ +A + GH+  +  VA+S DG  + + S 
Sbjct: 373 MMVTASDDYTMFLW----------NPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASF 422

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D S+ +W+    G + + IS  + H   V  V W     LL S S D T+++W   D   
Sbjct: 423 DNSIKLWD----GRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVRT 475

Query: 190 ECCAV-LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              +V L GH+  V++ D+  S    R+CSG  D  VR+W
Sbjct: 476 RKLSVDLPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRLW 513

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 74/162 (45%), Gaps = 19/162 (11%)

Query: 23  NNGGIMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTV 81
           N+  +M T S D  + L   ++S + I  +  T H+K V  VA+ P    + + SFD+++
Sbjct: 369 NSEEMMVTASDDYTMFLWNPLKSTKPIARM--TGHQKLVNHVAFSPDGRYIVSASFDNSI 426

Query: 82  SIW-GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
            +W G+D            + ++   GH   +  VAWS D  LL +CS+D ++ +W+   
Sbjct: 427 KLWDGRDG-----------KFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRT 475

Query: 141 MGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
                +    L  H  +V  V W      + S   D  VR+W
Sbjct: 476 RKLSVD----LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 83/204 (40%), Gaps = 22/204 (10%)

Query: 99  TELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
           T   + I GH + I C A++ H    + T + D +  IW+ D        +  L+ H   
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTP----MHTLKGHYNW 188

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCA-VLNGHEGTVWSSDFE-----KSN 211
           V  V W     ++A+ S D+T+R+W       +C    L GH   + S  +E     K  
Sbjct: 189 VLCVSWSPDGEVIATGSMDNTIRLWDP--KSGQCLGDALRGHSKWITSLSWEPIHLVKPG 246

Query: 212 SNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGS 271
           S  RL S S DGT++IW       +Y             HT +V  V W  +G + S   
Sbjct: 247 SKPRLASSSKDGTIKIWDTVSRVCQYTMS---------GHTNSVSCVKWGGQGLLYSGSH 297

Query: 272 DGRLVIYKESEDGWIVECIHELTH 295
           D  + ++  +  G  +  +    H
Sbjct: 298 DRTVRVWDINSQGRCINILKSHAH 321

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 110/257 (42%), Gaps = 42/257 (16%)

Query: 26  GIMATGSTDRKIKLVDIRS-FQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW 84
           G++ +GS DR +++ DI S  + I  L   AH        W  H ++    S D  + I 
Sbjct: 290 GLLYSGSHDRTVRVWDINSQGRCINILKSHAH--------WVNHLSL----STDYALRIG 337

Query: 85  GKDDDGYNDENDLETELLAIIEGHEN-EIKCVAWSHDGELLATCSRDKSVWIWEADEMGE 143
             D  G       E +  A+    EN E  C    +  E++ T S D ++++W   +  +
Sbjct: 338 AFDHTGKKPSTPEEAQKKAL----ENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTK 393

Query: 144 EFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTV- 202
               I+ +  H + V HV +      + S+S+D+++++W   D  +   +   GH  +V 
Sbjct: 394 P---IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF--ISTFRGHVASVY 448

Query: 203 ---WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVN 259
              WSSD         L S S D T+++W +       +        LP  H   VY+V+
Sbjct: 449 QVAWSSDCR------LLVSCSKDTTLKVWDVRTRKLSVD--------LP-GHKDEVYTVD 493

Query: 260 WSPKGYIASTGSDGRLV 276
           WS  G    +G   ++V
Sbjct: 494 WSVDGKRVCSGGKDKMV 510

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 63/142 (44%), Gaps = 21/142 (14%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           + + GH  T+  S F    S+ R+ +G+ D T RIW  +     +           K H 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSS-RMVTGAGDNTARIWDCDTQTPMHTL---------KGHY 186

Query: 253 RAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYE--TNM----VKWV 306
             V  V+WSP G + +TGS    +   + + G   +C+ +   G  +  T++    +  V
Sbjct: 187 NWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG---QCLGDALRGHSKWITSLSWEPIHLV 243

Query: 307 EYGSKDVILLITAGDDGHVNVW 328
           + GSK    L ++  DG + +W
Sbjct: 244 KPGSKP--RLASSSKDGTIKIW 263

>Scas_720.95
          Length = 515

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 133/316 (42%), Gaps = 52/316 (16%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-------HSNILAAGS 76
           NG ++ATGS D  I+L D +  + + +     H K + S+AW P        S  LA+ S
Sbjct: 197 NGEVIATGSMDNTIRLWDSKDGKPLGDAL-RGHLKWITSLAWEPIHLVKPGESPRLASAS 255

Query: 77  FDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWI 135
            D T+ IW           D+   + L  + GH N + C+ WS  G ++ + S DK+V +
Sbjct: 256 KDGTIRIW-----------DITRRVCLYTMSGHTNSVSCIKWSGQG-IIYSGSHDKTVRV 303

Query: 136 WEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVL 195
           W+   M  + +CI++L+ H+  V H+       L    ++D T        D  +    L
Sbjct: 304 WD---MNADGKCINILKSHAHWVNHLSLSTDYALRV-GAFDHTGAQPASAKDARD--KAL 357

Query: 196 NGHEGTVWSSDFEKSNSNVR--LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTR 253
             +E  V      K N  +   + + SDD T+ +W     N    +           H +
Sbjct: 358 ANYEKVV------KKNGKLEELMVTASDDFTMFLWNPLKSNKPIARM--------TGHQK 403

Query: 254 AVYSVNWSPKG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKD 312
            V  V +SP G YI S   D  + ++ +  DG  +         VY+   V W    S D
Sbjct: 404 LVNHVAFSPDGRYIVSASFDNSIKLW-DGRDGKFISTFRGHVASVYQ---VAW----SAD 455

Query: 313 VILLITAGDDGHVNVW 328
             LL++   D  + VW
Sbjct: 456 CRLLVSCSKDTTLKVW 471

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 78/160 (48%), Gaps = 21/160 (13%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           ++   S D T+ +W          N L++ + +A + GH+  +  VA+S DG  + + S 
Sbjct: 373 LMVTASDDFTMFLW----------NPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASF 422

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D S+ +W+    G + + IS  + H   V  V W     LL S S D T+++W   D   
Sbjct: 423 DNSIKLWD----GRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVW---DVRT 475

Query: 190 ECCAV-LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              +V L GH+  V++ D+  S    R+CSG  D  VRIW
Sbjct: 476 RKLSVDLPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRIW 513

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 72/158 (45%), Gaps = 19/158 (12%)

Query: 27  IMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW- 84
           +M T S D  + L   ++S + I  +  T H+K V  VA+ P    + + SFD+++ +W 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 85  GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE 144
           G+D            + ++   GH   +  VAWS D  LL +CS+D ++ +W+       
Sbjct: 431 GRDG-----------KFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLS 479

Query: 145 FECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
            +    L  H  +V  V W      + S   D  VRIW
Sbjct: 480 VD----LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 20/184 (10%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            H  T+   A+ P+ S+ +  G+ D+T  IW         + D +T   A + GH N + 
Sbjct: 141 GHGSTILCSAFAPNTSSRMVTGAGDNTARIW---------DCDTQTPK-ATLTGHFNWVL 190

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADE---MGEEFEC-ISVLQEHSQDVKHVIWHQSLPL 169
           CV++  +GE++AT S D ++ +W++ +   +G+     +  +   + +  H++     P 
Sbjct: 191 CVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPR 250

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           LAS+S D T+RIW        C   ++GH  +V  S  + S   + + SGS D TVR+W 
Sbjct: 251 LASASKDGTIRIWDITRR--VCLYTMSGHTNSV--SCIKWSGQGI-IYSGSHDKTVRVWD 305

Query: 230 LEDD 233
           +  D
Sbjct: 306 MNAD 309

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 86/203 (42%), Gaps = 20/203 (9%)

Query: 99  TELLAIIEGHENEIKCVAWSHD-GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
           T   + I GH + I C A++ +    + T + D +  IW+ D    +    + L  H   
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPK----ATLTGHFNW 188

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE-----KSNS 212
           V  V +  +  ++A+ S D+T+R+W D  D       L GH   + S  +E     K   
Sbjct: 189 VLCVSYCPNGEVIATGSMDNTIRLW-DSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGE 247

Query: 213 NVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
           + RL S S DGT+RIW +      Y             HT +V  + WS +G I S   D
Sbjct: 248 SPRLASASKDGTIRIWDITRRVCLYTMS---------GHTNSVSCIKWSGQGIIYSGSHD 298

Query: 273 GRLVIYKESEDGWIVECIHELTH 295
             + ++  + DG  +  +    H
Sbjct: 299 KTVRVWDMNADGKCINILKSHAH 321

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 116/292 (39%), Gaps = 75/292 (25%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +A+ S D  I++ DI     +  +  + H  +V  + W     I+ +GS D TV +W  +
Sbjct: 251 LASASKDGTIRIWDITRRVCLYTM--SGHTNSVSCIKWS-GQGIIYSGSHDKTVRVWDMN 307

Query: 88  DDGYNDENDLETELLAIIEGHEN-----------EIKCVAWSHDG--------------- 121
            DG         + + I++ H +            ++  A+ H G               
Sbjct: 308 ADG---------KCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALA 358

Query: 122 -------------ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
                        EL+ T S D ++++W   +  +    I+ +  H + V HV +     
Sbjct: 359 NYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKP---IARMTGHQKLVNHVAFSPDGR 415

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGT 224
            + S+S+D+++++W   D  +   +   GH  +V    WS+D         L S S D T
Sbjct: 416 YIVSASFDNSIKLWDGRDGKF--ISTFRGHVASVYQVAWSADCR------LLVSCSKDTT 467

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
           +++W +       +        LP  H   VY+V+WS  G    +G   ++V
Sbjct: 468 LKVWDVRTRKLSVD--------LP-GHKDEVYTVDWSVDGKRVCSGGKDKMV 510

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 91/182 (50%), Gaps = 26/182 (14%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            H  T+   A+ PH S+ +  G+ D+T  IW         + D +T L   ++GH N + 
Sbjct: 139 GHGATILCSAFAPHTSSRMVTGAGDNTARIW---------DCDTQTPL-CTLKGHSNWVL 188

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQ-------DVKHVIWHQS 166
           CVAWS DGE++AT S D ++ +W++ E G+       L+ H++       +  H++    
Sbjct: 189 CVAWSADGEVIATGSMDATIRLWDS-EKGQSLG--DALRGHTKWITSLSWEPIHLVKPGE 245

Query: 167 LPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
            P LAS+S D T++IW        C   L+GH  +V  S  +    NV L S S D TVR
Sbjct: 246 KPRLASASKDGTIKIWDTTRR--VCIYTLSGHTSSV--SCIKWGGRNV-LYSASHDRTVR 300

Query: 227 IW 228
            W
Sbjct: 301 CW 302

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 73/158 (46%), Gaps = 19/158 (12%)

Query: 27  IMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW- 84
           +M TGS D  + L   ++  + I  +  T H+K V  VA+ P    + + SFD+++ +W 
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPILRM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 428

Query: 85  GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE 144
           G+D            + +A   GH   +  VAWS D  LL +CS+D ++ +W+       
Sbjct: 429 GRDG-----------KFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLT 477

Query: 145 FECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
            +    L  H+ +V  V W      + S   D  VR+W
Sbjct: 478 VD----LPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 76/160 (47%), Gaps = 21/160 (13%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           ++  GS D T+ +W          N L+ ++ +  + GH+  +  VA+S DG  + + S 
Sbjct: 371 LMVTGSDDFTMYLW----------NPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASF 420

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D S+ +W+    G + + I+  + H   V  V W     LL S S D T+++W   D   
Sbjct: 421 DNSIKLWD----GRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKT 473

Query: 190 ECCAV-LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
               V L GH   V++ D+  S    R+CSG  D  VR+W
Sbjct: 474 RKLTVDLPGHNDEVYTVDW--SVDGKRVCSGGKDKMVRLW 511

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 129/322 (40%), Gaps = 53/322 (16%)

Query: 17  CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-------HS 69
            WS D   G ++ATGS D  I+L D    Q + +     H K + S++W P         
Sbjct: 191 AWSAD---GEVIATGSMDATIRLWDSEKGQSLGDALR-GHTKWITSLSWEPIHLVKPGEK 246

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
             LA+ S D T+ IW          +      +  + GH + + C+ W     +L + S 
Sbjct: 247 PRLASASKDGTIKIW----------DTTRRVCIYTLSGHTSSVSCIKWGGR-NVLYSASH 295

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D++V  W+   M    +CI++L+ H+  V H+        L    +D T        +D 
Sbjct: 296 DRTVRCWD---MAAGGKCINILKSHAHWVNHLSLSTDY-ALRMGPFDHT-GTKPASPEDA 350

Query: 190 ECCAVLNGHEGTVWSSDFEKSNSNVR--LCSGSDDGTVRIWCLEDDNGEYEQEWIQESIL 247
           +  A+ N  +         K N  +   + +GSDD T+ +W           +  +  + 
Sbjct: 351 QARALRNYEK-------VAKKNGTMEELMVTGSDDFTMYLW--------NPLKGSKPILR 395

Query: 248 PKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWV 306
              H + V  V +SP G YI S   D  + ++ +  DG  +         VY+   V W 
Sbjct: 396 MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-DGRDGKFIATFRGHVASVYQ---VAW- 450

Query: 307 EYGSKDVILLITAGDDGHVNVW 328
              S D  LL++   D  + VW
Sbjct: 451 ---SSDCRLLVSCSKDTTLKVW 469

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 72/159 (45%), Gaps = 24/159 (15%)

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
           EL+ T S D ++++W   +  +    I  +  H + V HV +      + S+S+D+++++
Sbjct: 370 ELMVTGSDDFTMYLWNPLKGSKP---ILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKL 426

Query: 182 WKDCDDDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           W   D  +   A   GH  +V    WSSD         L S S D T+++W ++      
Sbjct: 427 WDGRDGKF--IATFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWDVKTRKLTV 478

Query: 238 EQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
           +        LP  H   VY+V+WS  G    +G   ++V
Sbjct: 479 D--------LP-GHNDEVYTVDWSVDGKRVCSGGKDKMV 508

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 58/145 (40%), Gaps = 27/145 (18%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           + + GH  T+  S F    S+ R+ +G+ D T RIW  +                 K H+
Sbjct: 135 SAIAGHGATILCSAFAPHTSS-RMVTGAGDNTARIWDCDTQT---------PLCTLKGHS 184

Query: 253 RAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKD 312
             V  V WS  G + +TGS    +   +SE G   + + +   G       KW+   S +
Sbjct: 185 NWVLCVAWSADGEVIATGSMDATIRLWDSEKG---QSLGDALRG-----HTKWITSLSWE 236

Query: 313 VILLITAGD---------DGHVNVW 328
            I L+  G+         DG + +W
Sbjct: 237 PIHLVKPGEKPRLASASKDGTIKIW 261

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 135/304 (44%), Gaps = 46/304 (15%)

Query: 53  DTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112
           + AH+  +   A   +   LA  S D TV I+       ND N+  + LL  + GHE  +
Sbjct: 5   ENAHEGVIHHAALNYYGTRLATCSSDKTVKIFE-----INDVNN-SSSLLETLVGHEGPV 58

Query: 113 KCVAWSHD--GE-LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--HQSL 167
               W H   GE LLATC  D  V IW+    G + + I     HS  V  V W  H+  
Sbjct: 59  WYADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYG 118

Query: 168 PLLASSSYDDTVRIWKDCDDDWECCAVL-NGHEGTV----W--------SSDFEKSNSNV 214
            +L   S D  + + +  D       +L N H+  V    W        S D +++ +  
Sbjct: 119 LILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTAVK 178

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP----KGYIASTG 270
           +  SG +D  V+IW  +DD    ++ ++    L + H  AV +V+WSP    + Y+AS  
Sbjct: 179 QFISGGNDNLVKIWKFDDD----QETYVVADTL-EGHKDAVTAVDWSPTTLLQSYVASVS 233

Query: 271 SDGRLVIYKE----SEDGWIVECIHELTHGVYETNM--VKWVEYGSKDVILLITAGDDGH 324
           +D + +++ +     ++ W    ++E   G +E  +  V W   G+    LL  + DD +
Sbjct: 234 NDKQCLVWTQDHSSKKNDWKKISVNE---GKFEQKLGSVSWSLSGN----LLAVSDDDKN 286

Query: 325 VNVW 328
           V +W
Sbjct: 287 VTIW 290

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 89/189 (47%), Gaps = 30/189 (15%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIE-ELDDTAHKKTVRSVAWRPHSNI------------ 71
           G I+  GS D KI +V+++  QI   ++ D AHK  V S++W P                
Sbjct: 118 GLILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTAV 177

Query: 72  --LAAGSFDSTVSIWGKDDDGYNDENDLETELLA-IIEGHENEIKCVAWSHDGEL---LA 125
               +G  D+ V IW  DDD        ET ++A  +EGH++ +  V WS    L   +A
Sbjct: 178 KQFISGGNDNLVKIWKFDDD-------QETYVVADTLEGHKDAVTAVDWSPTTLLQSYVA 230

Query: 126 TCSRDKSVWIWEADEMGEE--FECISVLQ-EHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           + S DK   +W  D   ++  ++ ISV + +  Q +  V W  S  LLA S  D  V IW
Sbjct: 231 SVSNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIW 290

Query: 183 KDC-DDDWE 190
           K+  D  WE
Sbjct: 291 KESGDGKWE 299

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 74/167 (44%), Gaps = 11/167 (6%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++ I   HE  I   A ++ G  LATCS DK+V I+E +++      +  L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 161 VIW-HQSLP--LLASSSYDDTVRIWKDCDDDWECCAVLNG--HEGTVWSSDFEKSNSNVR 215
             W H SL   LLA+  YD  V IWK+     +   +     H  +V    +      + 
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLI 120

Query: 216 LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
           L  GS DG + +  L+D       +     IL  AH   V S++W+P
Sbjct: 121 LLCGSADGKISVVELKDG------QIASTKILDNAHKFGVNSISWAP 161

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 119/271 (43%), Gaps = 51/271 (18%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K L  L+ HD   W++   +GGI+ +GSTDR +++ DI+            H  TVR + 
Sbjct: 413 KFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFK--GHNSTVRCLD 470

Query: 65  WRPHSNI--LAAGSFDSTVSIWGKDDDG----YNDENDLE---------TELLAIIEGHE 109
              + NI  +  GS D+T+ +W    +     + +E+D              + ++ GH 
Sbjct: 471 IVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHM 530

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL 169
             ++ V  S  G ++ + S D ++ +W+  +M    +C+ +L  H+  +   I+      
Sbjct: 531 ASVRTV--SGHGNIVVSGSYDNTLIVWDVAQM----KCLYILSGHTDRIYSTIYDHERKR 584

Query: 170 LASSSYDDTVRIWKDCDDDW---EC---------CA-------VLNGHEGTVWSSDFEKS 210
             S+S D T+RIW D ++ W   EC         CA        L GH   V        
Sbjct: 585 CISASMDTTIRIW-DLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRL--- 640

Query: 211 NSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
            S+  L S + DG++R W    D  +Y +++
Sbjct: 641 -SDKFLVSAAADGSIRGW----DANDYSRKF 666

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 82/183 (44%), Gaps = 32/183 (17%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
           ++++    F+    I G DD      + +  + L  + GH+  +  + ++H G +L + S
Sbjct: 382 TSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGG-ILVSGS 440

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVK--HVIWHQSLPLLASSSYDDTVRIWK--- 183
            D++V +W+     ++  C  V + H+  V+   ++ ++++  + + S D+T+ +WK   
Sbjct: 441 TDRTVRVWDI----KKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPK 496

Query: 184 ------------------DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
                               +++     VL GH  +V +      + N+ + SGS D T+
Sbjct: 497 ESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVS---GHGNI-VVSGSYDNTL 552

Query: 226 RIW 228
            +W
Sbjct: 553 IVW 555

>Scas_630.6
          Length = 621

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 115/255 (45%), Gaps = 49/255 (19%)

Query: 6   LLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQI-IEELDDTAHKKT---- 59
           LL SL  HD     V  + +G  +ATG  +R  ++ D+ + ++ ++ LDDT +       
Sbjct: 272 LLHSLP-HDSVVCCVKFSQDGKYLATGC-NRTTQIFDVATGELYVKLLDDTVNTAIVTTT 329

Query: 60  --------------VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAII 105
                         +RS+ + P    LA G+ D  + IW          N  E +++ ++
Sbjct: 330 TENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIW----------NIKERKIVMVL 379

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           +GHE +I  + +  DG+ L + S D+S+ IW+     +  +C   L          +   
Sbjct: 380 KGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDL----KTGQCSLTLSIEDGVTTVAVSPN 435

Query: 166 SLPLLASSSYDDTVRIW--------KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLC 217
              L+A+ S D +VRIW        +  D D E     NGH+ +V+S  F K   +V   
Sbjct: 436 EGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG---NGHQDSVYSVAFTKDGQHV--V 490

Query: 218 SGSDDGTVRIWCLED 232
           SGS D TV++W L D
Sbjct: 491 SGSLDRTVKLWNLGD 505

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 61/142 (42%), Gaps = 21/142 (14%)

Query: 13  HDDKCWSVDVNNGGI-MATGSTDRKIKL---VDIRSFQIIEELDDTAHKKTVRSVAWRPH 68
           H D  +SV     G  + +GS DR +KL    D +S     E+    HK  V SVA    
Sbjct: 473 HQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSND 532

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH----DGE-- 122
              + +GS D  V IW KD              + +++GH   +  VA  +    DG+  
Sbjct: 533 DKYIFSGSKDRGVIIWDKDSGNP----------ILMLQGHRKSVISVATVNSNVDDGKNY 582

Query: 123 -LLATCSRDKSVWIWEADEMGE 143
            L AT S D    IW+  +MGE
Sbjct: 583 KLFATGSGDCKARIWKYFKMGE 604

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 70.5 bits (171), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 101/204 (49%), Gaps = 27/204 (13%)

Query: 31  GSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDG 90
           GS D +I++ +  + + +  +D  AH   +RS+A  P    + +GS D TV +W      
Sbjct: 73  GSDDFRIRVFNYNTGEKV--VDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLW------ 124

Query: 91  YNDENDLETELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECIS 149
            N EN+   E     EGHE+ + CVA++  D    A+   D++V +W    +G+     +
Sbjct: 125 -NWENNWALE--QTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVW---SLGQSTPNFT 178

Query: 150 VLQEHSQDVKHVIWH--QSLPLLASSSYDDTVRIWKDCDDDWE---CCAVLNGHEGTVWS 204
           +     + V +V ++     P + ++S D T++IW     D++   C A L GH   V  
Sbjct: 179 LTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIW-----DYQTKSCVATLEGHMSNVSF 233

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIW 228
           + F  +   +   SGS+DGT++IW
Sbjct: 234 AVFHPTLPII--ISGSEDGTLKIW 255

>Kwal_23.6324
          Length = 514

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 87/183 (47%), Gaps = 28/183 (15%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEI 112
            H  T+   A+ PH S  +  GS D+T  IW           D  T   +  ++GH N +
Sbjct: 140 GHGSTILCSAFAPHTSGRMVTGSGDNTARIW-----------DCNTNTPMYTLKGHFNWV 188

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQ-------DVKHVIWHQ 165
            CVAW  DGEL+AT S D ++ +W++++ GE +     L+ H++       +  H++   
Sbjct: 189 LCVAWCPDGELIATGSMDNTIRLWDSNK-GESYG--EALRGHAKWITSLTWEPMHLVKAG 245

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
             P LAS+S D T++IW        C   L+GH  +V      K      L SGS D T+
Sbjct: 246 DQPRLASASKDGTIKIWDTTRR--VCVLTLSGHTNSV---SCVKWGGRGILYSGSHDKTI 300

Query: 226 RIW 228
           R W
Sbjct: 301 RAW 303

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 77/158 (48%), Gaps = 19/158 (12%)

Query: 27  IMATGSTDRKIKLVD-IRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWG 85
           +M T S D  + L D +++ + I  +  T H+K V  VA+ P    + + SFD+++ +W 
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW- 428

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF 145
              DG N         +A   GH   +  VAWS D  LL +CS+D ++ +W+        
Sbjct: 429 ---DGRNGT------FIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----RT 474

Query: 146 ECISV-LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           + +SV L  H+ +V  V W      + S+  D  VRIW
Sbjct: 475 KKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 128/315 (40%), Gaps = 50/315 (15%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI-------LAAGS 76
           +G ++ATGS D  I+L D    +   E     H K + S+ W P   +       LA+ S
Sbjct: 196 DGELIATGSMDNTIRLWDSNKGESYGEALR-GHAKWITSLTWEPMHLVKAGDQPRLASAS 254

Query: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
            D T+ IW          +      +  + GH N + CV W   G +L + S DK++  W
Sbjct: 255 KDGTIKIW----------DTTRRVCVLTLSGHTNSVSCVKWGGRG-ILYSGSHDKTIRAW 303

Query: 137 EADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN 196
           +   M    +CI++L+ H+  + H+  +    L    ++D T    K    +      L 
Sbjct: 304 D---MAAGGKCINILKSHAHWINHLSLNTDYALRV-GAFDHTGE--KPSSPEEARAKALK 357

Query: 197 GHEGTVWSSDFEKSNSNVR--LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRA 254
            +E         K N  +   + + SDD T+ +W    D  +  +   + +     H + 
Sbjct: 358 NYE------KIAKKNGQLEELMVTASDDFTMYLW----DPLKASKPITRMT----GHQKL 403

Query: 255 VYSVNWSPKG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDV 313
           V  V +SP G YI S   D  + ++ +  +G  +         VY+   V W    S D 
Sbjct: 404 VNHVAFSPDGRYIVSASFDNSIKLW-DGRNGTFIATFRGHVASVYQ---VAW----SSDC 455

Query: 314 ILLITAGDDGHVNVW 328
            LL++   D  + VW
Sbjct: 456 RLLVSCSKDTTLKVW 470

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 99  TELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
           ++ +  + GH+  +  VA+S DG  + + S D S+ +W+    G     I+  + H   V
Sbjct: 391 SKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD----GRNGTFIATFRGHVASV 446

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAV-LNGHEGTVWSSDFEKSNSNVRLC 217
             V W     LL S S D T+++W   D   +  +V L GH   V++ D+  S    R+C
Sbjct: 447 YQVAWSSDCRLLVSCSKDTTLKVW---DVRTKKLSVDLPGHNDEVYTVDW--SVDGKRVC 501

Query: 218 SGSDDGTVRIW 228
           S   D  VRIW
Sbjct: 502 SAGKDKMVRIW 512

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 84/209 (40%), Gaps = 32/209 (15%)

Query: 99  TELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
           T   + I GH + I C A++ H    + T S D +  IW+ +     +     L+ H   
Sbjct: 132 TRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMY----TLKGHFNW 187

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE-----KSNS 212
           V  V W     L+A+ S D+T+R+W D +        L GH   + S  +E     K+  
Sbjct: 188 VLCVAWCPDGELIATGSMDNTIRLW-DSNKGESYGEALRGHAKWITSLTWEPMHLVKAGD 246

Query: 213 NVRLCSGSDDGTVRIW------CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI 266
             RL S S DGT++IW      C+   +G               HT +V  V W  +G +
Sbjct: 247 QPRLASASKDGTIKIWDTTRRVCVLTLSG---------------HTNSVSCVKWGGRGIL 291

Query: 267 ASTGSDGRLVIYKESEDGWIVECIHELTH 295
            S   D  +  +  +  G  +  +    H
Sbjct: 292 YSGSHDKTIRAWDMAAGGKCINILKSHAH 320

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 75/162 (46%), Gaps = 25/162 (15%)

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
           EL+ T S D ++++W+  +  +    I+ +  H + V HV +      + S+S+D+++++
Sbjct: 371 ELMVTASDDFTMYLWDPLKASKP---ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKL 427

Query: 182 WKDCDDDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           W   +  +   A   GH  +V    WSSD         L S S D T+++W +       
Sbjct: 428 WDGRNGTF--IATFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWDVRTKKLSV 479

Query: 238 EQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIY 278
           +        LP  H   VY+V+WS  G  + S G D  + I+
Sbjct: 480 D--------LP-GHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 56/145 (38%), Gaps = 27/145 (18%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           + + GH  T+  S F    S  R+ +GS D T RIW    +   Y           K H 
Sbjct: 136 SAIAGHGSTILCSAFAPHTSG-RMVTGSGDNTARIWDCNTNTPMYTL---------KGHF 185

Query: 253 RAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKD 312
             V  V W P G + +TGS    +   +S  G   E   E   G       KW+   + +
Sbjct: 186 NWVLCVAWCPDGELIATGSMDNTIRLWDSNKG---ESYGEALRG-----HAKWITSLTWE 237

Query: 313 VILLITAGD---------DGHVNVW 328
            + L+ AGD         DG + +W
Sbjct: 238 PMHLVKAGDQPRLASASKDGTIKIW 262

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 70.5 bits (171), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 120/274 (43%), Gaps = 48/274 (17%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELL---------AIIEGHENEIKCVAWSH 119
           + + AAG  DST+ +W      Y D + L++ L          A + GH   +  VA+S 
Sbjct: 510 ARLTAAGFQDSTIKVW------YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSP 563

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PL---LASSSY 175
           D   L + S DK+V +W  D     F C+   + H+    H +W+    PL     ++S+
Sbjct: 564 DNRYLLSASEDKTVRLWSLD----TFTCLVCYKGHN----HPVWYVKFSPLGHYFITASH 615

Query: 176 DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNG 235
           D T R+W  CD  +    + +GH   V  S F  +   V   +GS D T R+W ++   G
Sbjct: 616 DQTARLW-SCDHIYP-LRIFSGHLNDVDCSTFHPNGCYV--FTGSSDKTCRMWDIQ--TG 669

Query: 236 EYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGS-DGRLVIYKESEDGWIVECIHELT 294
           +  + ++        HT  V ++  SP G   +TGS DG ++++       I +      
Sbjct: 670 DSVRLFL-------GHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGK 722

Query: 295 HGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           + +Y           +K+   L+T G D  V VW
Sbjct: 723 NPIYSITF-------NKEGNCLVTGGADQSVRVW 749

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 71/174 (40%), Gaps = 18/174 (10%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H   V SVA+ P +  L + S D TV +W  D              L   +GH + +  
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLD----------TFTCLVCYKGHNHPVWY 600

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           V +S  G    T S D++  +W  D +      + +   H  DV    +H +   + + S
Sbjct: 601 VKFSPLGHYFITASHDQTARLWSCDHI----YPLRIFSGHLNDVDCSTFHPNGCYVFTGS 656

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            D T R+W     D     +  GH   V +   E S     L +GS+DGT+ +W
Sbjct: 657 SDKTCRMWDIQTGD--SVRLFLGHTSPVTA--LEVSPDGRWLTTGSEDGTIIVW 706

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 51/128 (39%), Gaps = 17/128 (13%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECI-----------SVLQEHSQDVKH 160
           + CV +S D  L A   +D ++ +W  D  G   + I           + L  HS  V  
Sbjct: 501 MTCVEFSDDARLTAAGFQDSTIKVWYLD--GSPLQSILPSKAKDQSNSATLVGHSGPVYS 558

Query: 161 VIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGS 220
           V +      L S+S D TVR+W    D + C     GH   VW   F  S       + S
Sbjct: 559 VAFSPDNRYLLSASEDKTVRLW--SLDTFTCLVCYKGHNHPVWYVKF--SPLGHYFITAS 614

Query: 221 DDGTVRIW 228
            D T R+W
Sbjct: 615 HDQTARLW 622

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 15/123 (12%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           NG  + TGS+D+  ++ DI++   +       H   V ++   P    L  GS D T+ +
Sbjct: 648 NGCYVFTGSSDKTCRMWDIQTGDSVRLF--LGHTSPVTALEVSPDGRWLTTGSEDGTIIV 705

Query: 84  WGKDDDGYNDENDLET-ELLAIIEGH-ENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
           W           D+ T + +  ++GH +N I  + ++ +G  L T   D+SV +W+    
Sbjct: 706 W-----------DIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIKRF 754

Query: 142 GEE 144
             E
Sbjct: 755 TNE 757

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 69.7 bits (169), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 90/183 (49%), Gaps = 28/183 (15%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEI 112
            H  T+   A+ PH S+ +  G+ D+T  IW           D  T+  ++ ++GH N +
Sbjct: 141 GHGSTILCSAFAPHTSSRMITGAGDNTARIW-----------DCNTQTPMSTLKGHFNWV 189

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQ-------DVKHVIWHQ 165
            CV+WS DGEL+AT S D ++ +WE ++ G+       L+ H +       +  H++   
Sbjct: 190 LCVSWSPDGELIATGSMDNTIRLWEGNK-GQPVG--DALRGHGKWITSLSWEPIHLVKPG 246

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
             P LAS+S D T++IW        C   L+GH  +V  S  +     V L SGS D T+
Sbjct: 247 QKPRLASASKDGTIKIWDTTRR--VCLITLSGHTSSV--SCIKWGGQGV-LYSGSHDKTI 301

Query: 226 RIW 228
           R W
Sbjct: 302 RAW 304

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 77/160 (48%), Gaps = 21/160 (13%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           ++   S D T+ +W          N L+ T+ +  + GH+  +  VA+S DG  + + S 
Sbjct: 373 LMVTASDDFTMYLW----------NPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASF 422

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D S+ +W     G + + IS  + H   V  V W     LL S S D T+++W   D   
Sbjct: 423 DNSIKLWN----GRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKT 475

Query: 190 ECCAV-LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           +  AV L GH+  V++ D+  S    R+CSG  D  VR+W
Sbjct: 476 KKLAVDLPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRLW 513

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 17/157 (10%)

Query: 27  IMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWG 85
           +M T S D  + L   ++S + I  +  T H+K V  VA+ P    + + SFD+++ +W 
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRM--TGHQKLVNHVAFSPDGRHIVSASFDNSIKLW- 429

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF 145
                    N  + + ++   GH   +  VAWS D  LL +CS+D ++ +W+        
Sbjct: 430 ---------NGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAV 480

Query: 146 ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +    L  H  +V  V W      + S   D  VR+W
Sbjct: 481 D----LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 74/180 (41%), Gaps = 32/180 (17%)

Query: 105 IEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           I GH + I C A++ H    + T + D +  IW+ +        +S L+ H   V  V W
Sbjct: 139 IAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTP----MSTLKGHFNWVLCVSW 194

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE-----KSNSNVRLCS 218
                L+A+ S D+T+R+W + +        L GH   + S  +E     K     RL S
Sbjct: 195 SPDGELIATGSMDNTIRLW-EGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLAS 253

Query: 219 GSDDGTVRIW------CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
            S DGT++IW      CL               I    HT +V  + W  +G + S   D
Sbjct: 254 ASKDGTIKIWDTTRRVCL---------------ITLSGHTSSVSCIKWGGQGVLYSGSHD 298

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 73/159 (45%), Gaps = 24/159 (15%)

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
           EL+ T S D ++++W   +     + I+ +  H + V HV +      + S+S+D+++++
Sbjct: 372 ELMVTASDDFTMYLWNPLK---STKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKL 428

Query: 182 WKDCDDDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           W   D  +   +   GH  +V    WSSD         L S S D T+++W ++      
Sbjct: 429 WNGRDGKF--ISTFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWDVKTKKLAV 480

Query: 238 EQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
           +        LP  H   VY+V+WS  G    +G   ++V
Sbjct: 481 D--------LP-GHKDEVYTVDWSVDGKRVCSGGKDKMV 510

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 19/141 (13%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           + + GH  T+  S F    S+ R+ +G+ D T RIW   D N +     +      K H 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSS-RMITGAGDNTARIW---DCNTQTPMSTL------KGHF 186

Query: 253 RAVYSVNWSPKGYIASTGS-DGRLVIYKESEDGWIVECIHELTHGVYETNM----VKWVE 307
             V  V+WSP G + +TGS D  + +++ ++   + + +    HG + T++    +  V+
Sbjct: 187 NWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALR--GHGKWITSLSWEPIHLVK 244

Query: 308 YGSKDVILLITAGDDGHVNVW 328
            G K    L +A  DG + +W
Sbjct: 245 PGQKP--RLASASKDGTIKIW 263

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 27/207 (13%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +  GS D K+++ +  + + +   D  AH   +RS+A  P    +  GS D TV +W   
Sbjct: 70  IVVGSDDNKVRVFNYNTGEKVA--DFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLW--- 124

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFE 146
               N END   E     +GHE+ + CVA++  D  + A+   D  V +W    +G+   
Sbjct: 125 ----NWENDWSLE--QTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVW---SLGQSTP 175

Query: 147 CISVLQEHSQDVKHVIWH--QSLPLLASSSYDDTVRIWKDCDDDWE---CCAVLNGHEGT 201
             ++     + V +V ++     P + +SS D TV+I+     D++   C A L GH   
Sbjct: 176 NFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF-----DYQTKSCVATLEGHMSN 230

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           V  + F  +   +   SGS+DGTV++W
Sbjct: 231 VSFAVFHPTLPII--ISGSEDGTVKLW 255

>Kwal_47.17465
          Length = 800

 Score = 69.7 bits (169), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 9/135 (6%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDG----YNDENDLET-ELLAIIEGH 108
           + H  +V  V + P  N LA+GS D  + IW KD+D     +  END E   +   +  H
Sbjct: 19  SRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAH 78

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
           +N+I+ + W+ D  +L T   D+SV +W     G  FE I     H   VK VI+  +  
Sbjct: 79  DNDIQDICWAPDSSILVTVGLDRSVIVWN----GSTFEKIKRFDVHQSLVKGVIFDPANK 134

Query: 169 LLASSSYDDTVRIWK 183
             A++S D TVRI++
Sbjct: 135 YFATASDDRTVRIFR 149

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 75/184 (40%), Gaps = 18/184 (9%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADE------MGEEFE-----CISV 150
           LA +  H   +  V +S DG  LA+ S D+ + IWE DE       G E +         
Sbjct: 15  LASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRR 74

Query: 151 LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKS 210
           L  H  D++ + W     +L +   D +V +W      +E     + H+  V    F+ +
Sbjct: 75  LVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGS--TFEKIKRFDVHQSLVKGVIFDPA 132

Query: 211 NSNVRLCSGSDDGTVRIWCLED--DNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIA 267
           N      + SDD TVRI+      D     +  + E       T     ++WSP G +IA
Sbjct: 133 NK--YFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWSPDGQHIA 190

Query: 268 STGS 271
           +  +
Sbjct: 191 APNA 194

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 10/89 (11%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH   ++ + W P S+IL     D +V +W          N    E +   + H++ +K 
Sbjct: 77  AHDNDIQDICWAPDSSILVTVGLDRSVIVW----------NGSTFEKIKRFDVHQSLVKG 126

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGE 143
           V +    +  AT S D++V I+   + G+
Sbjct: 127 VIFDPANKYFATASDDRTVRIFRYHKAGD 155

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 53/136 (38%), Gaps = 36/136 (26%)

Query: 8   KSLALHD----DKCWSVD--------VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTA 55
           + L  HD    D CW+ D        ++   I+  GST  KIK  D+             
Sbjct: 73  RRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDV------------- 119

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGH------E 109
           H+  V+ V + P +   A  S D TV I+      Y+   D+   +  ++          
Sbjct: 120 HQSLVKGVIFDPANKYFATASDDRTVRIF-----RYHKAGDMSFSIEHVVSEPFKGSPIT 174

Query: 110 NEIKCVAWSHDGELLA 125
              + ++WS DG+ +A
Sbjct: 175 TYFRRLSWSPDGQHIA 190

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 96/188 (51%), Gaps = 26/188 (13%)

Query: 18  WSVDVN-NGGIMATGSTDRKIKL---VDIRSF------------QIIEELDDTA-HKKTV 60
           ++VDV+ +G  +ATG  D KI++    DI  F            Q+ + L + + H  +V
Sbjct: 21  YTVDVSSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSV 80

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDG----YNDENDLET-ELLAIIEGHENEIKCV 115
            ++ + P +  LA+GS D  + IW K++      ++ ENDLE   +   +  H+N+I+ +
Sbjct: 81  TALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDI 140

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSY 175
            W+ D  +L T   D+S+ +W     G  FE I     H   VK V++  +    A++S 
Sbjct: 141 CWAPDSSILVTVGLDRSIIVWN----GSTFEKIKRFDVHQSHVKGVVFDPANKYFATASD 196

Query: 176 DDTVRIWK 183
           D TV++++
Sbjct: 197 DRTVKVFR 204

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 65/137 (47%), Gaps = 19/137 (13%)

Query: 210 SNSNVRLCSGSDDGTVRIWCLEDD--NGEYEQEW-IQESILPKA------HTRAVYSVNW 260
           S+   R+ +G  DG +RIW + D     + +  W  +E  L K       HT +V ++ +
Sbjct: 26  SSDGQRVATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSVTALKF 85

Query: 261 SPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDV------- 313
           SP     ++GSD ++++  E E+G  V+ + ++ + +   N+ + +     D+       
Sbjct: 86  SPDNKYLASGSDDKILLIWEKEEG-AVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAP 144

Query: 314 --ILLITAGDDGHVNVW 328
              +L+T G D  + VW
Sbjct: 145 DSSILVTVGLDRSIIVW 161

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 84/185 (45%), Gaps = 20/185 (10%)

Query: 46  QIIE--ELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLA 103
           QII+  E    AH+K + +++  P+ +I A  S+D T  IW       N EN    EL A
Sbjct: 478 QIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIW-------NLENG---ELEA 527

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
            +  H+  +  V++    +LLAT S DK+V IW  D     F  +  L+ H+  V+   +
Sbjct: 528 TLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLD----TFSVMKTLEGHTNAVQRCSF 583

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
                 L S   D  ++IW DC    EC   L+GH   +W+      N    + S   DG
Sbjct: 584 INKQKQLISCGADGLIKIW-DCSSG-ECLKTLDGHNNRLWA--LSTMNDGDMIVSADADG 639

Query: 224 TVRIW 228
             + W
Sbjct: 640 VFQFW 644

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 112/276 (40%), Gaps = 35/276 (12%)

Query: 67  PHSNILAAGSFDSTVSIWGKDD-DGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLA 125
           P  N LA  +   ++ I    D  G      L+ E   I EGHE+ +  +  + DG  +A
Sbjct: 348 PELNKLALATNSPSLRIIPVPDLSGPEASLPLDVE---IYEGHEDLLNSLDATEDGLWIA 404

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV----IWHQSLP-LLASSSYDDTVR 180
           T S+D +  +W  +E   +F+  +    HS  V  V    I  +  P  L ++S D T++
Sbjct: 405 TASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIK 464

Query: 181 IW----KDCDDDWECCAV----LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232
            W         D +   V     + HE  + +     ++S     + S D T +IW LE 
Sbjct: 465 KWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDS--IFATASYDKTCKIWNLE- 521

Query: 233 DNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHE 292
            NGE E            H R ++ V++     + +T S  + V        W ++    
Sbjct: 522 -NGELEATLAN-------HKRGLWDVSFCQYDKLLATSSGDKTVKI------WSLDTFSV 567

Query: 293 LTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           +      TN V+   + +K    LI+ G DG + +W
Sbjct: 568 MKTLEGHTNAVQRCSFINKQK-QLISCGADGLIKIW 602

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 91/182 (50%), Gaps = 26/182 (14%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            H  T+   A+ P+ S+ +  G+ D+T  IW         + D +T +   ++GH N + 
Sbjct: 141 GHGSTILCSAFAPNTSSRMVTGAGDNTACIW---------DCDTQTRM-CTLQGHHNWVL 190

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQ-------DVKHVIWHQS 166
           C +WS DGEL+AT S D ++ +WE+ + G+ +     L+ HS+       +  H++    
Sbjct: 191 CCSWSPDGELIATGSMDNTIRLWESSK-GKPYG--DALRGHSKWITSLSWEPIHLVKPGD 247

Query: 167 LPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
            P LA++S D T++IW        C   L GH  +V  S  +    NV L SGS D T+R
Sbjct: 248 KPRLATASKDGTIKIWDTTRR--VCLLTLCGHTSSV--SCVKWGGKNV-LYSGSHDKTIR 302

Query: 227 IW 228
            W
Sbjct: 303 CW 304

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 72/158 (45%), Gaps = 19/158 (12%)

Query: 27  IMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW- 84
           +M T S D  + L   ++S + I  +  T H+K V  VA+ P    + + SFD+++ +W 
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRM--TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 85  GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE 144
           G+D            + L+   GH   +  VAWS D  LL +CS+D ++ +W+       
Sbjct: 431 GRDG-----------KFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLS 479

Query: 145 FECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
            +    L  H  +V  V W      + S   D  VRIW
Sbjct: 480 VD----LPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 21/160 (13%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           ++   S D T+ +W          N L+ T+ +  + GH+  +  VA+S DG  + + S 
Sbjct: 373 LMVTASDDFTMYLW----------NPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASF 422

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D S+ +W+    G + + +S  + H   V  V W     LL S S D T+++W   D   
Sbjct: 423 DNSIKLWD----GRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW---DVKT 475

Query: 190 ECCAV-LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              +V L GH+  V++ D+  S    R+CSG  D  VRIW
Sbjct: 476 RKLSVDLPGHQDEVYTVDW--SVDGKRVCSGGKDKMVRIW 513

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 115/292 (39%), Gaps = 75/292 (25%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +AT S D  IK+ D      +  L    H  +V  V W    N+L +GS D T+  W   
Sbjct: 251 LATASKDGTIKIWDTTRRVCLLTL--CGHTSSVSCVKWG-GKNVLYSGSHDKTIRCW--- 304

Query: 88  DDGYNDENDLETELLAIIEGHEN-----------EIKCVAWSHDGE-------------- 122
                 + +L  + + I++ H +            ++  A+ H GE              
Sbjct: 305 ------DMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALK 358

Query: 123 --------------LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
                         L+ T S D ++++W   +  +    I+ +  H + V HV +     
Sbjct: 359 NYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKP---ITRMTGHQKLVNHVAFSPDGR 415

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGT 224
            + S+S+D+++++W   D  +   +   GH  +V    WSSD         L S S D T
Sbjct: 416 YIVSASFDNSIKLWDGRDGKF--LSTFRGHVASVYQVAWSSDCR------LLVSCSKDTT 467

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
           +++W ++      +        LP  H   VY+V+WS  G    +G   ++V
Sbjct: 468 LKVWDVKTRKLSVD--------LP-GHQDEVYTVDWSVDGKRVCSGGKDKMV 510

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 80/205 (39%), Gaps = 32/205 (15%)

Query: 103 AIIEGHENEIKCVAWSHD-GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           + I GH + I C A++ +    + T + D +  IW+ D        +  LQ H   V   
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTR----MCTLQGHHNWVLCC 192

Query: 162 IWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE-----KSNSNVRL 216
            W     L+A+ S D+T+R+W+         A L GH   + S  +E     K     RL
Sbjct: 193 SWSPDGELIATGSMDNTIRLWESSKGKPYGDA-LRGHSKWITSLSWEPIHLVKPGDKPRL 251

Query: 217 CSGSDDGTVRIW------CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTG 270
            + S DGT++IW      CL    G               HT +V  V W  K  + S  
Sbjct: 252 ATASKDGTIKIWDTTRRVCLLTLCG---------------HTSSVSCVKWGGKNVLYSGS 296

Query: 271 SDGRLVIYKESEDGWIVECIHELTH 295
            D  +  +  + +G  +  +    H
Sbjct: 297 HDKTIRCWDMNLNGKCINILKSHAH 321

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 58/145 (40%), Gaps = 27/145 (18%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           + + GH  T+  S F   N++ R+ +G+ D T  IW   D + +     +Q       H 
Sbjct: 137 SAIAGHGSTILCSAFA-PNTSSRMVTGAGDNTACIW---DCDTQTRMCTLQ------GHH 186

Query: 253 RAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKD 312
             V   +WSP G + +TGS    +   ES  G          +G       KW+   S +
Sbjct: 187 NWVLCCSWSPDGELIATGSMDNTIRLWESSKG--------KPYGDALRGHSKWITSLSWE 238

Query: 313 VILLITAGD---------DGHVNVW 328
            I L+  GD         DG + +W
Sbjct: 239 PIHLVKPGDKPRLATASKDGTIKIW 263

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 119/270 (44%), Gaps = 40/270 (14%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETEL-----LAIIEGHENEIKCVAWSHDGEL 123
           S ++AAG  DS + +W  D  G   E+ L ++         + GH   +  V++S D   
Sbjct: 499 SRLVAAGFQDSYIKLWSLD--GTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRY 556

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PL---LASSSYDDTV 179
           L + S DK+V +W  D     + C+   + H+    H +W     PL    A+ S+D T 
Sbjct: 557 LVSASEDKTVRLWSLD----TYTCLVSYKGHN----HPVWDVKFSPLGHYFATGSHDQTA 608

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
           R+W  CD  +    +  GH   V    F  + + V   +GS D T R+W ++   G+  +
Sbjct: 609 RLW-SCDHIYP-LRIFAGHLNDVDCVTFHPNGTYV--LTGSSDKTCRMWDIQ--TGDSVR 662

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGS-DGRLVIYKESEDGWIVECIHELTHGVY 298
            ++        HT +V SV  SP G   +TGS DG ++++       I +        VY
Sbjct: 663 LFL-------GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVY 715

Query: 299 ETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
             +        +K+  +L++ G D  V VW
Sbjct: 716 SLSF-------NKEGNILVSGGADQSVRVW 738

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 95/237 (40%), Gaps = 20/237 (8%)

Query: 9   SLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP 67
           +L  H    +SV  + +   + + S D+ ++L  + ++  +  +    H   V  V + P
Sbjct: 537 TLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCL--VSYKGHNHPVWDVKFSP 594

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATC 127
             +  A GS D T  +W  D              L I  GH N++ CV +  +G  + T 
Sbjct: 595 LGHYFATGSHDQTARLWSCD----------HIYPLRIFAGHLNDVDCVTFHPNGTYVLTG 644

Query: 128 SRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD 187
           S DK+  +W+     +  + + +   H+  V  V        L + S D  + +W D   
Sbjct: 645 SSDKTCRMWDI----QTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVW-DIGT 699

Query: 188 DWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244
                 +    +  V+S  F K   N+ L SG  D +VR+W L+    E   E  Q 
Sbjct: 700 GKRIKQMRGHGKSAVYSLSFNK-EGNI-LVSGGADQSVRVWDLKKFTNEPSLEPEQP 754

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 67.0 bits (162), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 111/261 (42%), Gaps = 54/261 (20%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH  +V ++ +    + + +G  D T+ IW  + +   + + + TE           I+ 
Sbjct: 122 AHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDRIHTE----------GIRD 171

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           VA+S++     TCS D  + IW      +E     VL  H  DV+   WH  L L+ S S
Sbjct: 172 VAFSNNDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVRSCDWHPELGLIVSGS 227

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW------ 228
            D+ V++W       +C + L   + TV  + F+ +  N+ L + S D + R++      
Sbjct: 228 KDNLVKLWD--PRSGQCVSTLLKFKHTVLKTRFQPTKGNL-LAAISKDKSCRVFDLRASM 284

Query: 229 ----CLEDDNGEYEQEW--IQES-------------------------ILPKAHTRAVYS 257
               C+ D+    E EW  I ES                         I+P AH + + +
Sbjct: 285 NELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEKCISA 344

Query: 258 VNWSPKGYIASTGSDGRLVIY 278
           + ++P G+I +T +  R + +
Sbjct: 345 IAYNPVGHILATAAKDRTIRF 365

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 84/195 (43%), Gaps = 25/195 (12%)

Query: 112 IKCVAWSHDGE--LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL 169
           I  + WS +G   ++AT S + S+W       G  F   +++Q H   V  + +  +   
Sbjct: 85  IPAIQWSPEGRRLIVATFSGEFSLW------NGSSFTFETIMQAHDTSVTTMKYSHAGDW 138

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNG--HEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
           + S   D T++IW+    ++     L+    EG     D   SN++ +  + SDD  ++I
Sbjct: 139 MISGDADGTIKIWQP---NFNMVKELDRIHTEGI---RDVAFSNNDSKFVTCSDDNILKI 192

Query: 228 WCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIV 287
           W     NG+      QE +L   H   V S +W P+  +  +GS   LV   +   G  V
Sbjct: 193 WNFS--NGQ------QERVL-SGHHWDVRSCDWHPELGLIVSGSKDNLVKLWDPRSGQCV 243

Query: 288 ECIHELTHGVYETNM 302
             + +  H V +T  
Sbjct: 244 STLLKFKHTVLKTRF 258

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 62/148 (41%), Gaps = 39/148 (26%)

Query: 26  GIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-HSNILAAGSFDSTVSIW 84
           G++ +GS D  +KL D RS Q +  L    H  TV    ++P   N+LAA S D +  ++
Sbjct: 221 GLIVSGSKDNLVKLWDPRSGQCVSTLLKFKH--TVLKTRFQPTKGNLLAAISKDKSCRVF 278

Query: 85  G-----------KDD---------------------DG----YNDENDLETELLAIIEGH 108
                       +D+                     DG    ++   D E  +  I   H
Sbjct: 279 DLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAH 338

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIW 136
           E  I  +A++  G +LAT ++D+++  W
Sbjct: 339 EKCISAIAYNPVGHILATAAKDRTIRFW 366

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 13/101 (12%)

Query: 24  NGGIMATGSTDRKIKLVDI-----RSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFD 78
           N  +   G  D  +K  D+     +   II      AH+K + ++A+ P  +ILA  + D
Sbjct: 305 NESMFTVGCYDGSLKHFDLGQDTEKPIHIIP----FAHEKCISAIAYNPVGHILATAAKD 360

Query: 79  STVSIWGK----DDDGYNDENDLETELLAIIEGHENEIKCV 115
            T+  W +    D + ++D      ++     G  N+I  V
Sbjct: 361 RTIRFWTRARPVDPNAFDDPTYNNKKMTGWFFGINNDINAV 401

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 51/126 (40%), Gaps = 11/126 (8%)

Query: 23  NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVS 82
           NN     T S D  +K+ +  + Q  +E   + H   VRS  W P   ++ +GS D+ V 
Sbjct: 176 NNDSKFVTCSDDNILKIWNFSNGQ--QERVLSGHHWDVRSCDWHPELGLIVSGSKDNLVK 233

Query: 83  IWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMG 142
           +W                +  +++     +K       G LLA  S+DKS  +++     
Sbjct: 234 LWDPRSGQC---------VSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASM 284

Query: 143 EEFECI 148
            E  C+
Sbjct: 285 NELMCV 290

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 103/233 (44%), Gaps = 26/233 (11%)

Query: 55  AHKKTVRSVAWRP-HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            H   V S++  P   N+L +GS D T+  W         E+      +   +GH + ++
Sbjct: 31  GHNGWVTSLSTSPAQPNMLLSGSRDKTLITWK-----LTGEDQQYGVPVRSFKGHSHIVQ 85

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS 173
               +HDG+   + S DK++ +W+     +  +CI     H  DV  V        + S+
Sbjct: 86  DCTVTHDGKYALSASWDKTLRLWDL----QSGKCIKRFVGHKSDVMSVSIDPRATQIVSA 141

Query: 174 SYDDTVRIWKDCDDDWECCAVLNGHE---GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           S D TV++W    D   C   L GH      V  +  EKS+  V + S   D  V++W L
Sbjct: 142 SRDKTVKVWNTVGD---CVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDL 198

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI-ASTGSDGRLVIYKESE 282
           +  +   E ++I        H   V +V  SP G I AS G DG+++++  +E
Sbjct: 199 Q--SFTIEADFI-------GHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNE 242

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 63/154 (40%), Gaps = 38/154 (24%)

Query: 23  NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVS 82
           ++G    + S D+ ++L D++S + I+      HK  V SV+  P +  + + S D TV 
Sbjct: 91  HDGKYALSASWDKTLRLWDLQSGKCIKRF--VGHKSDVMSVSIDPRATQIVSASRDKTVK 148

Query: 83  IWGKDDD------GYND------------ENDLETELLAIIE------------------ 106
           +W    D      G+ND             +D  T + A ++                  
Sbjct: 149 VWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
           GH N +  V  S DG + A+  +D  + +W  +E
Sbjct: 209 GHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNE 242

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 6/114 (5%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G I A+   D +I L ++     +  LD    K  V +VA+ P+   L A +  S + I
Sbjct: 222 DGSIFASAGKDGQIILWNLNEKTALYTLD---AKDEVFAVAFSPNRYWLTAAT-ASGIKI 277

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
           +  ++    D  DL+ E     +  +     +AWS DG+ L     D  + +W+
Sbjct: 278 FDLEERTIVD--DLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQ 329

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 68/165 (41%), Gaps = 21/165 (12%)

Query: 169 LLASSSYDDTVRIWKDCDDDWE---CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
           +L S S D T+  WK   +D +         GH   V   D   ++      S S D T+
Sbjct: 48  MLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIV--QDCTVTHDGKYALSASWDKTL 105

Query: 226 RIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDG 284
           R+W L+  +G+  + ++        H   V SV+  P+   I S   D  + ++    D 
Sbjct: 106 RLWDLQ--SGKCIKRFV-------GHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGD- 155

Query: 285 WIVECIHELT-HGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               C+  L  H  + +N+       S D + +I+AG D  V VW
Sbjct: 156 ----CVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVW 196

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 96/220 (43%), Gaps = 19/220 (8%)

Query: 4   LKLLKSLALHDDKCWSVD-VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           L++ ++L  HD K   +   +N  ++ TG  D  I + +    + I       H+  +  
Sbjct: 244 LEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRITD 303

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETE-LLAIIEGHENEIKCVAWSHDG 121
           +   P    +   SFDST  +W           D+E +  L + EGH  E+ C+A+  DG
Sbjct: 304 LQVHPSGKFIGTSSFDSTWRLW-----------DIEKQKQLLLQEGHSKELYCLAFQADG 352

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
            L++T   DK+  IW+        + +S LQ H++ +  + W      LA+   D  + I
Sbjct: 353 ALVSTAGTDKTAIIWDL----RSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITI 408

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
           W     D      +  H+  V S  F+K+N +  + SG D
Sbjct: 409 WDLRKSD--KLTKITEHKSIVTSLKFDKANDHNLISSGYD 446

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 119/272 (43%), Gaps = 33/272 (12%)

Query: 58  KTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAW 117
           + + +V +  + N +A+GS++  VSI         D N LE  +   ++ H+ ++  +AW
Sbjct: 213 RPISTVTFCNNGNYVASGSWNGEVSII--------DSNTLE--VTQTLQNHDGKVGGIAW 262

Query: 118 SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDD 177
           + +  +L T   D  + +  ++    EF   + +  H   +  +  H S   + +SS+D 
Sbjct: 263 TSNDSVLITGGEDHLITV--SNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDS 320

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           T R+W D +   +   +  GH   ++   F+   + V   +   D T  IW L       
Sbjct: 321 TWRLW-DIEKQKQLL-LQEGHSKELYCLAFQADGALV--STAGTDKTAIIWDLRSGKAVS 376

Query: 238 EQEWIQESILPKAHTRAVYSVNWSPKGY-IASTGSDGRLVIYKESEDGWIVECIHELTHG 296
           + +          H + +Y ++WS  G+ +A+ G DG + I       W +    +LT  
Sbjct: 377 QLQ---------GHAKTIYCMDWSIDGHTLATGGGDGVITI-------WDLRKSDKLTKI 420

Query: 297 VYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               ++V  +++   +   LI++G D  + V+
Sbjct: 421 TEHKSIVTSLKFDKANDHNLISSGYDRSIFVY 452

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 66.2 bits (160), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 106/245 (43%), Gaps = 41/245 (16%)

Query: 12  LHDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKT----------- 59
           LHD     V   NNG  +ATG  ++  K+ ++ +  ++ EL D     T           
Sbjct: 316 LHDSVVCCVKFSNNGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADL 374

Query: 60  -VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS 118
            +RSV + P    LA G+ D  + IW          +  + +++ ++ GHE +I  + + 
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIW----------DIAQRKIVMVLRGHEQDIYSLDYF 424

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
             G  L + S D+++ IW+        +C   L          +   +   +A+ S D T
Sbjct: 425 QSGNKLVSGSGDRTIRIWDL----HTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRT 480

Query: 179 VRIW--------KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           VR+W        +  D + E      GH+ +V+S  F +   N+   SGS D +V++W L
Sbjct: 481 VRVWDSNSGFLVERLDSEGETGV---GHKDSVYSVVFTRDGKNI--VSGSLDRSVKLWNL 535

Query: 231 EDDNG 235
            + NG
Sbjct: 536 RNING 540

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I+ V +S DG+ LAT + DK + IW+  +     + + VL+ H QD+  + + QS   L 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQR----KIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
           S S D T+RIW   D     C++    E  V +      N N  + +GS D TVR+W   
Sbjct: 432 SGSGDRTIRIW---DLHTGQCSLTLSIEDGVTTVAVSPGNGNY-VAAGSLDRTVRVW--- 484

Query: 232 DDNGEYEQEWI-QESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
           D N  +  E +  E      H  +VYSV ++  G    +GS  R V
Sbjct: 485 DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSV 530

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 82/176 (46%), Gaps = 19/176 (10%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIK 113
            H K V ++A++    +LA+   D+  +IW           DL + E +  +EGH   I 
Sbjct: 296 GHSKAVYTIAFQSDGALLASAGLDAVCAIW-----------DLRSGEPIMKLEGHAGAIS 344

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS 173
            V WS +G  LAT   D +V +W+   +G E   ++  Q  + DVK      +   L S 
Sbjct: 345 GVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVAALDVK--FKKNNGTFLVSC 401

Query: 174 SYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
            +D  V I+    D+W+  A L GH   V++ D  +  S +   SG  D +++ WC
Sbjct: 402 GHDRLVNIFN--ADNWQKLASLEGHTDRVFTVDITEDGSTI--YSGGKDRSLKQWC 453

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 99/229 (43%), Gaps = 21/229 (9%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKT 59
           +A  +L+ S  + D     V V+ +G  +ATG     IK+V   +  I + +D  AH+  
Sbjct: 159 LATFELVGSQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSID-AAHEGK 217

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           +  + W P  N L +G  D+ V +W           D+ +     + GH   +  V    
Sbjct: 218 IGGLDWHPDGNHLLSGGGDNLVKLW-----------DMTSNSFEELRGHAGRVSRVKVHP 266

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTV 179
            G L A+ S D +  +W+ +   E    + + + HS+ V  + +     LLAS+  D   
Sbjct: 267 SGRLAASASFDLTWILWDLERKVE----LQLQEGHSKAVYTIAFQSDGALLASAGLDAVC 322

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            IW       E    L GH G +   D+  S +  +L +   DGTVR+W
Sbjct: 323 AIWD--LRSGEPIMKLEGHAGAISGVDW--SPNGYQLATAGADGTVRVW 367

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 89/221 (40%), Gaps = 26/221 (11%)

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
           +  +  VA   DG+ LAT     S+ +   + +G      S+   H   +  + WH    
Sbjct: 172 DKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGI---AKSIDAAHEGKIGGLDWHPDGN 228

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            L S   D+ V++W    + +E    L GH G V  S  +   S     S S D T  +W
Sbjct: 229 HLLSGGGDNLVKLWDMTSNSFE---ELRGHAGRV--SRVKVHPSGRLAASASFDLTWILW 283

Query: 229 CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDGWIV 287
            LE            E  L + H++AVY++ +   G  +AS G D    I+    D    
Sbjct: 284 DLERK---------VELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIW----DLRSG 330

Query: 288 ECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           E I +L       + V W   G +    L TAG DG V VW
Sbjct: 331 EPIMKLEGHAGAISGVDWSPNGYQ----LATAGADGTVRVW 367

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 114/252 (45%), Gaps = 33/252 (13%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           +   + GH + +  +++   G  +ATCS D+ + +++ D+   E+E     + H   +  
Sbjct: 1   MKPFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVS 60

Query: 161 VIWHQSLP----LLASSSYDDTVRIWKDCDD-------DWECCAVLNGHEGTVWSSDFEK 209
           + W  + P    ++AS SYD T+++W++  D        W+    LN   G ++S  F  
Sbjct: 61  LDW--AAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAP 118

Query: 210 SNSNVRLCSGSDDGTVRIW-CLEDDNGE---YEQEWIQESILPKAHTRAVYSVNWSPKGY 265
           S+  +RL +  +DG +R++  LE  +        E    +  P +H ++ + ++W P  +
Sbjct: 119 SHLGLRLAALGNDGKLRLYDALESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPSRF 178

Query: 266 IASTGSDGRLV--------IYKESEDGWIVECIHELTH-GVYETNMVKWVEYGSKDVILL 316
                S  RLV        IY+ ++ G +V   H   H G+  +  + W     +   L+
Sbjct: 179 -----STERLVISAMDQATIYQRNKQGKLVPAGHLKGHTGLIRS--IAWAPSVGRWYQLI 231

Query: 317 ITAGDDGHVNVW 328
            T   DG + ++
Sbjct: 232 ATGCKDGKLRIF 243

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 96  DLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQ 152
           +L  EL++    H+ E+  V+W+  G +L++   D  + +W+A     EF C+SV+Q
Sbjct: 286 NLHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKA-SYSNEFRCMSVVQ 341

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 100/273 (36%), Gaps = 61/273 (22%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDT--AHKKTVRSVAWRP--HSNILAAGSFDST 80
           G  +AT S+D+ IK+  +       EL ++  AH  ++ S+ W       I+A+ S+D T
Sbjct: 21  GRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVSLDWAAPEFGRIIASVSYDKT 80

Query: 81  VSIWGKDDDGYNDENDLETELLAI--IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEA 138
           + +W +D D          +L  +    G    +K  A SH G  LA    D  + +++A
Sbjct: 81  IKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVK-FAPSHLGLRLAALGNDGKLRLYDA 139

Query: 139 DEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGH 198
            E  +                                   +R W    +      VLN  
Sbjct: 140 LESSD-----------------------------------LRSWTLTSE----ITVLNTP 160

Query: 199 EGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILP----KAHTRA 254
             +   SDF  S    R        T R+     D     Q   Q  ++P    K HT  
Sbjct: 161 PASHLQSDFCLSWCPSRF------STERLVISAMDQATIYQRNKQGKLVPAGHLKGHTGL 214

Query: 255 VYSVNWSPK-----GYIASTGSDGRLVIYKESE 282
           + S+ W+P        IA+   DG+L I+K +E
Sbjct: 215 IRSIAWAPSVGRWYQLIATGCKDGKLRIFKVTE 247

>Scas_707.22
          Length = 730

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 117/267 (43%), Gaps = 48/267 (17%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K LK L+ H+   W++  +  GI+ +GSTDR +++ DI+            H  TVR + 
Sbjct: 387 KFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFK--GHTSTVRCLE 444

Query: 65  WRPHSNI--LAAGSFDSTVSIW---------GKDDDGYNDENDLETELLAIIEGHENEIK 113
              + N+  +  GS D+T+ +W         G+    YN   +     + ++ GH   ++
Sbjct: 445 IVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEE-NPYFVGVLRGHMASVR 503

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS 173
            +  S  G ++ + S D ++ +W+  +M    +C+ VL  H+  +   I+        S+
Sbjct: 504 TI--SGHGNIVISGSYDNNLMVWDIAQM----KCLYVLIGHTDRIYSTIYDHKRQRCISA 557

Query: 174 SYDDTVRIWKDCDDDW-------------ECCAV------LNGHEGTVWSSDFEKSNSNV 214
           S D T+++W D D+ W              C  +      L GH   V         S+ 
Sbjct: 558 SMDSTIKVW-DLDNIWNNGNCTIITNSATPCTKITGSMLTLQGHTALVGLLRL----SDK 612

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEW 241
            L S + DG++R W    D+ +Y +++
Sbjct: 613 YLVSAAADGSLRGW----DSNDYSRKF 635

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 142/329 (43%), Gaps = 63/329 (19%)

Query: 30  TGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDD 89
           TG+ DR++++ D RS + ++EL  + H+  V ++ +     I+ +GS D +V IW     
Sbjct: 371 TGADDRQLRIYDARSKKFLKEL--SGHEGGVWALKYD-ADGIIVSGSTDRSVRIW----- 422

Query: 90  GYNDENDLETELLA-IIEGHENEIKC--VAWSHDGELLATCSRDKSVWIWEA-------- 138
                 D++      + +GH + ++C  +    + + + T SRD ++ +W+         
Sbjct: 423 ------DIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDG 476

Query: 139 ------DEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECC 192
                 +   E    + VL+ H   V+ +  H +  ++ S SYD+ + +W       +C 
Sbjct: 477 ELPMVYNTPEENPYFVGVLRGHMASVRTISGHGN--IVISGSYDNNLMVWDIA--QMKCL 532

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED--DNGEYEQEWIQESILP-- 248
            VL GH   ++S+ ++      R  S S D T+++W L++  +NG      I  S  P  
Sbjct: 533 YVLIGHTDRIYSTIYDHKRQ--RCISASMDSTIKVWDLDNIWNNGNC--TIITNSATPCT 588

Query: 249 ---------KAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYE 299
                    + HT  V  +  S K Y+ S  +DG L        GW     +      + 
Sbjct: 589 KITGSMLTLQGHTALVGLLRLSDK-YLVSAAADGSL-------RGWDSND-YSRKFSYHH 639

Query: 300 TNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            N+     +   D IL+  +G +G  NV+
Sbjct: 640 NNLSAITTFYMNDNILV--SGSEGQFNVY 666

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 78/178 (43%), Gaps = 27/178 (15%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
           ++++    F+    I G DD      +    + L  + GHE  +  + +  DG ++ + S
Sbjct: 356 TSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADG-IIVSGS 414

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVK--HVIWHQSLPLLASSSYDDTVRIWK--- 183
            D+SV IW+     +   C  V + H+  V+   ++ ++++  + + S D+T+ +WK   
Sbjct: 415 TDRSVRIWDI----KRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIK 470

Query: 184 -------------DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
                          +++     VL GH  +V +      + N+ + SGS D  + +W
Sbjct: 471 EEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTI---SGHGNI-VISGSYDNNLMVW 524

>Kwal_23.5035
          Length = 744

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 92/204 (45%), Gaps = 22/204 (10%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K +  L+ HD   W++   + GI+ +GSTDR +++ +I+S +         H  TVR + 
Sbjct: 401 KFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFK--GHTSTVRCLD 458

Query: 65  WRPHS--NILAAGSFDSTVSIWGKDD---DGYNDE-------NDLETELLAIIEGHENEI 112
              H+    +  GS D T+ +W   +   + YN E        D     + ++ GH   +
Sbjct: 459 IVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAV 518

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLAS 172
           + V  S  G ++ + S D ++ +W+  +M    +C+ VL  H+  +   I+        S
Sbjct: 519 RTV--SGHGNIVVSGSYDFNLMVWDIAQM----KCLYVLTGHTDRIYSTIYDYQRNRCIS 572

Query: 173 SSYDDTVRIW--KDCDDDWECCAV 194
           +  D TV++W   D   +  C  +
Sbjct: 573 AGMDSTVKVWDLADVSKNGPCTTI 596

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H+ T+R    +    I+    F+    I G DD      +    + +  + GH+  +  
Sbjct: 360 PHRTTLRGHTMK----IVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWA 415

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK--HVIWHQSLPLLAS 172
           + + HDG +L + S D+SV +W      +  +C  V + H+  V+   ++ H     + +
Sbjct: 416 LKYGHDG-ILVSGSTDRSVRVWNI----KSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVT 470

Query: 173 SSYDDTVRIWK--DC---DDDWECCAVLN 196
            S D T+ +WK  +C   D + E C V N
Sbjct: 471 GSRDHTLHVWKLPNCNAEDYNPEVCEVFN 499

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 111/240 (46%), Gaps = 21/240 (8%)

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--H 164
           GHE+ +  VA+   G  +ATCS D+ + +++ D+    +E     + H   +  + W   
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCA-------VLNGHEGTVWSSDFEKSNSNVRLC 217
           +   ++AS+SYD T++IW++  +  EC          LN  +G+++   F  S+  +R+ 
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIA 126

Query: 218 SGSDDGTVRIW-CLEDDNGEYEQEWIQESILPKA---HTRAVYSVNW-----SPKGYIAS 268
           S  +DG +R++  L+  N        +  +LP A   + ++ + ++W     SP+  IA 
Sbjct: 127 SIGNDGIMRMYDALDPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEK-IAV 185

Query: 269 TGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              D +  IY+  +DG   +   +L         + W     +   L+ T   DG V ++
Sbjct: 186 CALD-QAYIYQRGKDGHFYQA-GKLPGHTSLIRSISWAPLIGRPYHLIATGCKDGRVRIF 243

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 61/131 (46%), Gaps = 29/131 (22%)

Query: 55  AHKKTVRSVAWRP----HSNILAAGSFDSTVSIWG-------------KDDDGYNDEN-- 95
            H   +RS++W P      +++A G  D  V I+               D D YN E+  
Sbjct: 210 GHTSLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQG 269

Query: 96  --------DLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFEC 147
                   DLE ELL+  + H+ E+  V+W+  G +L++   D  V +W++     E++C
Sbjct: 270 IKQRQNNTDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKS-TYSNEYKC 328

Query: 148 ISVLQEHSQDV 158
           +S++    QD+
Sbjct: 329 MSIITS-KQDI 338

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 125/305 (40%), Gaps = 52/305 (17%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDT--AHKKTVRSVAWRP--HSNILAAGSFDST 80
           G  MAT S+D+ IK+  +       E++D+  AH  ++ S+ W    +  I+A+ S+D T
Sbjct: 21  GRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASPEYGRIIASASYDKT 80

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV--AWSHDGELLATCSRDKSVWIWEA 138
           + IW +D +         T L  + +  +  + CV  A SH G  +A+   D  + +++A
Sbjct: 81  IKIWEEDPNQEECSGRRWTRLCTLNDS-KGSLYCVKFAPSHLGLRIASIGNDGIMRMYDA 139

Query: 139 DE--------MGEEFECISVLQEHS-QDVKHVIW---HQSLPLLASSSYDDTVRIWKDCD 186
            +        M  E + + V   ++ Q    + W     S   +A  + D      +  D
Sbjct: 140 LDPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRFSPEKIAVCALDQAYIYQRGKD 199

Query: 187 DDWECCAVLNGHEGTVWSSDFEK--SNSNVRLCSGSDDGTVRIWCLED------------ 232
             +     L GH   + S  +          + +G  DG VRI+ + D            
Sbjct: 200 GHFYQAGKLPGHTSLIRSISWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSD 259

Query: 233 ---------------DNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI-ASTGSDGRLV 276
                          +N + E E + E      H   V+SV+W+  G I +STG DG++ 
Sbjct: 260 SDDYNMEDQGIKQRQNNTDLEVELLSEH---DDHKGEVWSVSWNLTGTILSSTGEDGKVR 316

Query: 277 IYKES 281
           ++K +
Sbjct: 317 LWKST 321

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 144 EFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC-DDDWECCAVLNGHE 199
           E E +S   +H  +V  V W+ +  +L+S+  D  VR+WK    ++++C +++   +
Sbjct: 280 EVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEYKCMSIITSKQ 336

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 98/207 (47%), Gaps = 27/207 (13%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +  GS D KI++ +  + + +  +D  AH   +R++A  P  + + + S D TV +W   
Sbjct: 70  IIVGSDDFKIRVFNYNTGEKV--VDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLW--- 124

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFE 146
               N E +   E     EGHE+ +  V ++  D    AT   D +V IW    +G+E  
Sbjct: 125 ----NWEKNWALE--QTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWS---LGQETS 175

Query: 147 CISVLQEHSQDVKHVIWH--QSLPLLASSSYDDTVRIWKDCDDDWE---CCAVLNGHEGT 201
             ++     + V  V ++  Q  P L +SS D TV++W     D++   C A L GH   
Sbjct: 176 NFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVW-----DYQTKSCVATLEGHLSN 230

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           V  + +      +   SGS+DGTV+IW
Sbjct: 231 VSYAVYHPMLPII--ISGSEDGTVKIW 255

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 15/115 (13%)

Query: 216 LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK--GYIASTGSDG 273
           + S SDD TV++W        +E+ W  E    + H   V SV ++PK     A+   D 
Sbjct: 112 VLSASDDLTVKLW-------NWEKNWALEQTF-EGHEHFVMSVTFNPKDPNTFATACLDH 163

Query: 274 RLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            + I+   ++         L  GV   N V +  Y  +D   LIT+ DD  V VW
Sbjct: 164 TVKIWSLGQETSNFTLRAHLEKGV---NFVDY--YPFQDKPYLITSSDDRTVKVW 213

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           + T S DR +K+ D ++   +  L+   H   V    + P   I+ +GS D TV IW  +
Sbjct: 201 LITSSDDRTVKVWDYQTKSCVATLE--GHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSN 258

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 71/294 (24%), Positives = 121/294 (41%), Gaps = 54/294 (18%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           +++A+ P    +    F ST+ +W          +     LL   E HE  ++ V +   
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLW----------DYRMGVLLHRFEEHEGPVRGVDFHPT 64

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
             L  +   D S+ +W         +C+  L  H   V+ V +H  LP + S+S D T+R
Sbjct: 65  QPLFVSAGDDYSIKVWSL----STHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIR 120

Query: 181 IWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED----- 232
           IW     +W+     A L GH   V  + F  +   V   S S D TVRIW +       
Sbjct: 121 IW-----NWQNRREIACLTGHNHFVMCAQFHPTEDLV--VSASLDETVRIWDISGLRKRH 173

Query: 233 ---DNGEYEQEWIQES-------------ILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
               +  +E++ I +               + + HTR V   ++ P   +  +GSD R V
Sbjct: 174 SAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQV 233

Query: 277 -IYK-ESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +++  S   W V+     T+ V   + V +  + +    L+I+ G+D  + VW
Sbjct: 234 KLWRMSSTKAWEVDTCRGHTNNV---DSVIFHPFQN----LIISVGEDSTIRVW 280

 Score = 38.1 bits (87), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 1/98 (1%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ +GS DR++KL  + S +  E      H   V SV + P  N++ +   DST+ +W  
Sbjct: 223 LIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDL 282

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           D      +   E +    I  H N +     +HD  ++
Sbjct: 283 DKRTPVKQFKREQDRFWSIRAHPN-VNLFGAAHDSGIM 319

 Score = 32.0 bits (71), Expect = 0.92,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWS 204
           ++  +  S   K + +H S P +  + +  T+++W     D+    +L+    HEG V  
Sbjct: 4   LTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLW-----DYRMGVLLHRFEEHEGPVRG 58

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCL 230
            DF  +       S  DD ++++W L
Sbjct: 59  VDFHPTQP--LFVSAGDDYSIKVWSL 82

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 91/192 (47%), Gaps = 27/192 (14%)

Query: 13  HDDKCWSVDVN-NGGIMATGSTDRKIKL---------------VDIRSFQIIEELDDTAH 56
            D + ++VDV+ +G  +ATG  D KI++               VD  + + +  +  + H
Sbjct: 16  RDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASM--SRH 73

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETE-----LLAIIEGHENE 111
             +V  V + P  N LA+GS D  + IW  D++ +      E E     +   +  H+N+
Sbjct: 74  TGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDND 133

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I+ + W+ D  +L T   D+SV +W     G  FE +     H   VK VI+  +    A
Sbjct: 134 IQDICWAPDSSILVTVGLDRSVIVWN----GLNFERLKRFDVHQSLVKGVIFDPANKYFA 189

Query: 172 SSSYDDTVRIWK 183
           ++S D T+R+++
Sbjct: 190 TASDDRTMRVFR 201

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 88/217 (40%), Gaps = 24/217 (11%)

Query: 67  PHSNILAAGSFDSTVSIWGKDD--DGYNDENDLETEL---LAIIEGHENEIKCVAWSHDG 121
           P    +A G  D  + IW  D        E+ ++ +    LA +  H   + CV +S DG
Sbjct: 27  PDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVTCVKFSPDG 86

Query: 122 ELLATCSRDKSVWIWEADE------MGEEFE-----CISVLQEHSQDVKHVIWHQSLPLL 170
             LA+ S D+ + IW  DE       G E E         L  H  D++ + W     +L
Sbjct: 87  NYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQDICWAPDSSIL 146

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
            +   D +V +W     ++E     + H+  V    F+ +N      + SDD T+R++  
Sbjct: 147 VTVGLDRSVIVWNGL--NFERLKRFDVHQSLVKGVIFDPANK--YFATASDDRTMRVFRY 202

Query: 231 EDDNGEYE---QEWIQESILPKAHTRAVYSVNWSPKG 264
               GE     ++ I E  +    T     ++WSP G
Sbjct: 203 H-KTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDG 238

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 69/180 (38%), Gaps = 45/180 (25%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           E  + EI  V  S DG+ +AT   D  + IW  D                          
Sbjct: 14  ESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDA------------------------- 48

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
              L+++++ +  V       D     A ++ H G+V    F    +   L SGSDD  +
Sbjct: 49  ---LVSAAAGESGVD-----RDTHRPLASMSRHTGSVTCVKFSPDGN--YLASGSDDRIL 98

Query: 226 RIWCLEDDN--------GEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
            IW ++++N        GE E   +++ ++  AH   +  + W+P   I  T    R VI
Sbjct: 99  LIWAMDEENHGGSFGSEGEKEHWTVRKRLV--AHDNDIQDICWAPDSSILVTVGLDRSVI 156

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 27  IMATGSTDRKIKL-VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTV 81
           I+AT   D+ + L +  R   I    D    +K++  +AW P+ NIL   S DS++
Sbjct: 313 IIATAGQDKSLALWITSRPRPIFVAYD--IAQKSITDMAWNPNGNILFVTSLDSSI 366

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 73/294 (24%), Positives = 120/294 (40%), Gaps = 54/294 (18%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           + +A+ P         F ST+ +W         +  + T LL   EGHE  ++ V +   
Sbjct: 15  KGIAFHPSRPWALVALFSSTIQLW---------DYRMGT-LLHRFEGHEGPVRAVDFHPT 64

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
             +  +   D S+ +W      E   C+  L  H   V+ V +H  LP + S+S D TVR
Sbjct: 65  QPIFVSAGDDASIKVWSL----ETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVR 120

Query: 181 IWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           IW     +W+     A L GH   V  + F ++   V   S S D TVR+W +     ++
Sbjct: 121 IW-----NWQNRKELACLTGHNHFVMCAQFHQTEDLV--VSASLDETVRVWDISGLRKKH 173

Query: 238 EQEWI---------QESILPKA------------HTRAVYSVNWSPKGYIASTGSDGRLV 276
               +         Q+++L  A            HTR V   ++ P   +  TG D R V
Sbjct: 174 SAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQV 233

Query: 277 -IYKESED-GWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +++ S +  W V+           TN V  V +   D  L+++  +D  + +W
Sbjct: 234 KLWRMSSNKAWEVDTCRG------HTNNVDCVVF-HPDQNLILSVAEDKTLRIW 280

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 104/254 (40%), Gaps = 43/254 (16%)

Query: 6   LLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           LL     H+    +VD +    I  +   D  IK+  + + + +  L  T H   VR+V 
Sbjct: 45  LLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTL--TGHLDYVRTVF 102

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           +      + + S D TV IW       N +N  E   LA + GH + + C  +    +L+
Sbjct: 103 FHSELPWVISASDDQTVRIW-------NWQNRKE---LACLTGHNHFVMCAQFHQTEDLV 152

Query: 125 ATCSRDKSVWIWE----------------ADEMGEEFECIS----------VLQEHSQDV 158
            + S D++V +W+                 D +  +   +           +L+ H++ V
Sbjct: 153 VSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGV 212

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWK-DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLC 217
               +H +LPL+ +   D  V++W+   +  WE      GH   V    F    +   + 
Sbjct: 213 NWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWE-VDTCRGHTNNVDCVVFHPDQN--LIL 269

Query: 218 SGSDDGTVRIWCLE 231
           S ++D T+RIW L+
Sbjct: 270 SVAEDKTLRIWDLD 283

 Score = 37.7 bits (86), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 10/93 (10%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWS 204
           ++  +  S   K + +H S P    + +  T+++W     D+    +L+   GHEG V +
Sbjct: 4   LTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLW-----DYRMGTLLHRFEGHEGPVRA 58

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
            DF  +       S  DD ++++W LE +   Y
Sbjct: 59  VDFHPTQP--IFVSAGDDASIKVWSLETNRCLY 89

 Score = 37.0 bits (84), Expect = 0.021,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 8/86 (9%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H + V   ++ P   ++  G  D  V +W       N   +++T       GH N + C
Sbjct: 207 GHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSS---NKAWEVDT-----CRGHTNNVDC 258

Query: 115 VAWSHDGELLATCSRDKSVWIWEADE 140
           V +  D  L+ + + DK++ IW+ D+
Sbjct: 259 VVFHPDQNLILSVAEDKTLRIWDLDK 284

 Score = 35.4 bits (80), Expect = 0.070,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 1/98 (1%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ TG  DR++KL  + S +  E      H   V  V + P  N++ + + D T+ IW  
Sbjct: 223 LIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDL 282

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           D      +   E +   +I  H N +     +HD  ++
Sbjct: 283 DKRTPVKQFKRENDRFWLIRSHPN-MSLFGAAHDSGIM 319

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 104/246 (42%), Gaps = 32/246 (13%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH + +       +   LA  S D T+ I+  D D +        +L+  + GHE  +  
Sbjct: 7   AHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDSH--------KLVDSLHGHEGPVWQ 58

Query: 115 VAWSHD--GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--HQSLPLL 170
           V W+H   G +LA+CS D  V IW+  E    +  I+  + HS  V  V W  H+  PLL
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWK--EENGRWSQIAAYEVHSASVNSVKWAPHEYGPLL 116

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGH----EGTVWSS-----DFEKSNSNVRLCSGSD 221
             SS D    + +  ++      +++ H        W+      D ++S    R+ +G  
Sbjct: 117 LCSSSDGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRRIATGGA 176

Query: 222 DGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWS----PKGYIASTGSDGRLVI 277
           D  V+IW    +   Y    + E  L  AH   V  V WS    P+ Y+A+   D   +I
Sbjct: 177 DNLVKIWKYNPEANTY----LLEDTL-AAHADWVRDVAWSPSVLPRAYLATVSQDRTCII 231

Query: 278 YKESED 283
           + +  +
Sbjct: 232 WTQENN 237

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 81/198 (40%), Gaps = 23/198 (11%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++ I   H   I      + G+ LATCS DK++ I+E D  G+  + +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVD--GDSHKLVDSLHGHEGPVWQ 58

Query: 161 VIW-HQSLP-LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           V W H     +LAS SYD  V IWK+ +  W   A    H  +V S  +        L  
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLC 118

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY------------I 266
            S DG   +        E+++      I+  AH   V +  W+P               I
Sbjct: 119 SSSDGKFSV-------VEFKENGTTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRRI 171

Query: 267 ASTGSDGRLVIYKESEDG 284
           A+ G+D  + I+K + + 
Sbjct: 172 ATGGADNLVKIWKYNPEA 189

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 102/256 (39%), Gaps = 33/256 (12%)

Query: 5   KLLKSLALHDDKCWSVD---VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVR 61
           KL+ SL  H+   W VD      G I+A+ S D K+ +    + +  +      H  +V 
Sbjct: 44  KLVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVN 103

Query: 62  SVAWRPH--SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           SV W PH    +L   S D   S+    ++G        T    II+ H   +    W+ 
Sbjct: 104 SVKWAPHEYGPLLLCSSSDGKFSVVEFKENG--------TTSPIIIDAHAIGVNAACWAP 155

Query: 120 -----DGE------LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS-L 167
                DG+       +AT   D  V IW+ +     +     L  H+  V+ V W  S L
Sbjct: 156 ATIEDDGQQSQHLRRIATGGADNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSVL 215

Query: 168 P--LLASSSYDDTVRIWKDCDDDWECCAVL---NGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           P   LA+ S D T  IW   ++       L   +     +W + +  S + + L  G  D
Sbjct: 216 PRAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGG--D 273

Query: 223 GTVRIWCLEDDNGEYE 238
             V +W  E+  G++E
Sbjct: 274 NKVTLW-KENLEGKWE 288

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 109/261 (41%), Gaps = 54/261 (20%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH   V ++ +   S+ + +G  D  + IW  +           + +  I   H   I+ 
Sbjct: 133 AHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN----------FSMVKEIDAAHTESIRD 182

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           +A+S +     TCS D  + IW      +E     VL  H  DVK   WH  + L+AS+S
Sbjct: 183 MAFSSNDSKFVTCSDDNILKIWNFSNGKQE----RVLSGHHWDVKSCDWHPEMGLIASAS 238

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW------ 228
            D+ V++W     +  C + +   + TV  + F+ +  N+ L + S D + R++      
Sbjct: 239 KDNLVKLWDPRSGN--CISSILKFKHTVLKTRFQPTKGNL-LMAISKDKSCRVFDIRYSM 295

Query: 229 ----CLEDDNGEYEQEW--IQESI-------------------------LPKAHTRAVYS 257
               C+ D+      EW  I ES+                         +P AH + + S
Sbjct: 296 KELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILTIPYAHDKCITS 355

Query: 258 VNWSPKGYIASTGSDGRLVIY 278
           ++++P G+I +T +  R + +
Sbjct: 356 LSYNPVGHIFATAAKDRTIRF 376

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 42  IRSFQIIEELDDT------AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK----DDDGY 91
           ++ F +++ L++       AH K + S+++ P  +I A  + D T+  W +    D + Y
Sbjct: 329 LKHFDLLQNLNEPILTIPYAHDKCITSLSYNPVGHIFATAAKDRTIRFWTRARPIDPNAY 388

Query: 92  NDENDLETELLAIIEGHENEIKCV 115
           +D      ++     G  N+I  V
Sbjct: 389 DDPTYNNKKINGWFFGINNDINAV 412

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 74/294 (25%), Positives = 118/294 (40%), Gaps = 54/294 (18%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           + +A+ P    +    F ST+ +W          +     LL   E HE  ++ + +   
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW----------DYRMGVLLHRFEDHEGPVRGIDFHPT 64

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
             L  +   D ++ +W      E  +C+  L  H   V+ V +H  LP + SSS D T+R
Sbjct: 65  QPLFVSAGDDYTIKVWSL----ESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIR 120

Query: 181 IWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           IW     +W+     A L GH   V  + F      V   S S D TVR+W +      +
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCAQFHPVEDLV--VSASLDETVRVWDISGLRKRH 173

Query: 238 ---------EQEWIQESILP------------KAHTRAVYSVNWSPKGYIASTGSDGRLV 276
                    EQ   Q+++L             + HTR V   ++ P   +  +GSD R V
Sbjct: 174 SAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQV 233

Query: 277 -IYKES-EDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +++ S    W V+           TN V  V +  +   L+I+ G+D  V VW
Sbjct: 234 KLWRMSATKAWEVDTCRG------HTNNVDSVIFHPQQN-LIISVGEDKTVRVW 280

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 73/173 (42%), Gaps = 24/173 (13%)

Query: 30  TGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW----- 84
           + S D+ I++ + ++ + I  L  T H   V    + P  +++ + S D TV +W     
Sbjct: 112 SSSDDQTIRIWNWQNRKEIACL--TGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGL 169

Query: 85  -----GKDDDGYNDENDLETELLA----------IIEGHENEIKCVAWSHDGELLATCSR 129
                      + ++   +  LL           I+EGH   +   ++     L+ + S 
Sbjct: 170 RKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSD 229

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           D+ V +W      + +E +   + H+ +V  VI+H    L+ S   D TVR+W
Sbjct: 230 DRQVKLWRMSAT-KAWE-VDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVW 280

 Score = 37.0 bits (84), Expect = 0.022,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 44/98 (44%), Gaps = 1/98 (1%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ +GS DR++KL  + + +  E      H   V SV + P  N++ +   D TV +W  
Sbjct: 223 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDL 282

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           D      +   E +   ++  H N +     +HD  ++
Sbjct: 283 DKRTPIKQFKRENDRFWLVRAHPN-LNLFGAAHDSGIM 319

 Score = 35.0 bits (79), Expect = 0.077,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWS 204
           ++  +  S   K + +H S P +  + +  T+++W     D+    +L+    HEG V  
Sbjct: 4   LTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLW-----DYRMGVLLHRFEDHEGPVRG 58

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
            DF  +       S  DD T+++W LE +
Sbjct: 59  IDFHPTQP--LFVSAGDDYTIKVWSLESN 85

 Score = 30.0 bits (66), Expect = 3.6,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 36/86 (41%), Gaps = 8/86 (9%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H + V   ++ P   ++ +GS D  V +W          +  +   +    GH N +  
Sbjct: 207 GHTRGVNWASFHPTLPLIVSGSDDRQVKLW--------RMSATKAWEVDTCRGHTNNVDS 258

Query: 115 VAWSHDGELLATCSRDKSVWIWEADE 140
           V +     L+ +   DK+V +W+ D+
Sbjct: 259 VIFHPQQNLIISVGEDKTVRVWDLDK 284

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 110/266 (41%), Gaps = 41/266 (15%)

Query: 53  DTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112
           + AH + +       +   LA  S D TV I+  + + +        +L+  ++GHE  +
Sbjct: 5   NNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVEGETH--------KLVDTLQGHEGPV 56

Query: 113 KCVAWSHD--GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--HQSLP 168
             V W+H   G +LA+CS D  V IW+  E+   +  I+  + HS  V  + W  H+  P
Sbjct: 57  WQVDWAHPKFGVILASCSYDGKVLIWK--EVNGRWSQIAAHEVHSASVNSIQWAPHEYGP 114

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHE----GTVWSSDFEKSNSNV---------- 214
           LL ++S D  V + +  ++      +++ H        W+    +  SN           
Sbjct: 115 LLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSASPQQ 174

Query: 215 --RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP----KGYIAS 268
             R  +G  D  V+IW    D   Y  E   E      H+  V  V WSP    + Y+AS
Sbjct: 175 VRRFVTGGADNLVKIWKYNSDAATYLLEHTLE-----GHSDWVRDVAWSPTVLSRSYLAS 229

Query: 269 TGSDGRLVIYKE--SEDGWIVECIHE 292
              D   +I+ +   ED W    + E
Sbjct: 230 VSQDRTCIIWTQDSKEDTWKKTLLKE 255

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 11/164 (6%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++ I   H   I      + G+ LATCS D +V I+E +  GE  + +  LQ H   V  
Sbjct: 1   MVTINNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVE--GETHKLVDTLQGHEGPVWQ 58

Query: 161 VIW-HQSLP-LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           V W H     +LAS SYD  V IWK+ +  W   A    H  +V S  +        L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLA 118

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
            S DG V +        E+++      I+  AH+    +  W+P
Sbjct: 119 ASSDGKVSV-------VEFKENGTTSPIIIDAHSIGANTACWAP 155

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 10/140 (7%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF 207
           +++   HS+ +   +       LA+ S D TV+I++   +  +    L GHEG VW  D+
Sbjct: 2   VTINNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVEGETHKLVDTLQGHEGPVWQVDW 61

Query: 208 EKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY-- 265
                 V L S S DG V IW  ++ NG + Q    E      H+ +V S+ W+P  Y  
Sbjct: 62  AHPKFGVILASCSYDGKVLIW--KEVNGRWSQIAAHE-----VHSASVNSIQWAPHEYGP 114

Query: 266 -IASTGSDGRLVIYKESEDG 284
            + +  SDG++ + +  E+G
Sbjct: 115 LLLAASSDGKVSVVEFKENG 134

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 79/190 (41%), Gaps = 31/190 (16%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHS--------------- 69
           G ++   S+D K+ +V+ +       +   AH     +  W P +               
Sbjct: 113 GPLLLAASSDGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSASP 172

Query: 70  ---NILAAGSFDSTVSIWGKDDDGYNDENDLETELLA-IIEGHENEIKCVAWSH---DGE 122
                   G  D+ V IW      YN  +D  T LL   +EGH + ++ VAWS       
Sbjct: 173 QQVRRFVTGGADNLVKIWK-----YN--SDAATYLLEHTLEGHSDWVRDVAWSPTVLSRS 225

Query: 123 LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK-HVIWHQSLPLLASSSYDDTVRI 181
            LA+ S+D++  IW  D   + ++   + ++   DV     W  S  +LA S  D+TV +
Sbjct: 226 YLASVSQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCGDNTVTL 285

Query: 182 WK-DCDDDWE 190
           WK + +  WE
Sbjct: 286 WKENLEGKWE 295

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 18/118 (15%)

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY---IASTGS 271
           RL + S D TV+I+ +E   GE  +  + +++  + H   V+ V+W+   +   +AS   
Sbjct: 23  RLATCSSDHTVKIFEVE---GETHK--LVDTL--QGHEGPVWQVDWAHPKFGVILASCSY 75

Query: 272 DGRLVIYKESEDGWIVECIHELTHGVYETNMVKWV--EYGSKDVILLITAGDDGHVNV 327
           DG+++I+KE    W     HE+       N ++W   EYG     LL+ A  DG V+V
Sbjct: 76  DGKVLIWKEVNGRWSQIAAHEVHSA--SVNSIQWAPHEYGP----LLLAASSDGKVSV 127

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 142/339 (41%), Gaps = 64/339 (18%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K L  L+ HD   W++     GI+ +GSTDR +++ +I   +         H  TVR + 
Sbjct: 400 KFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFK--GHTSTVRCLD 457

Query: 65  WRPHSNI--LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE 122
              H  +  +  GS D+T+ IW       +D N        I EG  N      +S++G 
Sbjct: 458 IVEHEGVKYIVTGSRDNTLHIWKLPQ--MSDSN--------IDEGMPN-----VYSNNGP 502

Query: 123 LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           L            + + E    F  + VL+ H   V+ V  H    ++ S SYD+ + +W
Sbjct: 503 LF-----------FHSPEENPYF--VGVLRGHIASVRTVSGHGR--IVISGSYDNNLIVW 547

Query: 183 KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED--DNGEYEQE 240
                  +C  +L GH   ++S+ ++   +  R  S S D T++IW L++  +NGE    
Sbjct: 548 DII--QMKCLYILMGHTDRIYSTIYDYKRN--RCISASMDSTIKIWDLQNIWNNGECVN- 602

Query: 241 WIQESILP-----------KAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVEC 289
            +  + +P           + HT  V  +  S K ++ S  +DG L  +  S+       
Sbjct: 603 -VTNATVPCTKITGPMMTLQGHTALVGLLKLSDK-FLVSAAADGSLRGWDSSD------- 653

Query: 290 IHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +      +  N+     +   D IL+  +G +G  N++
Sbjct: 654 -YSRKFAYHHNNLSAITTFYMTDNILV--SGSEGQFNIY 689

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 55/109 (50%), Gaps = 7/109 (6%)

Query: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
           F+    I G DD      + +  + L  + GH+  +  + ++ +G +L + S D+SV IW
Sbjct: 377 FEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNG-ILVSGSTDRSVRIW 435

Query: 137 EADEMGEEFECISVLQEHSQDVK--HVIWHQSLPLLASSSYDDTVRIWK 183
               +G   +C  V + H+  V+   ++ H+ +  + + S D+T+ IWK
Sbjct: 436 NI-HLG---KCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWK 480

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 75/164 (45%), Gaps = 11/164 (6%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++ I   H + I      + G+ LATCS DK++ I+E +  GE  + +  L  H   V  
Sbjct: 1   MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWR 58

Query: 161 VIW-HQSL-PLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           V W H     +LAS SYD  V IWK+ +D W   AV   H  +V S  +        L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLA 118

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
            S DG V +        E+++      ++  AH   V + +W+P
Sbjct: 119 ASSDGKVSV-------VEFKENGTATPLIFDAHAIGVNAASWAP 155

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 121/286 (42%), Gaps = 44/286 (15%)

Query: 25  GGIMATGSTDRKIKLVDIR--SFQIIEELDDTAHKKTVRSVAW--RPHSNILAAGSFDST 80
           G  +AT S+D+ IK+ ++   S ++++ L    H+  V  V W       ILA+ S+D  
Sbjct: 21  GKKLATCSSDKTIKIFEVEGESHKLVDTL--VGHEGPVWRVDWAHPKFGTILASCSYDGK 78

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HD-GELLATCSRDKSVWIWEA 138
           V IW +++D ++         +A+   H   +  V W+ H+ G LL   S D  V + E 
Sbjct: 79  VIIWKEENDRWSQ--------IAVHAVHTASVNSVQWAPHEYGALLLAASSDGKVSVVEF 130

Query: 139 DEMGEEFECISVLQEHSQDVKHVIW--------------HQSLPLLASSSYDDTVRIWKD 184
            E G     I     H+  V    W               + +    +   D+ V+IW+ 
Sbjct: 131 KENGTATPLI--FDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIWRY 188

Query: 185 CDDDWECCA--VLNGHEGTVWSSDFEKSNSNV---RLCSGSDDGTVRIWCLEDDNGEYEQ 239
             +         L GH    W  D   S S +    + S S D T  IW  ED+ G    
Sbjct: 189 NPETQSYLVEDTLEGHSD--WVRDVAWSPSVLLRSYIASVSQDRTCNIWTQEDNTG---- 242

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYI-ASTGSDGRLVIYKESEDG 284
            W++  + P+     ++  +WS  G I A +G D ++ ++KE+ +G
Sbjct: 243 PWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENLNG 288

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 79/172 (45%), Gaps = 22/172 (12%)

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           LA+ S D T++I++   +  +    L GHEG VW  D+        L S S DG V IW 
Sbjct: 24  LATCSSDKTIKIFEVEGESHKLVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWK 83

Query: 230 LEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIA---STGSDGRLVIYKESEDGWI 286
            E+D       W Q ++    HT +V SV W+P  Y A   +  SDG++ + +  E+G  
Sbjct: 84  EEND------RWSQIAVH-AVHTASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTA 136

Query: 287 VECIHELTHGVYETNMVKW----VEYGS------KDVILLITAGDDGHVNVW 328
              I +  H +   N   W    VE G+      K+V   +T G D  V +W
Sbjct: 137 TPLIFD-AHAI-GVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIW 186

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 28  MATGSTDRKIKL----VDIRSFQIIEELDDTAHKKTVRSVAWRPH---SNILAAGSFDST 80
             TG  D  +K+     + +S+ + + L+   H   VR VAW P     + +A+ S D T
Sbjct: 174 FVTGGADNLVKIWRYNPETQSYLVEDTLE--GHSDWVRDVAWSPSVLLRSYIASVSQDRT 231

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
            +IW ++D   N    ++T+L    E   + +   +WS  G +LA    D  V +W+ + 
Sbjct: 232 CNIWTQED---NTGPWVKTQLTP--EEFPDVLWRASWSLSGNILAISGGDNKVTLWKENL 286

Query: 141 MGE 143
            G+
Sbjct: 287 NGK 289

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 63.2 bits (152), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 77/186 (41%), Gaps = 21/186 (11%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH+K + +++  P+ ++ A  S+D T  IW  DD           E  A +  H+  +  
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLDDG----------EFQATLANHKRGLWD 542

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           VA+    +LLATCS DK++ IW      E +  +  L+ H+  V+   +      L S+ 
Sbjct: 543 VAFCQYDKLLATCSGDKTIKIWSL----ESYAVVKTLEGHTNAVQRCSFINKNKQLISTG 598

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDN 234
            D  V IW       E    L+ H   +W+      N      +   DG    W    DN
Sbjct: 599 ADGLVIIWDLSTG--ESVKTLDAHNNRIWA--LAVMNDGESFVTADADGFFEFW---RDN 651

Query: 235 GEYEQE 240
            E E E
Sbjct: 652 SEEEHE 657

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 100/240 (41%), Gaps = 29/240 (12%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           + + EGH + +  +  + DG  +AT S+D SV +W      E+F   +    H   V  V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 162 IWHQSLP-----LLASSSYDDTVRIW---KDCDDDWECCAVLNGHEGTVWSSD-----FE 208
                +P      + ++S D T++ W   K   D+ E   ++   E T  + +       
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 209 KSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIAS 268
            S ++    + S D T +IW L+D  GE++            H R ++ V +     + +
Sbjct: 503 ISPNDSLFATASYDKTCKIWNLDD--GEFQATLAN-------HKRGLWDVAFCQYDKLLA 553

Query: 269 TGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           T S  + +     E   +V+ +         TN V+   + +K+   LI+ G DG V +W
Sbjct: 554 TCSGDKTIKIWSLESYAVVKTLEG------HTNAVQRCSFINKNK-QLISTGADGLVIIW 606

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 64/154 (41%), Gaps = 20/154 (12%)

Query: 9   SLALHDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP 67
           +LA H    W V       ++AT S D+ IK+  + S+ +++ L+   H   V+  ++  
Sbjct: 532 TLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLE--GHTNAVQRCSFIN 589

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLAT 126
            +  L +   D  V IW           DL T E +  ++ H N I  +A  +DGE   T
Sbjct: 590 KNKQLISTGADGLVIIW-----------DLSTGESVKTLDAHNNRIWALAVMNDGESFVT 638

Query: 127 CSRDKSVWIW-----EADEMGEEFECISVLQEHS 155
              D     W     E  E   E E + + QE S
Sbjct: 639 ADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQS 672

>Scas_674.20
          Length = 297

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 76/164 (46%), Gaps = 11/164 (6%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++AI   H + I      + G+ LATCS DK++ I+E +  GE  + ++ L+ H   V  
Sbjct: 1   MVAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKEVATLEGHDGPVWR 58

Query: 161 VIW-HQSL-PLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           V W H     +LAS SYD  V IWK+ +  W   A    H  +V S  +        L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLA 118

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
            S DG V +        E+++      I+  AH   V S +W+P
Sbjct: 119 ASSDGKVSV-------VEFKENGTLTPIIIDAHNIGVNSASWAP 155

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 10/124 (8%)

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           LA+ S D T++I++   +  +  A L GH+G VW  D+        L S S DG V IW 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIW- 82

Query: 230 LEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY---IASTGSDGRLVIYKESEDGWI 286
            +++NG + Q           H+ +V SV W+P  Y   + +  SDG++ + +  E+G +
Sbjct: 83  -KEENGRWSQ-----IACHAVHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTL 136

Query: 287 VECI 290
              I
Sbjct: 137 TPII 140

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 26/185 (14%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-------------HSNI 71
           G ++   S+D K+ +V+ +    +  +   AH   V S +W P              S  
Sbjct: 113 GALLLAASSDGKVSVVEFKENGTLTPIIIDAHNIGVNSASWAPATLQENKPTKSPEESRR 172

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLA-IIEGHENEIKCVAWSHDGEL---LATC 127
              G  D+ V IW      YN+E+  +T LL   ++GH + ++ VAWS    L   +A+ 
Sbjct: 173 FVTGGADNLVKIW-----KYNNES--QTYLLEDTLQGHSDWVRDVAWSPSVLLRSYIASV 225

Query: 128 SRDKSVWIWEADEMGEEFECISVLQEHSQDVK-HVIWHQSLPLLASSSYDDTVRIWK-DC 185
           S+DK+  IW  +     ++   + +E   DV     W  S  +LA S  D+ V +WK + 
Sbjct: 226 SQDKTCIIWTQENNDSSWKKTELQKERFPDVLWRASWSLSGNILALSGGDNKVTLWKENL 285

Query: 186 DDDWE 190
           + +WE
Sbjct: 286 EGNWE 290

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 82/205 (40%), Gaps = 29/205 (14%)

Query: 5   KLLKSLALHDDKCWSVD---VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVR 61
           K + +L  HD   W VD      G I+A+ S D K+ +    + +  +      H  +V 
Sbjct: 44  KEVATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVN 103

Query: 62  SVAWRPH--SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS- 118
           SV W PH    +L A S D  VS+    ++G        T    II+ H   +   +W+ 
Sbjct: 104 SVQWAPHEYGALLLAASSDGKVSVVEFKENG--------TLTPIIIDAHNIGVNSASWAP 155

Query: 119 ------------HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166
                        +     T   D  V IW+ +   + +     LQ HS  V+ V W  S
Sbjct: 156 ATLQENKPTKSPEESRRFVTGGADNLVKIWKYNNESQTYLLEDTLQGHSDWVRDVAWSPS 215

Query: 167 LPL---LASSSYDDTVRIWKDCDDD 188
           + L   +AS S D T  IW   ++D
Sbjct: 216 VLLRSYIASVSQDKTCIIWTQENND 240

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 72/164 (43%), Gaps = 11/164 (6%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++ I   H   I      + G+ LATCS DK++ I+E +  GE  + I  L  H   V  
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWR 58

Query: 161 VIW-HQSL-PLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           V W H     +LAS SYD  V IWK+ +  W   AV   H  +V S  +        L  
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLV 118

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
            S DG V +        E+++      I+  AH   V S +W+P
Sbjct: 119 ASSDGKVSV-------VEFKENGTTSPIIIDAHAIGVNSASWAP 155

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 21/171 (12%)

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           LA+ S D T++I++   +  +    L GHEG VW  D+        L S S DG V IW 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW- 82

Query: 230 LEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY---IASTGSDGRLVIYKESEDGWI 286
            +++NG + Q  +        H+ +V SV W+P  Y   +    SDG++ + +  E+G  
Sbjct: 83  -KEENGRWSQIAVH-----AVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTT 136

Query: 287 VECIHELTHGVYETNMVKWVEY---------GSKDVILLITAGDDGHVNVW 328
              I +  H +   N   W            G+K+    +T G D  V +W
Sbjct: 137 SPIIID-AHAI-GVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 26/188 (13%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-------------HSNI 71
           G ++   S+D K+ +V+ +       +   AH   V S +W P              S  
Sbjct: 113 GPLLLVASSDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRK 172

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELL-AIIEGHENEIKCVAWSHDGEL---LATC 127
              G  D+ V IW      YN  +D +T +L + +EGH + ++ VAWS    L   LA+ 
Sbjct: 173 FVTGGADNLVKIW-----KYN--SDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASV 225

Query: 128 SRDKSVWIWEADEMGEEFECISVLQEHSQDVK-HVIWHQSLPLLASSSYDDTVRIWK-DC 185
           S+D++  IW  D     ++   + +E   DV     W  S  +LA S  D+ V +WK + 
Sbjct: 226 SQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENL 285

Query: 186 DDDWECCA 193
           +  WE   
Sbjct: 286 EGKWEPAG 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 105/258 (40%), Gaps = 35/258 (13%)

Query: 5   KLLKSLALHDDKCWSVD---VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVR 61
           KL+ +L  H+   W VD      G I+A+ S D K+ +    + +  +      H  +V 
Sbjct: 44  KLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVN 103

Query: 62  SVAWRPH--SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS- 118
           SV W PH    +L   S D  VS+    ++G        T    II+ H   +   +W+ 
Sbjct: 104 SVQWAPHEYGPLLLVASSDGKVSVVEFKENG--------TTSPIIIDAHAIGVNSASWAP 155

Query: 119 ----HDGE--------LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166
                DGE           T   D  V IW+ +   + +   S L+ HS  V+ V W  +
Sbjct: 156 ATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPT 215

Query: 167 LPL---LASSSYDDTVRIWKDCDDDWECCAVLNGHEG---TVWSSDFEKSNSNVRLCSGS 220
           + L   LAS S D T  IW   ++       L   E     +W + +  S + + L  G 
Sbjct: 216 VLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGG- 274

Query: 221 DDGTVRIWCLEDDNGEYE 238
            D  V +W  E+  G++E
Sbjct: 275 -DNKVTLWK-ENLEGKWE 290

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 107/238 (44%), Gaps = 17/238 (7%)

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--H 164
           GH++ +  V +   G  +ATCS D+ + +++ D+    +E     + H   +  + W   
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCA-------VLNGHEGTVWSSDFEKSNSNVRLC 217
           +   ++AS+SYD TV++W++  D  EC          LN  +G+++S  F  ++  ++L 
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLA 126

Query: 218 SGSDDGTVRIW-CLEDDNGE---YEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDG 273
              +DG +R++  LE  +        E    SI P  H ++ + ++W P  +     +  
Sbjct: 127 CLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVS 186

Query: 274 RL---VIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            L   +IY+  +DG  +    +L         + W     +   L+ T   DG + ++
Sbjct: 187 ALEQAIIYQRGKDG-KLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIF 243

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 68/129 (52%), Gaps = 17/129 (13%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ATG  D +I++     F+I E+L   A ++++       +SN+    S D  +   G+
Sbjct: 230 LIATGCKDGRIRI-----FKITEKLSPLASEESLT------NSNMFD-NSADVDMDAQGR 277

Query: 87  DDDGYND----ENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMG 142
            D    +    +++L+ ELL+  + H  E+  V+W+  G +L++   D  V +W+A    
Sbjct: 278 SDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKA-TYS 336

Query: 143 EEFECISVL 151
            EF+C+SV+
Sbjct: 337 NEFKCMSVI 345

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 129/328 (39%), Gaps = 41/328 (12%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDT--AHKKTVRSVAWRP--HSNILAAGSFDST 80
           G  +AT S+D+ IK+  +       EL D+  AH  ++ ++ W    +  I+A+ S+D T
Sbjct: 21  GRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKT 80

Query: 81  VSIWGKDDDGYNDENDLETELLAI--IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEA 138
           V +W +D D          +L  +   +G    +K  A +H G  LA    D  + +++A
Sbjct: 81  VKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVK-FAPAHLGLKLACLGNDGILRLYDA 139

Query: 139 DE--------MGEEFECISVLQ-EHSQDVKHVIW---HQSLPLLASSSYDDTVRIWKDCD 186
            E        +  E + +S+    H Q    + W     S   LA S+ +  +   +  D
Sbjct: 140 LEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKD 199

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSN--VRLCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244
                 A L GH+  + S  +  S       + +G  DG +RI+             I E
Sbjct: 200 GKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFK------------ITE 247

Query: 245 SILPKAHTRAVYSVNWSPKG----YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYET 300
            + P A   ++ + N           A   SD       E +    VE + E      E 
Sbjct: 248 KLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEV 307

Query: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328
             V W   G+    +L +AGDDG V +W
Sbjct: 308 WSVSWNLTGT----ILSSAGDDGKVRLW 331

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 66/153 (43%), Gaps = 19/153 (12%)

Query: 54  TAHKKTVRSVAWRPH----SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHE 109
             HK  +RS++W P       ++A G  D  + I+              TE L+ +   E
Sbjct: 209 PGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKI------------TEKLSPLASEE 256

Query: 110 NEIKCVAW--SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL 167
           +      +  S D ++ A    D +       +   + E +S   +H+ +V  V W+ + 
Sbjct: 257 SLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTG 316

Query: 168 PLLASSSYDDTVRIWKDC-DDDWECCAVLNGHE 199
            +L+S+  D  VR+WK    ++++C +V+   +
Sbjct: 317 TILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ 349

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 71/294 (24%), Positives = 122/294 (41%), Gaps = 54/294 (18%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           + +A+ P    +    F ST+ +W         +  + T LL   E HE  ++ + +   
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW---------DYRMGT-LLHRFEDHEGPVRGLDFHPT 64

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
             +  +   D ++ +W  D      +C+  L  H   V+ V +H+ LP + S+S D T+R
Sbjct: 65  QPIFVSAGDDYTIKVWSLDTN----KCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIR 120

Query: 181 IWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           IW     +W+     A L GH   V  + F  ++    + S S D T+RIW +      +
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCAQFHPTDD--LIVSASLDETIRIWDISGLRKRH 173

Query: 238 ---------EQEWIQESILP------------KAHTRAVYSVNWSPKGYIASTGSDGRLV 276
                    EQ   Q+++L             + HTR V   ++ P   +  +GSD R V
Sbjct: 174 SAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQV 233

Query: 277 -IYKES-EDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +++ S    W V+           TN V  V +      L+I+ G+D  + VW
Sbjct: 234 KLWRMSATKAWEVDTCRG------HTNNVDSVIFHPHQN-LIISVGEDKTLRVW 280

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 75/205 (36%), Gaps = 40/205 (19%)

Query: 16  KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQ-IIEELDD-----------------TAHK 57
           K WS+D N      TG  D    +   R    II   DD                 T H 
Sbjct: 78  KVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHN 137

Query: 58  KTVRSVAWRPHSNILAAGSFDSTVSIW----------GKDDDGYNDENDLETELLA---- 103
             V    + P  +++ + S D T+ IW                + ++   +  LL     
Sbjct: 138 HFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLG 197

Query: 104 ------IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
                 I+EGH   +   ++     L+ + S D+ V +W      + +E +   + H+ +
Sbjct: 198 DCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSAT-KAWE-VDTCRGHTNN 255

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIW 182
           V  VI+H    L+ S   D T+R+W
Sbjct: 256 VDSVIFHPHQNLIISVGEDKTLRVW 280

 Score = 38.1 bits (87), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 1/98 (1%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ +GS DR++KL  + + +  E      H   V SV + PH N++ +   D T+ +W  
Sbjct: 223 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDL 282

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           D      +   E +   +I  H + I     +HD  ++
Sbjct: 283 DKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIM 319

 Score = 33.9 bits (76), Expect = 0.21,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWS 204
           ++  +  S   K + +H S P +  + +  T+++W     D+    +L+    HEG V  
Sbjct: 4   LTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLW-----DYRMGTLLHRFEDHEGPVRG 58

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
            DF  +       S  DD T+++W L+ +   Y
Sbjct: 59  LDFHPTQP--IFVSAGDDYTIKVWSLDTNKCLY 89

 Score = 28.5 bits (62), Expect = 9.5,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 36/86 (41%), Gaps = 8/86 (9%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H + V   ++ P   ++ +GS D  V +W          +  +   +    GH N +  
Sbjct: 207 GHTRGVNWASFHPTLPLIVSGSDDRQVKLW--------RMSATKAWEVDTCRGHTNNVDS 258

Query: 115 VAWSHDGELLATCSRDKSVWIWEADE 140
           V +     L+ +   DK++ +W+ D+
Sbjct: 259 VIFHPHQNLIISVGEDKTLRVWDLDK 284

>Scas_624.11
          Length = 1205

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 77/302 (25%), Positives = 123/302 (40%), Gaps = 67/302 (22%)

Query: 8   KSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP 67
           K +A H  + W +      +    ST   I+L D R   ++   +D  H+  VRSV + P
Sbjct: 15  KGIAFHPSRPWVL------VALFSST---IQLWDYRMGTLLHRFED--HEGPVRSVDFHP 63

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLAT 126
              I  +G  D T+ +W            LET + L  + GH + I+ V +  +   + +
Sbjct: 64  TQPIFVSGGDDYTIKVW-----------SLETNKCLYTLNGHLDYIRTVFFHKELPWIIS 112

Query: 127 CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW---- 182
            S D+++ IW      E    I+ L  H+  V    +H +  L+ S+S D+T+R+W    
Sbjct: 113 ASDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISG 168

Query: 183 ----------KDCDDDW------------ECCA--VLNGH-EGTVWSSDFEKSNSNVRLC 217
                        DD              +C    +L GH  G  W+S F  +   +   
Sbjct: 169 LRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWAS-FHPTLPMI--V 225

Query: 218 SGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP-KGYIASTGSDGRLV 276
           SGSDD  V++W       +Y      E    + HT  V  V + P + +I S G D  L 
Sbjct: 226 SGSDDRQVKLW-------KYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLR 278

Query: 277 IY 278
           I+
Sbjct: 279 IW 280

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 69/294 (23%), Positives = 119/294 (40%), Gaps = 54/294 (18%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           + +A+ P    +    F ST+ +W         +  + T LL   E HE  ++ V +   
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLW---------DYRMGT-LLHRFEDHEGPVRSVDFHPT 64

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
             +  +   D ++ +W      E  +C+  L  H   ++ V +H+ LP + S+S D T+R
Sbjct: 65  QPIFVSGGDDYTIKVWSL----ETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIR 120

Query: 181 IWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE------ 231
           IW     +W+     A L GH   V  + F  ++  V   S S D T+R+W +       
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCAQFHPTDDLV--VSASLDETIRVWDISGLRKKH 173

Query: 232 --------DDNGEYEQEWIQE-------SILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
                   DD    +Q  +           + + HTR V   ++ P   +  +GSD R V
Sbjct: 174 SAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQV 233

Query: 277 -IYK-ESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            ++K  S   W V+           TN V  V +      +L + G+D  + +W
Sbjct: 234 KLWKYNSTKAWEVDTCRG------HTNNVDCVIFHPTQKFIL-SVGEDKTLRIW 280

 Score = 39.7 bits (91), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWS 204
           ++  +  S   K + +H S P +  + +  T+++W     D+    +L+    HEG V S
Sbjct: 4   LTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLW-----DYRMGTLLHRFEDHEGPVRS 58

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
            DF  +       SG DD T+++W LE +   Y
Sbjct: 59  VDFHPTQP--IFVSGGDDYTIKVWSLETNKCLY 89

 Score = 37.4 bits (85), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H + V   ++ P   ++ +GS D  V +W      YN     E +      GH N + C
Sbjct: 207 GHTRGVNWASFHPTLPMIVSGSDDRQVKLWK-----YNSTKAWEVD---TCRGHTNNVDC 258

Query: 115 VAWSHDGELLATCSRDKSVWIWEADE 140
           V +    + + +   DK++ IW+ D+
Sbjct: 259 VIFHPTQKFILSVGEDKTLRIWDLDK 284

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 40/98 (40%), Gaps = 1/98 (1%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ +GS DR++KL    S +  E      H   V  V + P    + +   D T+ IW  
Sbjct: 223 MIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDL 282

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           D      +   E +   +I  H N I     +HD  ++
Sbjct: 283 DKRIPVKQFKRENDRFWLIASHPN-INLFGAAHDAGIM 319

>Kwal_56.24526
          Length = 1210

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 71/294 (24%), Positives = 121/294 (41%), Gaps = 54/294 (18%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           + +A+ P    +    F S++ +W         +  + T LL   E HE  ++ + +   
Sbjct: 15  KGLAFHPSRPWVLVALFSSSIQLW---------DYRMGT-LLHKFEDHEGPVRGIDFHPT 64

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
             L  +   D ++ +W  D      +C+  L  H   V+ V +H+ LP + S+S D T+R
Sbjct: 65  QPLFVSAGDDYTIKVWSLDTK----KCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIR 120

Query: 181 IWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           IW     +W+     A L GH   V  +DF  +   V   S S D TVR+W +      +
Sbjct: 121 IW-----NWQNRKEIACLTGHNHFVMCADFHPTEDLV--VSASLDETVRVWDISGLRKRH 173

Query: 238 ---------EQEWIQESILP------------KAHTRAVYSVNWSPK-GYIASTGSDGRL 275
                    +Q   Q+++L             + H+R V   ++ P    I S G D ++
Sbjct: 174 SAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQV 233

Query: 276 VIYK-ESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            +++  S   W V+           TN V  V +      L+I+ G+D  V VW
Sbjct: 234 KLWRMSSTKAWEVDTCRG------HTNNVDSVIFHPHQN-LIISVGEDKTVRVW 280

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 40/175 (22%), Positives = 74/175 (42%), Gaps = 28/175 (16%)

Query: 30  TGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDD 89
           + S D+ I++ + ++ + I  L  T H   V    + P  +++ + S D TV +W  D  
Sbjct: 112 SASDDQTIRIWNWQNRKEIACL--TGHNHFVMCADFHPTEDLVVSASLDETVRVW--DIS 167

Query: 90  GYNDEND------LETELLA----------------IIEGHENEIKCVAWSHDGELLATC 127
           G    +       LE ++ A                I+EGH   +   ++     L+ + 
Sbjct: 168 GLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSG 227

Query: 128 SRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
             D+ V +W      + +E +   + H+ +V  VI+H    L+ S   D TVR+W
Sbjct: 228 GDDRQVKLWRMSST-KAWE-VDTCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVW 280

 Score = 40.4 bits (93), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 1/98 (1%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ +G  DR++KL  + S +  E      H   V SV + PH N++ +   D TV +W  
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDL 282

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           D      +   E +   ++  H N I     +HD  ++
Sbjct: 283 DKRTPVKQFKRENDRFWLVRAHPN-INLFGAAHDSGIM 319

 Score = 28.9 bits (63), Expect = 8.0,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 35/86 (40%), Gaps = 8/86 (9%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H + V   ++ P   ++ +G  D  V +W          +  +   +    GH N +  
Sbjct: 207 GHSRGVNWASFHPTLPLIVSGGDDRQVKLW--------RMSSTKAWEVDTCRGHTNNVDS 258

Query: 115 VAWSHDGELLATCSRDKSVWIWEADE 140
           V +     L+ +   DK+V +W+ D+
Sbjct: 259 VIFHPHQNLIISVGEDKTVRVWDLDK 284

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 69/150 (46%), Gaps = 16/150 (10%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH+K + +++  P+ +I A  S+D T  +W  D            E +A +  H+  +  
Sbjct: 493 AHEKDINAISMAPNDSIFATASYDKTCKLWNVDTG----------EPVATLANHKRGLWD 542

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           V++    + +ATCS DK+V IW      E F  +  L+ H+  V+   +      L S+ 
Sbjct: 543 VSFCESEKWIATCSGDKTVKIWSL----ESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAG 598

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWS 204
            D  +++W     D  C   L+GH   +W+
Sbjct: 599 ADGLIKVWDIASGD--CIKNLDGHSNRIWA 626

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 90/249 (36%), Gaps = 74/249 (29%)

Query: 89  DGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECI 148
           D    + DL  E+  + EGH + +  +A + DG+ LAT S+DK+  +W  +   + F   
Sbjct: 371 DADTQDTDLPIEV-NLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIY 429

Query: 149 SVLQEHSQDV--------------KHVIWHQS------------------LPLLASSS-- 174
           +    H+  V              K++I   +                  +P +  SS  
Sbjct: 430 ATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIY 489

Query: 175 -------------------------YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEK 209
                                    YD T ++W    D  E  A L  H+  +W   F +
Sbjct: 490 TRHAHEKDINAISMAPNDSIFATASYDKTCKLWN--VDTGEPVATLANHKRGLWDVSFCE 547

Query: 210 SNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK-GYIAS 268
           S   +  CSG  D TV+IW LE        E          HT AV   ++  K   + S
Sbjct: 548 SEKWIATCSG--DKTVKIWSLESFTVLKTLE---------GHTNAVQRCSFMNKQKQLVS 596

Query: 269 TGSDGRLVI 277
            G+DG + +
Sbjct: 597 AGADGLIKV 605

>Kwal_27.12053
          Length = 755

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 96/217 (44%), Gaps = 28/217 (12%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H  TV S ++ P +  L + S D TV +W  D   Y          L   +GH + I  
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDT--YTS--------LVNYKGHNHPIWD 529

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           VA+S  G   AT S D++  +W  D +      + +   H  DV  V +H +   + + S
Sbjct: 530 VAFSPLGHYFATASHDQTARLWSCDHI----YPLRIFAGHLNDVDTVSFHPNGTYVFTGS 585

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDN 234
            D T R+W     D     +  GH   V S+    S     L +GS+DG + +W +    
Sbjct: 586 SDKTCRMWDITSGD--SVRLFLGHTAPVTSTAV--SPDGRWLSTGSEDGVINVWDI--GT 639

Query: 235 GEYEQEWIQESILPKAHTR-AVYSVNWSPKGYIASTG 270
           G+  ++        + H + AVYS+++S +G++  +G
Sbjct: 640 GKRLKQM-------RGHGKNAVYSLSYSKEGHVLISG 669

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 118/268 (44%), Gaps = 40/268 (14%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETEL-----LAIIEGHENEIKCVAWSHDGELLA 125
           + AAG  DS + IW  D  G   +N L ++         + GH   +   ++S D   L 
Sbjct: 441 LAAAGFQDSIIKIWSLD--GEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLL 498

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PL---LASSSYDDTVRI 181
           + S DK+V +W  D     +  +   + H+    H IW  +  PL    A++S+D T R+
Sbjct: 499 SASEDKTVRLWSTD----TYTSLVNYKGHN----HPIWDVAFSPLGHYFATASHDQTARL 550

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
           W  CD  +    +  GH   V +  F  + + V   +GS D T R+W +   +G+  + +
Sbjct: 551 W-SCDHIYP-LRIFAGHLNDVDTVSFHPNGTYV--FTGSSDKTCRMWDIT--SGDSVRLF 604

Query: 242 IQESILPKAHTRAVYSVNWSPKGYIASTGS-DGRLVIYKESEDGWIVECIHELTHGVYET 300
           +        HT  V S   SP G   STGS DG + ++   + G          HG    
Sbjct: 605 L-------GHTAPVTSTAVSPDGRWLSTGSEDGVINVW---DIGTGKRLKQMRGHG---K 651

Query: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328
           N V  + Y SK+  +LI+ G D  V VW
Sbjct: 652 NAVYSLSY-SKEGHVLISGGADHSVRVW 678

>Kwal_56.24596
          Length = 294

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 73/163 (44%), Gaps = 11/163 (6%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           ++ I   H   I      + G+ LATCS DK++ I+E +  GE  + +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLVETLHGHEGPVWQ 58

Query: 161 VIW-HQSLP-LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           V W H     +LAS SYD  V IWK+ +  W   AV   H  +V S  +        L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLA 118

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWS 261
            S DG V +        E+++      IL  AH+  V + +W+
Sbjct: 119 ASSDGKVSV-------VEFKENGTTSPILVDAHSIGVNTASWA 154

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 18/190 (9%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF 207
           +++   H++ +   +       LA+ S D T++I++   +  +    L+GHEG VW  D+
Sbjct: 2   VTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDW 61

Query: 208 EKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY-- 265
                 V L S S DG V IW  +++NG + Q  +        H+ +V SV W+P  Y  
Sbjct: 62  AHPKFGVILASCSYDGKVLIW--KEENGRWTQIAVH-----AVHSASVNSVQWAPHEYGP 114

Query: 266 -IASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYG------SKDVILLIT 318
            + +  SDG++ + +  E+G     I    H +   N   W          S+ +   +T
Sbjct: 115 LLLAASSDGKVSVVEFKENG-TTSPILVDAHSI-GVNTASWASAALQGGAVSQQMRRFVT 172

Query: 319 AGDDGHVNVW 328
            G D  V VW
Sbjct: 173 GGADNLVKVW 182

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 102/255 (40%), Gaps = 32/255 (12%)

Query: 5   KLLKSLALHDDKCWSVD---VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVR 61
           KL+++L  H+   W VD      G I+A+ S D K+ +    + +  +      H  +V 
Sbjct: 44  KLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVN 103

Query: 62  SVAWRPH--SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAW-- 117
           SV W PH    +L A S D  VS+    ++G        T    +++ H   +   +W  
Sbjct: 104 SVQWAPHEYGPLLLAASSDGKVSVVEFKENG--------TTSPILVDAHSIGVNTASWAS 155

Query: 118 --------SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL 169
                   S       T   D  V +W+ +     +     L+ H+  V+ V W  S+ L
Sbjct: 156 AALQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHTDWVRDVAWSPSVLL 215

Query: 170 ---LASSSYDDTVRIWKDCDDDWECCAVL---NGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
              LAS S D T  IW   ++       L   +     +W + +  S + + L  G  D 
Sbjct: 216 RSYLASVSQDRTCIIWTQENNQGPWKKTLLKEDKFSDVLWRASWSLSGNILALSGG--DN 273

Query: 224 TVRIWCLEDDNGEYE 238
            V +W  E+  G++E
Sbjct: 274 KVTLWK-ENLEGKWE 287

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 99/207 (47%), Gaps = 27/207 (13%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +  GS D K+++ +  + + + E +  AH   +RS+A  P    +  GS D T+ +W   
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFE--AHPDYIRSIAVHPTKPFVLTGSDDLTIKLW--- 124

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFE 146
               N E +   +      GHE+ +  VA++  D    A+   D ++ +W    +G++  
Sbjct: 125 ----NWEKNWGCQ--QTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVW---SIGQDVP 175

Query: 147 CISVLQEHSQDVKHVIWH--QSLPLLASSSYDDTVRIWKDCDDDWEC---CAVLNGHEGT 201
             ++    ++ V +V ++  Q  P L ++S D T+++W     D++     A L GH   
Sbjct: 176 NFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVW-----DYQTKSNVATLEGHMAN 230

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           V  + F  +   +   SGS+DGT++IW
Sbjct: 231 VSYAVFHPTLPII--ISGSEDGTLKIW 255

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 100/238 (42%), Gaps = 45/238 (18%)

Query: 7   LKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVD-------IRSFQIIEELDDTAHKKT 59
           ++S+A+H  K +         + TGS D  IKL +        ++F        T H+  
Sbjct: 100 IRSIAVHPTKPF---------VLTGSDDLTIKLWNWEKNWGCQQTF--------TGHEHF 142

Query: 60  VRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENE-IKCVAW 117
           V SVA+ P   N  A+G  D T+ +W    D  N            ++ HE + +  V +
Sbjct: 143 VMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPN----------FTLKAHETKGVNYVDY 192

Query: 118 S--HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSY 175
               D   L T S D ++ +W+          ++ L+ H  +V + ++H +LP++ S S 
Sbjct: 193 YPLQDKPYLITTSDDGTIKVWDYQTKSN----VATLEGHMANVSYAVFHPTLPIIISGSE 248

Query: 176 DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
           D T++IW    + ++    LN      W      S     + SG D+G   +  L DD
Sbjct: 249 DGTLKIWN--ANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDNG-FTVLSLGDD 303

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 19/117 (16%)

Query: 216 LCSGSDDGTVRIWCLEDDNGEYEQEW-IQESILPKAHTRAVYSVNWSPK--GYIASTGSD 272
           + +GSDD T+++W        +E+ W  Q++     H   V SV ++PK     AS   D
Sbjct: 112 VLTGSDDLTIKLW-------NWEKNWGCQQTF--TGHEHFVMSVAFNPKDPNQFASGCLD 162

Query: 273 GRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGS-KDVILLITAGDDGHVNVW 328
             + ++   +D      +   T   +ET  V +V+Y   +D   LIT  DDG + VW
Sbjct: 163 HTIKVWSIGQD------VPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVW 213

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 89/191 (46%), Gaps = 29/191 (15%)

Query: 18  WSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDD------------------TAHKK 58
           ++VDV+ +G  +ATG  D KI++  I S     EL+                   + H  
Sbjct: 21  YTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTG 80

Query: 59  TVRSVAWRPHSNILAAGSFDSTVSIWGKDDD-----GYNDENDLET-ELLAIIEGHENEI 112
           ++  V + P    LA+GS D  + IW  D++      +  E++ E   +   +  H+N+I
Sbjct: 81  SITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDI 140

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLAS 172
           + + W+ D  +L T   D+SV +W     G  FE +     H   VK V++  +    A+
Sbjct: 141 QDICWAPDSSILVTVGLDRSVIVWN----GSTFEKLKRFDVHQSLVKGVVFDPANKYFAT 196

Query: 173 SSYDDTVRIWK 183
           +S D T++I++
Sbjct: 197 TSDDRTMKIFR 207

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 82/217 (37%), Gaps = 28/217 (12%)

Query: 72  LAAGSFDSTVSIWGKDD-------DGYNDENDLETEL---LAIIEGHENEIKCVAWSHDG 121
           LA G  D  + IW  D        +    E  L  +L   L  +  H   I CV +S DG
Sbjct: 32  LATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFSPDG 91

Query: 122 ELLATCSRDKSVWIWEADE-------MGEEFE-----CISVLQEHSQDVKHVIWHQSLPL 169
           + LA+ S D+ + IW  DE        G E E         L  H  D++ + W     +
Sbjct: 92  KYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSI 151

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           L +   D +V +W      +E     + H+  V    F+ +N      + SDD T++I+ 
Sbjct: 152 LVTVGLDRSVIVWNGS--TFEKLKRFDVHQSLVKGVVFDPANK--YFATTSDDRTMKIFR 207

Query: 230 LED--DNGEYEQEWIQESILPKAHTRAVYSVNWSPKG 264
                D     +  I E       T      +WSP G
Sbjct: 208 YHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDG 244

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 69/180 (38%), Gaps = 39/180 (21%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           E  + EI  V  SHDG+ LAT   D  + IW  D +    E  S+  E            
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPE------------ 61

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
            +PL                D     C+ ++ H G++    F  S     L SGSDD  +
Sbjct: 62  -IPLPQ--------------DLQMPLCS-MSRHTGSITCVKF--SPDGKYLASGSDDRIL 103

Query: 226 RIWCLEDDN-------GEYEQE-WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
            IW L+++         E+E+E W     L  AH   +  + W+P   I  T    R VI
Sbjct: 104 LIWALDEEQSSQPAFGSEHEREHWTVRKRL-VAHDNDIQDICWAPDSSILVTVGLDRSVI 162

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH   ++ + W P S+IL     D +V +W          N    E L   + H++ +K 
Sbjct: 135 AHDNDIQDICWAPDSSILVTVGLDRSVIVW----------NGSTFEKLKRFDVHQSLVKG 184

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEH 154
           V +    +  AT S D+++ I+   + G+    IS   EH
Sbjct: 185 VVFDPANKYFATTSDDRTMKIFRYHKTGD----ISFTIEH 220

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 13  HDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNIL 72
           +DDK    D N   ++AT   D+ + +      + I    D A+K ++  ++W P  ++L
Sbjct: 313 NDDKVHHFDKNIDSVVATAGQDKSLAVWSTSRPRPILVAFDIANK-SITDMSWNPDGSLL 371

Query: 73  AAGSFDSTVSIWGKDDDGYNDENDLETEL 101
              S DS+++++  +++       LE  +
Sbjct: 372 FVASLDSSITLFKFENNELGKPIPLEKNM 400

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 121/276 (43%), Gaps = 49/276 (17%)

Query: 17  CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGS 76
           C+S D   G  +ATG+ DR I++ DI + +I+  L    H++ + S+ + P  + L +GS
Sbjct: 450 CFSPD---GKFLATGAEDRLIRIWDIENRKIVMILQ--GHEQDIYSLDYFPSGDKLVSGS 504

Query: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWI 135
            D TV IW           DL T   ++    E+ +  VA S  DG+ +A  S D++V +
Sbjct: 505 GDRTVRIW-----------DLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRV 553

Query: 136 WEADEMGEEFECISVLQE----HSQDVKHVIWHQSLPLLASSSYDDTVRIWK-------- 183
           W++ E G   E +    E    H   V  V++ +    + S S D +V++W         
Sbjct: 554 WDS-ETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKS 612

Query: 184 --DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
                +   C     GH+  V S     + ++  + SGS D  V  W  +  N       
Sbjct: 613 DSKTPNSGTCEVTYIGHKDFVLS--VATTQNDEYILSGSKDRGVLFWDKKSGN------- 663

Query: 242 IQESILPKAHTRAVYSV---NWSPKGY---IASTGS 271
               ++ + H  +V SV   N SP G    + +TGS
Sbjct: 664 --PLLMLQGHRNSVISVAVANGSPLGPEYNVFATGS 697

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 19  SVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDD-----TAHKKTVRSVAWRPHSNILA 73
           +V   +G  +A GS DR +++ D  +  ++E LD      T HK +V SV +      + 
Sbjct: 533 AVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVV 592

Query: 74  AGSFDSTVSIWGKDDDGYNDENDLETELLAIIE----GHENEIKCVAWSHDGELLATCSR 129
           +GS D +V +W   +   N+++D +T      E    GH++ +  VA + + E + + S+
Sbjct: 593 SGSLDRSVKLWNLQN--ANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 650

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL------LASSSYDDTVRIWK 183
           D+ V  W+     +    + +LQ H   V  V      PL       A+ S D   RIWK
Sbjct: 651 DRGVLFWDK----KSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 84/186 (45%), Gaps = 29/186 (15%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWS 118
           +RSV + P    LA G+ D  + IW           D+E  +++ I++GHE +I  + + 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIW-----------DIENRKIVMILQGHEQDIYSLDYF 494

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
             G+ L + S D++V IW+        +C   L          +       +A+ S D  
Sbjct: 495 PSGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 550

Query: 179 VRIW--------KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           VR+W        +  D + E      GH+ +V+S  F +   +V   SGS D +V++W L
Sbjct: 551 VRVWDSETGFLVERLDSENESGT---GHKDSVYSVVFTRDGQSV--VSGSLDRSVKLWNL 605

Query: 231 EDDNGE 236
           ++ N +
Sbjct: 606 QNANNK 611

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 80/167 (47%), Gaps = 14/167 (8%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I+ V +S DG+ LAT + D+ + IW+     E  + + +LQ H QD+  + +  S   L 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDI----ENRKIVMILQGHEQDIYSLDYFPSGDKLV 501

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGHEG--TVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           S S D TVRIW D     +C   L+  +G  TV  S  +       + +GS D  VR+W 
Sbjct: 502 SGSGDRTVRIW-DL-RTGQCSLTLSIEDGVTTVAVSPGDGK----YIAAGSLDRAVRVW- 554

Query: 230 LEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
            + + G   +    E+     H  +VYSV ++  G    +GS  R V
Sbjct: 555 -DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

>Kwal_56.23920
          Length = 937

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 106/254 (41%), Gaps = 42/254 (16%)

Query: 1   MAGLKLLKSL-ALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEE----LDDT 54
           +A   LL ++   H    WS+D+  +G  + TGS D+ +   D   FQ+ +E      D 
Sbjct: 453 LASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWD---FQVEQEPVPGTTDK 509

Query: 55  AHKKT-------------VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETEL 101
            + K              V +V   P + +LA    D+TV ++  D            + 
Sbjct: 510 FNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMD----------SMKF 559

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF-ECISVLQEHSQDVKH 160
              + GH+  +  +  S D +LL T S DK++ IW     G +F +C   L  H+  +  
Sbjct: 560 FLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW-----GLDFGDCHRSLFAHNDSIMK 614

Query: 161 VIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGS 220
           V++        S S D  V+ W    D +EC   L  H+  VW+     S+    + S S
Sbjct: 615 VVFVPESHNFFSCSKDALVKYWDG--DKFECIQKLAAHQKEVWT--LAISSDGRFVVSAS 670

Query: 221 DDGTVRIWCLEDDN 234
            D ++R+W   DD 
Sbjct: 671 HDQSIRVWSETDDQ 684

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 99/243 (40%), Gaps = 33/243 (13%)

Query: 99  TELLAIIEG-HENEIKCVAWSHDGELLATCSRDKSVWIWE-----------ADEMGEEFE 146
           + LL  IEG H   I  +  + DG+ L T S DK+V  W+            D+   + +
Sbjct: 456 STLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLK 515

Query: 147 CI-SVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSS 205
                  E + DV  V       LLA S  D+TV+++    D  +    L GH+  V S 
Sbjct: 516 MFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVF--FMDSMKFFLSLYGHKLPVLSI 573

Query: 206 DFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY 265
           D   S  +  L + S D  ++IW L  D G+  +          AH  ++  V + P+ +
Sbjct: 574 DI--SFDSKLLITSSADKNIKIWGL--DFGDCHRSLF-------AHNDSIMKVVFVPESH 622

Query: 266 IASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHV 325
              + S   LV Y    DG   ECI +L     E     W    S D   +++A  D  +
Sbjct: 623 NFFSCSKDALVKY---WDGDKFECIQKLAAHQKEV----WTLAISSDGRFVVSASHDQSI 675

Query: 326 NVW 328
            VW
Sbjct: 676 RVW 678

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 93/220 (42%), Gaps = 33/220 (15%)

Query: 11  ALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSN 70
           AL +  CWS+   +G ++ T +       VD +S +  E             + + P + 
Sbjct: 41  ALENVNCWSM--KSGELIGTLTDGLPPGAVDAKSTKPAE----------TSYLQYHPETR 88

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
           +LA G  D  + IW          + L   +L    GH++ I  + +   G  L + SRD
Sbjct: 89  LLAVGYNDGAIKIW----------DLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRD 138

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
             + +W  D +GE    +  L+ H   +   +W +    L S+S D  +++W D     +
Sbjct: 139 SDIIVW--DLVGE--VGLYKLRSHKDSITG-LWCEGEEWLISTSKDGLIKVW-DLKVQ-Q 191

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           C      H G  WS    +   ++ + +G+D+  +++W L
Sbjct: 192 CVETHVAHVGECWSMGVHE---DLVITAGADN-QIKLWNL 227

 Score = 35.0 bits (79), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 77/175 (44%), Gaps = 29/175 (16%)

Query: 157 DVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVL---NGHEGTVWSSDFEKSNSN 213
           +  ++ +H    LLA    D  ++IW     D    +VL   NGH+  +    F+++ + 
Sbjct: 77  ETSYLQYHPETRLLAVGYNDGAIKIW-----DLLSKSVLISFNGHKSAITILTFDQTGT- 130

Query: 214 VRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDG 273
            RL SGS D  + +W L  + G Y+          ++H  ++  +    + ++ ST  DG
Sbjct: 131 -RLISGSRDSDIIVWDLVGEVGLYKL---------RSHKDSITGLWCEGEEWLISTSKDG 180

Query: 274 RLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            + ++    D  + +C+      V E     W     +D  L+ITAG D  + +W
Sbjct: 181 LIKVW----DLKVQQCVETHVAHVGEC----WSMGVHED--LVITAGADNQIKLW 225

 Score = 35.0 bits (79), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 20/129 (15%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDK-SVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           I GH ++++ +  S D +LLAT S     +W  + +     FEC   L          + 
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYAL------ACKFLP 434

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN----GHEGTVWSSDFEKSNSNVRLCSG 219
             +L +L + + D  + ++     D     +LN     H G +WS D   +    RL +G
Sbjct: 435 GGALVVLGTKTGD--LHLY-----DLASSTLLNTIEGAHSGAIWSLDM--TTDGKRLVTG 485

Query: 220 SDDGTVRIW 228
           S D TV  W
Sbjct: 486 SADKTVCFW 494

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 102/252 (40%), Gaps = 39/252 (15%)

Query: 1   MAGLKLLKSLALHDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEEL-------- 51
           +A   LL +   H    WS+D+ +NG  + TGS D+  K  D   F+++E+L        
Sbjct: 451 LASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWD---FEVVEQLVPGTKDKY 507

Query: 52  -------DDTAHKKT--VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELL 102
                   DT  + T  + +V        LA    D+TV ++  D            +  
Sbjct: 508 IPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDS----------LKFY 557

Query: 103 AIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
             + GH+  +  + +S D ++L T S DK++ IW  D  G+   C   +  H   +  V 
Sbjct: 558 LSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD-FGD---CHKSIFAHQDSIMSVR 613

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           +        S   D  V+ W    D ++C   LNGH+  VW          V   S S D
Sbjct: 614 FEADTHNFFSCGKDGAVKRWDG--DKFDCIQKLNGHQSEVWCIAVSPDGRTV--VSTSHD 669

Query: 223 GTVRIWCLEDDN 234
            ++R+W   DD 
Sbjct: 670 HSIRVWQETDDQ 681

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 98/243 (40%), Gaps = 49/243 (20%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSR-DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           ++GH  +I+ +  S DG+LL+T S  +  VW     +    F C            + + 
Sbjct: 379 LQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSC-----------GYALC 427

Query: 164 HQSLP---LLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWSSDFEKSNSNVRLC 217
            Q LP   L+   +    ++++     D     +L+    H   +WS D   +++  RL 
Sbjct: 428 SQMLPGGLLVVVGTRQGELQLF-----DLASSTLLSTTEAHTAAIWSLDL--TSNGKRLV 480

Query: 218 SGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
           +GS D + + W  E          + E ++P    + +  +       +  T  D  L +
Sbjct: 481 TGSADKSCKFWDFE----------VVEQLVPGTKDKYIPQLKLVHDTTLELT--DDILAV 528

Query: 278 YKESEDGWIVECIHELTHGVYETNMVKWV--EYGSK----------DVILLITAGDDGHV 325
              SED ++   + + T  V+  + +K+    YG K          D  +LIT+  D ++
Sbjct: 529 KISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNI 588

Query: 326 NVW 328
            +W
Sbjct: 589 KIW 591

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 75/186 (40%), Gaps = 21/186 (11%)

Query: 53  DTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112
           + +    V ++ +   + +L  G  D  + +W          + L   +L    GH++ +
Sbjct: 69  NISKPSVVTAMCFHKETELLCVGYEDGVIKVW----------DLLSKSVLMQFNGHKSGV 118

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLAS 172
             +    +G  L + S+D  + IW  D +GE    +  L+ H   +  +    ++  L S
Sbjct: 119 TVLRLDSEGTRLVSGSKDSDLIIW--DLVGE--VGLMKLRSHKDAITGIWIDHNMDWLIS 174

Query: 173 SSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC--L 230
            + D  +++W D     +C      H G  WS   ++      + + S D   +IW   L
Sbjct: 175 VAKDGLIKVW-DLKAGGQCVETHMAHTGQCWSMAIDEE----VIITTSMDSQAKIWELDL 229

Query: 231 EDDNGE 236
           E  NGE
Sbjct: 230 EKSNGE 235

>Scas_585.8
          Length = 460

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/297 (19%), Positives = 115/297 (38%), Gaps = 89/297 (29%)

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
           K  + ++ W P    L   +++   S+W  +   +N+         ++++ H++ + C+ 
Sbjct: 90  KHVIPAITWTPEGRRLVVATYNGEFSLW--NGTSFNE---------SLMQAHDSAVSCIQ 138

Query: 117 WSHDGELLATCSRDKSVWIWEAD-EMGEEFE-----CIS--------------------- 149
           +SH G+ + +   D  + IW+ +  M +EFE     CI                      
Sbjct: 139 YSHAGDWMCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLK 198

Query: 150 -----------VLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGH 198
                       L  H  D+K   WH  + L+ S+S D+ V++W       +C + +   
Sbjct: 199 IWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWD--PRSGQCISTIIKF 256

Query: 199 EGTVWSSDFEKSNSNVRLCSGSDDGTVRIW----------CLEDDNGEYEQEW--IQES- 245
           + TV  + F+ +  N+ L + S D + R++          C+ D+       W  I ES 
Sbjct: 257 KHTVLKTRFQPTRGNL-LAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPINESM 315

Query: 246 ------------------------ILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIY 278
                                   ++P AH + V S+ ++P G I ++ S  R + +
Sbjct: 316 FTVGNYDGAMKYFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTIRF 372

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 24  NGGIMATGSTDRKIKLVDI-RSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVS 82
           N  +   G+ D  +K  D+ +  +    +   AH K V S+A+ P  NILA+ S D T+ 
Sbjct: 312 NESMFTVGNYDGAMKYFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTIR 371

Query: 83  IWGK---------DDDGYNDE 94
            W +         DD  YN+E
Sbjct: 372 FWTRAKPVDPNAYDDPTYNNE 392

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-HSNILAAGSFDSTVSI 83
           G ++A  S D+  ++ DIR    ++EL     +    ++ W P + ++   G++D  +  
Sbjct: 270 GNLLAAISKDKSCRVFDIR--HSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKY 327

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
                  ++   DLE     I   H+  +  +A++  G +LA+ S+D+++  W
Sbjct: 328 -------FDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTIRFW 373

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 84/208 (40%), Gaps = 19/208 (9%)

Query: 23  NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVS 82
           NN     T S D  +K+ +  + Q+   L  + H   ++S  W P   ++ + S D+ V 
Sbjct: 183 NNDSKFVTCSDDNVLKIWNFSNGQVERTL--SGHHWDIKSCDWHPEMGLIVSASKDNLVK 240

Query: 83  IWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMG 142
           +W        D    +  +  II+     +K       G LLA  S+DKS  +++     
Sbjct: 241 LW--------DPRSGQC-ISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSM 291

Query: 143 EEFECISVLQEHSQDVKHVIWHQ-SLPLLASSSYDDTVRIWKDCDD-DWECCAVLNGHEG 200
           +E  C+        D   + W+  +  +    +YD  ++ +    D +     +   H+ 
Sbjct: 292 KELMCV----RDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIPYAHDK 347

Query: 201 TVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            V S  +  +  N+ L S S D T+R W
Sbjct: 348 CVTSMAYNPA-GNI-LASASKDRTIRFW 373

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 105/251 (41%), Gaps = 21/251 (8%)

Query: 5   KLLKSLALHDDKCWSVD-VNNGGIMATGSTDRKIKLVDIRSF--QIIEELDDTAHKKTVR 61
           K++ +L  H+   +S+D   +G  + +GS DR +++ D+ +    +   ++D      V 
Sbjct: 439 KIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDG-----VT 493

Query: 62  SVAWRP-HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           +VA  P     +AAGS D TV +W  D     +  D E EL     GH + +  V ++ D
Sbjct: 494 TVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT---GHRDSVYSVVFTRD 550

Query: 121 GELLATCSRDKSVWIWEADEMGEE---FECISVLQEHSQDVKHVIWHQSLPLLASSSYDD 177
           G+ + + S D+SV +W  + +  +    EC      H   V  V   Q+   + S S D 
Sbjct: 551 GKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDR 610

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR----LCSGSDDGTVRIWCLEDD 233
            V  W           +L GH  +V S      +          +GS D   RIW     
Sbjct: 611 GVLFWD--TKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYSKK 668

Query: 234 NGEYEQEWIQE 244
           N +     I+E
Sbjct: 669 NSQQNSTQIKE 679

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 79/167 (47%), Gaps = 14/167 (8%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I+ V +S DG+ LAT + DK + IW+     E  + +  L+ H QD+  + +  S   L 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDL----ETKKIVMTLKGHEQDIYSLDYFPSGNKLV 464

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGHEG--TVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           S S D TVRIW        C   L+  +G  TV  S  E       + +GS D TVR+W 
Sbjct: 465 SGSGDRTVRIWDLT--TGTCSLTLSIEDGVTTVAVSPGEGK----FIAAGSLDRTVRVW- 517

Query: 230 LEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
            + D G   +    E+ L   H  +VYSV ++  G    +GS  R V
Sbjct: 518 -DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSV 563

>Scas_652.16
          Length = 345

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 89/201 (44%), Gaps = 33/201 (16%)

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--H 164
           GHE+ I  V +   G  +ATCS D+ + +++ D+   E+E     + H   +  V W   
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 165 QSLPLLASSSYDDTVRIWKDCDDD-------WECCAVLNGHEGTVWSSDFEKSNSNVRLC 217
           +   ++ S+SYD TV++W++  D        W     LN  +G++++  F   +  ++L 
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLA 129

Query: 218 SGSDDGTVRIW-CLEDDNGEYEQEWIQES------ILPKAHTRAVYSVNWSPKGY----- 265
              +D T+RI+  LE  +    + W   S      + P  H ++ + + W P  +     
Sbjct: 130 CIGNDATLRIYEALEPSD---LRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKL 186

Query: 266 ---------IASTGSDGRLVI 277
                    I   G DG+L I
Sbjct: 187 VVSTLDQASIYQRGKDGKLYI 207

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/335 (25%), Positives = 139/335 (41%), Gaps = 59/335 (17%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDT--AHK 57
           MAG+K   S   H+D    V  +  G  +AT S+D+ IK+  +       EL D+  AH 
Sbjct: 1   MAGMKPFNSG--HEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHD 58

Query: 58  KTVRSVAWRP--HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAI--IEGHENEIK 113
            ++ SV W    +  I+ + S+D TV +W +D D         T+L  +   +G    +K
Sbjct: 59  SSIVSVDWASPEYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVK 118

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADE--------MGEEFECISVLQ-EHSQDVKHVIW- 163
             A  H G  LA    D ++ I+EA E        +  E + + V    H Q    + W 
Sbjct: 119 -FAPPHLGLKLACIGNDATLRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWC 177

Query: 164 --HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR----LC 217
               S   L  S+ D      +  D      A LNGH+G +   D   + S  R    + 
Sbjct: 178 PSRFSPEKLVVSTLDQASIYQRGKDGKLYIVAKLNGHKGLI--RDISWAPSIGRWYHLIA 235

Query: 218 SGSDDGTVRIWCL-------------------EDDNGEYEQEWIQESILPKA-------- 250
           +G  DG +RI+ L                   ED + E   E  ++S+L  +        
Sbjct: 236 TGCKDGKLRIFRLVEKLSDNSSKDAINDSYDDEDVDMEDIAENKEKSLLGSSVSVELLSE 295

Query: 251 ---HTRAVYSVNWSPKGYI-ASTGSDGRLVIYKES 281
              H   ++SV+W+  G I +S G DG++ ++K +
Sbjct: 296 HDDHNAEIWSVSWNLTGTILSSAGDDGKVRLWKST 330

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 67/144 (46%), Gaps = 36/144 (25%)

Query: 45  FQIIEELDDTAHKKTVRSVAWRPH----SNILAAGSFDSTVSIW----------GKD--D 88
             I+ +L+   HK  +R ++W P      +++A G  D  + I+           KD  +
Sbjct: 205 LYIVAKLN--GHKGLIRDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNSSKDAIN 262

Query: 89  DGYNDEN-DLE----------------TELLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
           D Y+DE+ D+E                 ELL+  + H  EI  V+W+  G +L++   D 
Sbjct: 263 DSYDDEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNLTGTILSSAGDDG 322

Query: 132 SVWIWEADEMGEEFECISVLQEHS 155
            V +W++     EF+C+SV+  +S
Sbjct: 323 KVRLWKS-TYSNEFKCMSVITSNS 345

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (51%), Gaps = 16/130 (12%)

Query: 105 IEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
            EGHE+ + CVA++  D    A+   D +V IW    +G++    ++    ++ V  V +
Sbjct: 18  FEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWS---LGQQSPNFTMTAHETRGVNFVDY 74

Query: 164 H--QSLPLLASSSYDDTVRIWKDCDDDWE---CCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           +  Q  P L +SS D +V+IW     D++   C A L GH   V  + F  S   +   S
Sbjct: 75  YPLQDKPYLITSSDDRSVKIW-----DYQTKSCVATLEGHMANVSYAIFHPSLPII--IS 127

Query: 219 GSDDGTVRIW 228
           GS+DGTV+IW
Sbjct: 128 GSEDGTVKIW 137

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 58/132 (43%), Gaps = 18/132 (13%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENE-I 112
            H+  V  VA+ P   N  A+   D TV IW       N            +  HE   +
Sbjct: 20  GHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPN----------FTMTAHETRGV 69

Query: 113 KCVAWS--HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLL 170
             V +    D   L T S D+SV IW+         C++ L+ H  +V + I+H SLP++
Sbjct: 70  NFVDYYPLQDKPYLITSSDDRSVKIWDYQTKS----CVATLEGHMANVSYAIFHPSLPII 125

Query: 171 ASSSYDDTVRIW 182
            S S D TV+IW
Sbjct: 126 ISGSEDGTVKIW 137

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 109/253 (43%), Gaps = 35/253 (13%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           +     GHE+ +  + +   G  +ATCS D+ + ++  D+   E+      + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 161 VIW--HQSLPLLASSSYDDTVRIWKDCDD-------DWECCAVLNGHEGTVWSSDFEKSN 211
           + W   +   +LAS SY+ T+++W++  D        W     LN   G ++S  F   +
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 212 SNVRLCSGSDDGTVRIW-CLEDDNGEYEQEWIQES------ILPKAHTRAVYSVNWSPKG 264
             +RL +  +DG +RI+  LE  +    + W   S        P +H ++ +S++W P  
Sbjct: 121 LGLRLGAIGNDGVLRIYDALEPSD---LRSWTLTSEVKVLATPPASHLQSDFSLDWCPSR 177

Query: 265 YIASTGSDGRLV--------IYKESEDGWIVECIHELTH-GVYETNMVKWVEYGSKDVIL 315
           + A      RLV        +Y+ ++ G + +      H G+  +  V W     +   L
Sbjct: 178 FSAE-----RLVVCALDQAFVYERNKAGKLFQAARLPGHQGLIRS--VSWAPSFGRWHQL 230

Query: 316 LITAGDDGHVNVW 328
           + T   DG V ++
Sbjct: 231 IATGSKDGRVRIF 243

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 56/128 (43%), Gaps = 20/128 (15%)

Query: 43  RSFQIIEELDDTAHKKTVRSVAWRPH----SNILAAGSFDSTVSIWGKDDD--------- 89
           ++ ++ +      H+  +RSV+W P       ++A GS D  V I+   +          
Sbjct: 198 KAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDAST 257

Query: 90  ------GYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGE 143
                        +  +LL+    H+ E+  V+W+  G +L++   D  V +W++     
Sbjct: 258 DDASTDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKS-SFSN 316

Query: 144 EFECISVL 151
           EF+C+SV+
Sbjct: 317 EFKCMSVI 324

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 117/296 (39%), Gaps = 42/296 (14%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDT--AHKKTVRSVAWRP--HSNILAAGSFDST 80
           G  +AT S+D+ IK+  +        L D+   H  +V ++ W    +  ILA+ S++ T
Sbjct: 21  GRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVALDWASPEYGRILASVSYNKT 80

Query: 81  VSIWGKDDDGYNDENDLETELLAI--IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEA 138
           + +W +D D         T L  +    G    +K  A  H G  L     D  + I++A
Sbjct: 81  IKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVK-FAPGHLGLRLGAIGNDGVLRIYDA 139

Query: 139 DE--------MGEEFECISVLQ-EHSQDVKHVIW---HQSLPLLASSSYDDTVRIWKDCD 186
            E        +  E + ++     H Q    + W     S   L   + D      ++  
Sbjct: 140 LEPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRFSAERLVVCALDQAFVYERNKA 199

Query: 187 DDWECCAVLNGHEGTV----WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD--------- 233
                 A L GH+G +    W+  F + +  +   +GS DG VRI+ L +          
Sbjct: 200 GKLFQAARLPGHQGLIRSVSWAPSFGRWHQLI--ATGSKDGRVRIFQLTEKLDATDDAST 257

Query: 234 -------NGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI-ASTGSDGRLVIYKES 281
                   G      +Q       H   V+SV+W+  G I +S+G DG++ ++K S
Sbjct: 258 DDASTDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSS 313

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 82/190 (43%), Gaps = 44/190 (23%)

Query: 41  DIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD-------DDGYND 93
           D+RS+ +  E         V+ +A  P S++ +  S D   S +  +       D  +  
Sbjct: 144 DLRSWTLTSE---------VKVLATPPASHLQSDFSLDWCPSRFSAERLVVCALDQAFVY 194

Query: 94  ENDLETELL--AIIEGHENEIKCVAWSHDG----ELLATCSRDKSVWIWEADEM------ 141
           E +   +L   A + GH+  I+ V+W+       +L+AT S+D  V I++  E       
Sbjct: 195 ERNKAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDD 254

Query: 142 ------------GEEFECISVLQEHSQ---DVKHVIWHQSLPLLASSSYDDTVRIWKDC- 185
                             + +L EH+    +V  V W+ +  +L+SS  D  VR+WK   
Sbjct: 255 ASTDDASTDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSF 314

Query: 186 DDDWECCAVL 195
            ++++C +V+
Sbjct: 315 SNEFKCMSVI 324

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 138/306 (45%), Gaps = 26/306 (8%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW 84
           G ++  G+ + +++L DI S  +++   + AH   + S+        L  GS D TV  W
Sbjct: 439 GALVVVGTRNGELQLFDIASSTMLDN-KEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW 497

Query: 85  GKD--DDGYNDENDLETELLAIIEGH----ENEIKCVAWSHDGELLATCSRDKSVWIWEA 138
             +  +   +DE++    +L +        +++I  V  S D + +A    D +V ++  
Sbjct: 498 TFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL 557

Query: 139 DEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGH 198
           D M    +    L  H   V  +       L+ + S D  ++IW    D  +C   L  H
Sbjct: 558 DSM----KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW--GLDFGDCHKSLFAH 611

Query: 199 EGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSV 258
           + ++ +  F   + N   CS   D TV+ W    D  ++E   IQ+     AH   V+S+
Sbjct: 612 QDSIMNVKFLPESYNFFSCS--KDATVKYW----DGQKFE--CIQKL---AAHQSEVWSI 660

Query: 259 NWSPKG-YIASTGSDGRLVIYKESEDG-WIVECIHELTHGVYETNMVKWVEYGSKDVILL 316
           + S  G ++ STG D  + +++E+ED  ++ E   +     YE  ++  +E G+ D +L 
Sbjct: 661 SVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720

Query: 317 ITAGDD 322
           +  GD+
Sbjct: 721 VKKGDN 726

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 81/189 (42%), Gaps = 18/189 (9%)

Query: 1   MAGLKLL--KSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKK 58
           M  L+L    +L L DD    V   +   +A    D  +K+  + S +    L    HK 
Sbjct: 514 MPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL--YGHKL 571

Query: 59  TVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS 118
            V S+     S ++   S D  + IWG D        D    L A    H++ I  V + 
Sbjct: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDF------GDCHKSLFA----HQDSIMNVKFL 621

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
            +     +CS+D +V  W+    G++FECI  L  H  +V  +        + S+ +D +
Sbjct: 622 PESYNFFSCSKDATVKYWD----GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHS 677

Query: 179 VRIWKDCDD 187
           +R+W++ +D
Sbjct: 678 IRVWEETED 686

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 96/234 (41%), Gaps = 32/234 (13%)

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSV--WIWEADEMG---EEFECISVLQ-------EH 154
            H+  I  +  + DG  L T S DK+V  W +E  E+    E  + + +LQ       E 
Sbjct: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527

Query: 155 SQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNV 214
             D+  V+       +A S  D+TV+++    D  +    L GH+  V S D    +  +
Sbjct: 528 DDDILSVVISPDDKFIAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGR 274
             CS   D  ++IW L  D G+  +          AH  ++ +V + P+ Y   + S   
Sbjct: 586 VTCSA--DKNIKIWGL--DFGDCHKSLF-------AHQDSIMNVKFLPESYNFFSCSKDA 634

Query: 275 LVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            V Y    DG   ECI +L     E     W    S D   +I+ G D  + VW
Sbjct: 635 TVKY---WDGQKFECIQKLAAHQSEV----WSISVSNDGTFVISTGHDHSIRVW 681

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 98/222 (44%), Gaps = 28/222 (12%)

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAI-IEGHENEIKCVAWSHDG 121
           + + P +N+LAAG  D  + IW           DL ++ + I   GH++ I  +A+   G
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW-----------DLISKTVLISFNGHKSAITVLAFDTTG 133

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
             L + S+D  + +W  D +GE    +  L+ H +D    +W +    L S+S D  V+I
Sbjct: 134 TRLISASKDSDIIVW--DLVGE--SGLYKLRSH-KDAITGLWCEDENWLISTSKDGLVKI 188

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
           W D     +C      H G  WS    +  +     + S D  V++W L D   E   + 
Sbjct: 189 W-DLKSQ-QCVETHLAHTGECWSLGIIEDMA----VTCSADSQVKLWKL-DLQAENGSKL 241

Query: 242 IQESILPKAHTRAVYSVNW--SPKG--YIASTGSDGRLVIYK 279
            ++ I+ K   +    +++  +P G  +     +D  + IY+
Sbjct: 242 TEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYR 283

>Kwal_23.6429
          Length = 750

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 81/185 (43%), Gaps = 29/185 (15%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWS 118
           +RSV + P    LA G+ D  + IW           DL T  ++  ++GHE +I  + + 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW-----------DLATRRIVMTLQGHEQDIYSLDYF 521

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
             G+ L + S D++V IW+        +C   L          +      L+A+ S D T
Sbjct: 522 PSGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRT 577

Query: 179 VRIW--------KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           VRIW        +  D + E      GH+ +V+S  F +    V   SGS D +V++W L
Sbjct: 578 VRIWDSETGFLVERLDSENELG---TGHKDSVYSVVFTRDGHGV--VSGSLDRSVKLWNL 632

Query: 231 EDDNG 235
              NG
Sbjct: 633 RSANG 637

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 94/206 (45%), Gaps = 11/206 (5%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
           ++A  S D++ +  G D      EN   +  +A     +  I+ V +S DG+ LAT + D
Sbjct: 433 LIARLSEDASSAPSGADASA-TSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAED 491

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
           K + IW+          +  LQ H QD+  + +  S   L S S D TVRIW   D    
Sbjct: 492 KLIRIWDLATR----RIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIW---DLRTG 544

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA 250
            C++    E  V +      +  + + +GS D TVRIW  + + G   +    E+ L   
Sbjct: 545 QCSLTLSIEDGVTTVAVSPGDGKL-IAAGSLDRTVRIW--DSETGFLVERLDSENELGTG 601

Query: 251 HTRAVYSVNWSPKGYIASTGSDGRLV 276
           H  +VYSV ++  G+   +GS  R V
Sbjct: 602 HKDSVYSVVFTRDGHGVVSGSLDRSV 627

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 115/262 (43%), Gaps = 28/262 (10%)

Query: 1   MAGLKLLKSLALHDDKCWSVD-VNNGGIMATGSTDRKIKLVDIRSFQ--IIEELDDTAHK 57
           +A  +++ +L  H+   +S+D   +G  + +GS DR +++ D+R+ Q  +   ++D    
Sbjct: 499 LATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG--- 555

Query: 58  KTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
             V +VA  P    ++AAGS D TV IW  +     +  D E EL     GH++ +  V 
Sbjct: 556 --VTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT---GHKDSVYSVV 610

Query: 117 WSHDGELLATCSRDKSVWIW---EADEMGEEFECISVLQE-----HSQDVKHVIWHQSLP 168
           ++ DG  + + S D+SV +W    A+    E +  +   E     H   V  V   Q+  
Sbjct: 611 FTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDE 670

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWS----SDFEKSNSNVRLCSGSDDGT 224
            + S S D  V  W     +     +L GH  +V S    +D           +GS D  
Sbjct: 671 FILSGSKDRGVLFWDTPSGN--PLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCK 728

Query: 225 VRIW--CLEDDNGEYEQEWIQE 244
            RIW    +  N E +   ++E
Sbjct: 729 ARIWKYSKQTSNAEPKLREVKE 750

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 87/208 (41%), Gaps = 39/208 (18%)

Query: 108 HENEIKCVAWSHDGELLAT-CSRDKSVWIWEADEM-------------GEEFECIS---- 149
           H + + CV +SHDGE LAT C++   V+     E+             G +    S    
Sbjct: 399 HSSVVCCVRFSHDGEFLATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAK 458

Query: 150 ----VLQEHSQD--VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVW 203
               V    S D  ++ V +      LA+ + D  +RIW            L GHE  ++
Sbjct: 459 ASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLA--TRRIVMTLQGHEQDIY 516

Query: 204 SSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK 263
           S D+  S    +L SGS D TVRIW L        Q  +  SI        V +V  SP 
Sbjct: 517 SLDYFPSGD--KLVSGSGDRTVRIWDLRTG-----QCSLTLSI-----EDGVTTVAVSPG 564

Query: 264 -GYIASTGSDGRLVIYKESEDGWIVECI 290
            G + + GS  R V   +SE G++VE +
Sbjct: 565 DGKLIAAGSLDRTVRIWDSETGFLVERL 592

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 111/246 (45%), Gaps = 32/246 (13%)

Query: 5   KLLKSLALHDDKCWSVDVNN--GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           +L K+L  HDD   S+ +N   G + +T + D +IKL DI + Q +  L  + H+ TV +
Sbjct: 271 QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVL--SGHRATVNT 328

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE 122
             +   + +LA+   D++V +W  D+    D N  +   LA  +GH++ +  +A +  G 
Sbjct: 329 TRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATT--GN 386

Query: 123 LLATCSRDKSVWIWE--ADEMGEEFECISVLQEHSQDVKHVIWHQSL--PL--------- 169
            + + S DK++  W+  + +  +  +    L+   Q V  +    S   PL         
Sbjct: 387 AIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDN 446

Query: 170 -LASSSYDDTVRIWKDCDDDWECCAV---LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
            L + + D  V +W     D     V   L GH G + S  +  S     L +GS D + 
Sbjct: 447 ALVTGTKDGIVYLW-----DLRIGRVVGSLEGHRGPITSLKYMGS----ELITGSMDKST 497

Query: 226 RIWCLE 231
           RIW L 
Sbjct: 498 RIWDLR 503

>Kwal_23.5769
          Length = 627

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCS 128
            +L  GS+DSTV+IW           DL T +L+  + GH + +K + +  DG+ L T S
Sbjct: 328 RLLFTGSYDSTVAIW-----------DLATGKLVRRLTGHRDGVKAIYF--DGQKLITGS 374

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188
            D+ + +W          C++    HS  V  V  ++   ++ S S D TV++W     +
Sbjct: 375 LDRMIRVWNYVTGA----CVAAYPGHSDSVLSVDSYKK--IIVSGSADKTVKVW---HVE 425

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              C  L GH  T W    +    +    SGSDD T+R+W
Sbjct: 426 SRTCYTLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMW 463

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
            +GH + +  + +++   LL T S D +V IW+        + +  L  H   VK + + 
Sbjct: 313 FKGHMDGVLSLQFNY--RLLFTGSYDSTVAIWDL----ATGKLVRRLTGHRDGVKAIYFD 366

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
                L + S D  +R+W        C A   GH  +V S D  K      + SGS D T
Sbjct: 367 GQK--LITGSLDRMIRVWNYVTG--ACVAAYPGHSDSVLSVDSYKKI----IVSGSADKT 418

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
           V++W +E           +     + HT  V +V   PK +   +GSD
Sbjct: 419 VKVWHVES----------RTCYTLRGHTEWVGTVKLHPKSFTCFSGSD 456

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 102/270 (37%), Gaps = 65/270 (24%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60
           +A  KL++ L  H D   ++  + G  + TGS DR I++ +  +   +       H  +V
Sbjct: 344 LATGKLVRRLTGHRDGVKAIYFD-GQKLITGSLDRMIRVWNYVTGACVAAY--PGHSDSV 400

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
            SV    +  I+ +GS D TV +W            +E+     + GH   +  V     
Sbjct: 401 LSVD--SYKKIIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVGTVKLHPK 447

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI------------------ 162
                + S D ++ +W+         C+ V + H   V+ V+                  
Sbjct: 448 SFTCFSGSDDTTIRMWDI----RSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503

Query: 163 ------------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECCAVLNGHEGT 201
                                SLP    L S S D+T+++W+      +C     GH   
Sbjct: 504 PRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEV--RTGKCVRTHFGHVEG 561

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
           +W    + +  N R+ SG+ D TV++W L+
Sbjct: 562 IW----DIAADNFRIVSGAHDKTVKVWDLQ 587

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 90/206 (43%), Gaps = 19/206 (9%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           M + S D  IK+ D+RS  +     +  H   V  VA  P+   L +   D  + IW   
Sbjct: 90  MVSSSEDGTIKVWDVRSPSVQR---NYKHNAPVNEVAIHPNQGELISCDQDGNIRIW--- 143

Query: 88  DDGYND-ENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM--GEE 144
           D G N   N L  E           ++ ++ + DG +L   +   + ++W+         
Sbjct: 144 DLGENQCTNQLTPE-------DNTPLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDAST 196

Query: 145 FECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWS 204
            E ++  + H++ +  V+    +  LA+ S D T R+W + +D++E    L+GH+  VW 
Sbjct: 197 LEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVW-NIEDNFELETTLDGHQRWVWD 255

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCL 230
             F  S  +  L +   D  VR+W L
Sbjct: 256 CAF--SADSAYLVTACSDHYVRLWDL 279

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 64/165 (38%), Gaps = 18/165 (10%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
           S ILA+  +D T+  W            L       I+  ++++  +  + D + LA   
Sbjct: 2   SVILASAGYDHTIRFWEA----------LTGVCSRTIQHADSQVNRLEITSDKKYLAAAG 51

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188
               + +   D        +S  + H  +V  + + Q    + SSS D T+++W     D
Sbjct: 52  H---LHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW-----D 103

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
               +V   ++     ++     +   L S   DG +RIW L ++
Sbjct: 104 VRSPSVQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGEN 148

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 93/222 (41%), Gaps = 32/222 (14%)

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATC 127
             N+L +GS D T+  W   ++    E      + +  +GH + ++ V  S DG    + 
Sbjct: 30  QPNLLVSGSRDKTLISWRLTEN----EQQFGVPVRSY-KGHSHIVQDVVVSADGNYAVSA 84

Query: 128 SRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD 187
           S DK++ +W       E   +     H+ DV  V    +   + S+S D T+R+W    D
Sbjct: 85  SWDKTLRLWNLATGNSEARFVG----HTGDVLSVAIDANSSKIISASRDKTIRVWNTVGD 140

Query: 188 DWECCAVLNGHEGTVWSS----------DFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
              C  VL GH  T W +          D E  +  +   S   D  VR W L +D+   
Sbjct: 141 ---CAYVLLGH--TDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRI 195

Query: 238 EQEWIQESILPKAHTRAVYSVNWSPKGYI-ASTGSDGRLVIY 278
           E ++I        H   +  V  SP G + AS G DG++ ++
Sbjct: 196 EADFI-------GHNNYINVVQPSPDGSLAASAGKDGQIYVW 230

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 101/241 (41%), Gaps = 33/241 (13%)

Query: 101 LLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFEC-ISVLQEHSQDV 158
           L   +EGH   +  ++ S     LL + SRDK++  W   E  ++F   +   + HS  V
Sbjct: 10  LRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIV 69

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           + V+         S+S+D T+R+W     + E   V  GH G V S   + ++S  ++ S
Sbjct: 70  QDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFV--GHTGDVLSVAIDANSS--KIIS 125

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIY 278
            S D T+R+W    D           + +   HT  V  V  +PK        DGR+   
Sbjct: 126 ASRDKTIRVWNTVGDC----------AYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFV 175

Query: 279 KE-----------SEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNV 327
                        +ED + +E    + H  Y  N+V+     S D  L  +AG DG + V
Sbjct: 176 SAGMDKIVRSWSLNEDSYRIEA-DFIGHNNY-INVVQ----PSPDGSLAASAGKDGQIYV 229

Query: 328 W 328
           W
Sbjct: 230 W 230

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 77/202 (38%), Gaps = 35/202 (17%)

Query: 40  VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET 99
           V +RS++         H   V+ V      N   + S+D T+ +W          N    
Sbjct: 57  VPVRSYK--------GHSHIVQDVVVSADGNYAVSASWDKTLRLW----------NLATG 98

Query: 100 ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK 159
              A   GH  ++  VA   +   + + SRDK++ +W  + +G   +C  VL  H+  V 
Sbjct: 99  NSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVW--NTVG---DCAYVLLGHTDWVT 153

Query: 160 HV-IWHQSLP---------LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEK 209
            V +  ++L             S+  D  VR W   +D +   A   GH   +  +  + 
Sbjct: 154 KVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYI--NVVQP 211

Query: 210 SNSNVRLCSGSDDGTVRIWCLE 231
           S       S   DG + +W L+
Sbjct: 212 SPDGSLAASAGKDGQIYVWNLK 233

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G + A+   D +I + +++        D    K  V ++A+ P    L A +  S + I
Sbjct: 214 DGSLAASAGKDGQIYVWNLKHKSAFMNFD---AKDEVFALAFSPSRFWLTAAT-ASGIKI 269

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
           +  +++   DE  L+ E     +  +     +AWS DG+ L     D  + +W+
Sbjct: 270 YDLENEVLIDE--LKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQ 321

>Kwal_27.11585
          Length = 823

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 78/184 (42%), Gaps = 20/184 (10%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH+K + +++  P+ ++ A  S+D T  IW  D            EL   +  H+  +  
Sbjct: 502 AHEKDINALSISPNDSVFATASYDKTCKIWNVDSG----------ELEGTLANHKRGLWD 551

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           V +    +LLATCS DK++ +W  + M      +  L+ H+  V+   +      + S+ 
Sbjct: 552 VTFCQYDKLLATCSGDKTIKVWSLESMS----VVKTLEGHTNAVQRCSFINRNKQIVSTG 607

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW--CLED 232
            D  +++W       EC   L+ H   +W+      +      +   DG  + W  C E+
Sbjct: 608 ADGLIKVWDLSTG--ECIRTLDAHSNRIWA--LSVLSDGKEFVTADADGVFQFWKDCSEE 663

Query: 233 DNGE 236
           +  E
Sbjct: 664 EQKE 667

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 105/246 (42%), Gaps = 35/246 (14%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQ 156
           LE EL    EGH + +  +  S +GE LATCS+D +V +W+ +   E+F+  +    H+ 
Sbjct: 391 LEVELY---EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAG 447

Query: 157 DVKHV----IWHQSLP-LLASSSYDDTVRIW---KDCDDDWECCAV------LNGHEGTV 202
            V  V    +   + P  + ++S D T++ W   K   +D +   +         HE  +
Sbjct: 448 PVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDI 507

Query: 203 WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
            +     ++S     + S D T +IW +  D+GE E            H R ++ V +  
Sbjct: 508 NALSISPNDS--VFATASYDKTCKIWNV--DSGELEGTLAN-------HKRGLWDVTFCQ 556

Query: 263 KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDD 322
              + +T S  + +     E   +V+ +   T+ V   + +   +        +++ G D
Sbjct: 557 YDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQ-------IVSTGAD 609

Query: 323 GHVNVW 328
           G + VW
Sbjct: 610 GLIKVW 615

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 113/278 (40%), Gaps = 32/278 (11%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETE-LLAIIEGHENEIKCVAWS 118
           +RSV + P    LA G+ D  + IW           DL T+ +L  ++GHE +I  + + 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW-----------DLTTKKILMTLQGHEQDIYSLDYF 403

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
             G+ L + S D++V IW+        +C   L          +       +A+ S D T
Sbjct: 404 PAGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRT 459

Query: 179 VRIW--------KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           VR+W        +  D + E      GH+ +V+S  F +    V   SGS D +V++W L
Sbjct: 460 VRVWDSETGFLVERLDSENELS---TGHKDSVYSVVFTRDGQGV--ISGSLDRSVKLWDL 514

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECI 290
              NG+      + +     H   V SV  +       +GS  R V++ ++  G  +  +
Sbjct: 515 RGLNGQKSHATCEVTY--TGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLML 572

Query: 291 HELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               + V    +V     G  DV +  T   D    +W
Sbjct: 573 QGHRNSVISVAVVNGFPLG-PDVGVFATGSGDCKARIW 609

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 100/222 (45%), Gaps = 29/222 (13%)

Query: 17  CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGS 76
           C+S D   G  +ATG+ D+ I++ D+ + +I+  L    H++ + S+ + P  + L +GS
Sbjct: 359 CFSPD---GKYLATGAEDKLIRIWDLTTKKILMTLQ--GHEQDIYSLDYFPAGDKLVSGS 413

Query: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWI 135
            D TV IW           DL T   ++    E+ +  VA S  DG+ +A  S D++V +
Sbjct: 414 GDRTVRIW-----------DLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRV 462

Query: 136 WEADEMGEEFECISVLQE----HSQDVKHVIWHQSLPLLASSSYDDTVRIW-----KDCD 186
           W++ E G   E +    E    H   V  V++ +    + S S D +V++W         
Sbjct: 463 WDS-ETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQK 521

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
               C     GH+  V S     +  +  + SGS D  V  W
Sbjct: 522 SHATCEVTYTGHKDFVLS--VATTQDDEYILSGSKDRGVLFW 561

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 118/273 (43%), Gaps = 46/273 (16%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIE-----GHENEIKCVAWSHDGEL 123
           + + AAG  DS + +W  D  G   ++ L ++    I      GH   +   ++S D + 
Sbjct: 433 ATLAAAGFQDSYIKLWSLD--GTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKY 490

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PL---LASSSYDDTV 179
           L + S DK+V +W  D     +  +   + H+    H +W  S  PL    A++S+D T 
Sbjct: 491 LLSASEDKTVRLWSMD----TYSSLVSYKGHN----HPVWDVSFSPLGHYFATASHDQTA 542

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
           R+W  CD  +    +  GH   V    F  + + V   +GS D T R+W +    G+  +
Sbjct: 543 RLW-SCDHIYP-LRIFAGHLNDVDCVSFHPNGTYV--FTGSTDKTCRMWDI--GTGDSVR 596

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELT----H 295
            ++        HT  V S   SP G   STGS+  ++      + W +     L     H
Sbjct: 597 LFL-------GHTAPVISTAVSPDGRWLSTGSEDGII------NVWDIGTGKRLKQMRGH 643

Query: 296 GVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           G    N V  + Y SK+  +L++ G D  V VW
Sbjct: 644 G---KNAVYSLSY-SKEGTVLVSGGADHSVRVW 672

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 102/226 (45%), Gaps = 31/226 (13%)

Query: 49  EELDDT---AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAII 105
           E++++T    H  TV S ++ P +  L + S D TV +W  D   Y+         L   
Sbjct: 465 EKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDT--YSS--------LVSY 514

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           +GH + +  V++S  G   AT S D++  +W  D +      + +   H  DV  V +H 
Sbjct: 515 KGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI----YPLRIFAGHLNDVDCVSFHP 570

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
           +   + + S D T R+W     D     +  GH   V S+    S     L +GS+DG +
Sbjct: 571 NGTYVFTGSTDKTCRMWDIGTGD--SVRLFLGHTAPVISTAV--SPDGRWLSTGSEDGII 626

Query: 226 RIWCLEDDNGEYEQEWIQESILPKAHTR-AVYSVNWSPKGYIASTG 270
            +W +    G+  ++        + H + AVYS+++S +G +  +G
Sbjct: 627 NVWDI--GTGKRLKQM-------RGHGKNAVYSLSYSKEGTVLVSG 663

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 21/190 (11%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H   V  V++ P  +  A  S D T  +W  D              L I  GH N++ CV
Sbjct: 517 HNHPVWDVSFSPLGHYFATASHDQTARLWSCD----------HIYPLRIFAGHLNDVDCV 566

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSY 175
           ++  +G  + T S DK+  +W   ++G   + + +   H+  V           L++ S 
Sbjct: 567 SFHPNGTYVFTGSTDKTCRMW---DIGTG-DSVRLFLGHTAPVISTAVSPDGRWLSTGSE 622

Query: 176 DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE---- 231
           D  + +W D         +    +  V+S  + K  +   L SG  D +VR+W L+    
Sbjct: 623 DGIINVW-DIGTGKRLKQMRGHGKNAVYSLSYSKEGT--VLVSGGADHSVRVWDLKRSTA 679

Query: 232 DDNGEYEQEW 241
           + N E EQ +
Sbjct: 680 EPNTEPEQPF 689

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 16/128 (12%)

Query: 12  LHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           L+D  C S   N G  + TGSTD+  ++ DI +   +       H   V S A  P    
Sbjct: 560 LNDVDCVSFHPN-GTYVFTGSTDKTCRMWDIGTGDSVRLF--LGHTAPVISTAVSPDGRW 616

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGH-ENEIKCVAWSHDGELLATCSR 129
           L+ GS D  +++W           D+ T + L  + GH +N +  +++S +G +L +   
Sbjct: 617 LSTGSEDGIINVW-----------DIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGA 665

Query: 130 DKSVWIWE 137
           D SV +W+
Sbjct: 666 DHSVRVWD 673

>Kwal_55.22067
          Length = 451

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 109/265 (41%), Gaps = 58/265 (21%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH   V  + +    + L +G  D T+ IW  +   +N    L+       E H   I+ 
Sbjct: 123 AHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPN---FNMVKVLD-------EAHTQCIRG 172

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           +++S       TCS D  + IW      +E    S L  H  DV+   WH ++ L+AS S
Sbjct: 173 ISFSGTDSKFVTCSDDNILKIWNFSNGQQE----STLSGHHWDVRSCDWHPTMGLIASGS 228

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDN 234
            D+ V++W       +C + + G + T+ S+ F+ +  N+ L   S D + RI+ +  + 
Sbjct: 229 KDNLVKLWD--PRAGQCISTILGCKHTIISTKFQPTKGNM-LAVISKDKSCRIFDIRQNM 285

Query: 235 GE---YEQE-------W--IQESI-----------------------------LPKAHTR 253
            E   Y  E       W  I ES+                             +P AH +
Sbjct: 286 KELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYAHDK 345

Query: 254 AVYSVNWSPKGYIASTGSDGRLVIY 278
            + S+ ++P G+I ++ S  R + +
Sbjct: 346 CITSLAYNPVGHILASASKDRTIRF 370

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 81/173 (46%), Gaps = 20/173 (11%)

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
           K  + ++ W P    L   ++    S+W  +   +N E        +I++ H++ +  + 
Sbjct: 83  KHVIPALEWTPEGRRLVVATYSGEFSLW--NGSTFNFE--------SIMQAHDSAVAVMK 132

Query: 117 WSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQE-HSQDVKHVIWHQSLPLLASSSY 175
           +SH G+ L +   D ++ IW+ +     F  + VL E H+Q ++ + +  +     + S 
Sbjct: 133 YSHAGDWLISGDSDGTIKIWQPN-----FNMVKVLDEAHTQCIRGISFSGTDSKFVTCSD 187

Query: 176 DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           D+ ++IW   +   E  + L+GH   V S D+  +     + SGS D  V++W
Sbjct: 188 DNILKIWNFSNGQQE--STLSGHHWDVRSCDWHPTMG--LIASGSKDNLVKLW 236

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 76/192 (39%), Gaps = 19/192 (9%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I  + W+ +G  L   +      +W     G  F   S++Q H   V  + +  +   L 
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLWN----GSTFNFESIMQAHDSAVAVMKYSHAGDWLI 141

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLN-GHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           S   D T++IW+    ++    VL+  H   +    F  ++S    CS  DD  ++IW  
Sbjct: 142 SGDSDGTIKIWQP---NFNMVKVLDEAHTQCIRGISFSGTDSKFVTCS--DDNILKIWNF 196

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECI 290
              NG+      QES L   H   V S +W P   + ++GS   LV   +   G  +  I
Sbjct: 197 S--NGQ------QESTL-SGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTI 247

Query: 291 HELTHGVYETNM 302
               H +  T  
Sbjct: 248 LGCKHTIISTKF 259

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 42  IRSFQIIEELDDT----------AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK----D 87
           ++ F +++E  D+          AH K + S+A+ P  +ILA+ S D T+  W +    D
Sbjct: 319 MKHFDLLQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHILASASKDRTIRFWTRARPYD 378

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCV-AWSHDGELLATCSRDKSVWI 135
            + ++D      ++ A   G  N I  +   + DG  L   S D +  I
Sbjct: 379 PNSFDDPTYNNKKVNAWYFGINNNINAIRPKTEDGIALPPASNDSTASI 427

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 90/208 (43%), Gaps = 25/208 (12%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
             T S D  +K+ +  + Q  +E   + H   VRS  W P   ++A+GS D+ V +W   
Sbjct: 182 FVTCSDDNILKIWNFSNGQ--QESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLW--- 236

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFE 146
                  +    + ++ I G ++ I    +    G +LA  S+DKS  I++  +  +E  
Sbjct: 237 -------DPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKE-- 287

Query: 147 CISVLQEHSQDVKHVIWHQ-SLPLLASSSYDDTVR---IWKDCDDDWECCA--VLNGHEG 200
            ++V ++ S D   + WH  +  +     YD +++   + ++  D    C   +   H+ 
Sbjct: 288 -LAVYRDES-DYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYAHDK 345

Query: 201 TVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            + S  +        L S S D T+R W
Sbjct: 346 CITSLAYNPVGH--ILASASKDRTIRFW 371

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 92  NDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVL 151
           ND  + ET   A  + +   I+ V +S DG+ LAT + DK + IW+     E+ + + VL
Sbjct: 541 NDNAEAETSAGATTDLY---IRSVCFSPDGKFLATGAEDKLIRIWDI----EQKKIVMVL 593

Query: 152 QEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEG--TVWSSDFEK 209
           + H QD+  + +  S   L S S D TVRIW D     +C   L+  +G  TV  S  + 
Sbjct: 594 KGHEQDIYSLDYFPSGDKLVSGSGDRTVRIW-DL-KTGQCTLTLSIEDGVTTVAVSPGDG 651

Query: 210 SNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIAST 269
                 + +GS D  VR+W  + D G   +    E+ L   H  +VYSV ++  G    +
Sbjct: 652 K----FIAAGSLDRAVRVW--DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVS 705

Query: 270 GSDGRLV 276
           GS  R V
Sbjct: 706 GSLDRSV 712

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 19  SVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDD-----TAHKKTVRSVAWRPHSNILA 73
           +V   +G  +A GS DR +++ D  +  ++E LD      T HK +V SV +    N + 
Sbjct: 645 AVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVV 704

Query: 74  AGSFDSTVSIWGKDDDGYNDENDLETELL--AIIEGHENEIKCVAWSHDGELLATCSRDK 131
           +GS D +V +W   +  +N+ +   T         GH++ +  VA + D E + + S+D+
Sbjct: 705 SGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDR 764

Query: 132 SVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL------LASSSYDDTVRIWK 183
            V  W+          + +LQ H   V  V  +   PL       A+ S D   RIWK
Sbjct: 765 GVLFWDK----VSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 102/226 (45%), Gaps = 32/226 (14%)

Query: 17  CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGS 76
           C+S D   G  +ATG+ D+ I++ DI   +I+  L    H++ + S+ + P  + L +GS
Sbjct: 562 CFSPD---GKFLATGAEDKLIRIWDIEQKKIVMVLK--GHEQDIYSLDYFPSGDKLVSGS 616

Query: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWI 135
            D TV IW           DL+T    +    E+ +  VA S  DG+ +A  S D++V +
Sbjct: 617 GDRTVRIW-----------DLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRV 665

Query: 136 WEADE--MGEEFECISVLQE-HSQDVKHVIWHQSLPLLASSSYDDTVRIWK--------- 183
           W++D   + E  +  + L   H   V  V++ +    + S S D +V++W          
Sbjct: 666 WDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNA 725

Query: 184 DCDDDWECCAVL-NGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           D       C V   GH+  V S     +  +  + SGS D  V  W
Sbjct: 726 DGKPTSGTCEVTYTGHKDFVLS--VATTEDDEYILSGSKDRGVLFW 769

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 83/182 (45%), Gaps = 25/182 (13%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWS 118
           +RSV + P    LA G+ D  + IW           D+E  +++ +++GHE +I  + + 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIW-----------DIEQKKIVMVLKGHEQDIYSLDYF 606

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
             G+ L + S D++V IW+     +  +C   L          +       +A+ S D  
Sbjct: 607 PSGDKLVSGSGDRTVRIWDL----KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA 662

Query: 179 VRIWKDCDDDWEC------CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232
           VR+W D D  +          +  GH+ +V+S  F +  + V   SGS D +V++W L +
Sbjct: 663 VRVW-DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGV--VSGSLDRSVKLWNLRN 719

Query: 233 DN 234
            N
Sbjct: 720 VN 721

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 65/142 (45%), Gaps = 22/142 (15%)

Query: 108 HENEIKCVAWSHDGELLAT-CSRDKSVWIWEADEMGEEF--ECISVLQEHSQD------- 157
           H + + CV +S+DGE LAT C++   ++     E+   F  E     +    D       
Sbjct: 490 HTSVVCCVKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETS 549

Query: 158 --------VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEK 209
                   ++ V +      LA+ + D  +RIW D +   +   VL GHE  ++S D+  
Sbjct: 550 AGATTDLYIRSVCFSPDGKFLATGAEDKLIRIW-DIEQK-KIVMVLKGHEQDIYSLDYFP 607

Query: 210 SNSNVRLCSGSDDGTVRIWCLE 231
           S    +L SGS D TVRIW L+
Sbjct: 608 SGD--KLVSGSGDRTVRIWDLK 627

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 75/161 (46%), Gaps = 25/161 (15%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATC 127
           + +L  GS+DSTV+IW           DL T +L+  + GH + +K  A   D + L T 
Sbjct: 269 NKLLLTGSYDSTVAIW-----------DLATGKLIRRLSGHTDGVK--ALRFDDQKLITG 315

Query: 128 SRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD 187
           S DK++ +W          C+S  + H   V  V   +   L+ S S D TV++W     
Sbjct: 316 SLDKTIRVWNYVTGA----CVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWH---V 366

Query: 188 DWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           +   C  L GH G  W +  +    +    SGSDD T+R+W
Sbjct: 367 ESRTCYTLRGHTG--WVNCVKLHPKSFTCFSGSDDMTIRMW 405

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 24/152 (15%)

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
           +LL T S D +V IW+        + I  L  H+  VK + +      L + S D T+R+
Sbjct: 270 KLLLTGSYDSTVAIWDL----ATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRV 323

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSD-FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
           W        C +   GH+ +V S D F K      + SGS D TV++W +E         
Sbjct: 324 WNYVTG--ACVSTYRGHQDSVLSVDSFRKL-----IVSGSADKTVKVWHVES-------- 368

Query: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
             +     + HT  V  V   PK +   +GSD
Sbjct: 369 --RTCYTLRGHTGWVNCVKLHPKSFTCFSGSD 398

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 105/269 (39%), Gaps = 65/269 (24%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60
           +A  KL++ L+ H D   ++  ++  ++ TGS D+ I++ +  +   +       H+ +V
Sbjct: 286 LATGKLIRRLSGHTDGVKALRFDDQKLI-TGSLDKTIRVWNYVTGACVSTY--RGHQDSV 342

Query: 61  RSV-AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
            SV ++R    ++ +GS D TV +W            +E+     + GH   + CV    
Sbjct: 343 LSVDSFR---KLIVSGSADKTVKVW-----------HVESRTCYTLRGHTGWVNCVKLHP 388

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI----------------- 162
                 + S D ++ +W+         C+ V   H   V+ VI                 
Sbjct: 389 KSFTCFSGSDDMTIRMWDI----RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEDPKDAVV 444

Query: 163 -----------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTV 202
                            +  SLP    L S S D+T+++W        C     GH   V
Sbjct: 445 PPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV--KTGACIRTQFGHVEGV 502

Query: 203 WSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
           W    + +  N R+ SGS D + ++W L+
Sbjct: 503 W----DIAADNFRIVSGSHDRSCKVWDLQ 527

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 118/276 (42%), Gaps = 34/276 (12%)

Query: 58  KTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAW 117
           K + +V+      ++A GS       W  D    N +      L   ++ H  +I  + W
Sbjct: 176 KPISAVSLSTDDMVVATGS-------WAGDLQVLNSQT--LQPLTQKLDSHVGKIGAIDW 226

Query: 118 SHD-GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYD 176
             D    + +C+ D  +  ++          +  L  H + +  V +H S   + S+S+D
Sbjct: 227 HPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHD 286

Query: 177 DTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGE 236
            T R+W D     E   +  GH+  V+S  F+   S V  CSG  D    +W +   +  
Sbjct: 287 MTWRLW-DASTHQELL-LQEGHDKGVFSLSFQCDGSLV--CSGGMDSLSMLWDIRSGS-- 340

Query: 237 YEQEWIQESILPKAHTRAVYSVNWSPKGY-IASTGSDGRLVIY--KESEDGWIVECIHEL 293
                  + +    H++ +Y+V WSP GY +A+ G DG + ++  ++ ++G       +L
Sbjct: 341 -------KVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEG-------QL 386

Query: 294 THGVYETNMVKWVEYGSKD-VILLITAGDDGHVNVW 328
              +   N+V  V +  +D    L++ G D  +NV+
Sbjct: 387 NQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 102/231 (44%), Gaps = 23/231 (9%)

Query: 2   AGLKLLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60
            GL+LL  L  H+ +   V  + +G  + + S D   +L D  + Q  E L    H K V
Sbjct: 253 GGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQ--ELLLQEGHDKGV 310

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSH 119
            S++++   +++ +G  DS   +W           D+ +   +  + GH   I  VAWS 
Sbjct: 311 FSLSFQCDGSLVCSGGMDSLSMLW-----------DIRSGSKVMTLAGHSKPIYTVAWSP 359

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ--SLPLLASSSYDD 177
           +G  +AT   D  + +W+  +  E    ++ +  H   V  V + +      L S  YD+
Sbjct: 360 NGYQVATGGGDGIINVWDIRKRDE--GQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDN 417

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            + ++    D W     L GH   + S D   SN++  L SG  D ++++W
Sbjct: 418 LINVY--SSDTWLKMGSLAGHTDKIISLDI--SNNSHFLVSGGWDRSIKLW 464

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 68/178 (38%), Gaps = 14/178 (7%)

Query: 52  DDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENE 111
           D   H++ +  V + P    + + S D T  +W   D   + E       L + EGH+  
Sbjct: 260 DLVGHERRISDVKYHPSGKFIGSASHDMTWRLW---DASTHQE-------LLLQEGHDKG 309

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           +  +++  DG L+ +   D    +W+     +    +  L  HS+ +  V W  +   +A
Sbjct: 310 VFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSK----VMTLAGHSKPIYTVAWSPNGYQVA 365

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           +   D  + +W     D      +  H   V    F K +   +L S   D  + ++ 
Sbjct: 366 TGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYS 423

>Scas_704.40
          Length = 608

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 76/159 (47%), Gaps = 25/159 (15%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDL-ETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           +L  GS+DSTV+IW           DL   +L+  + GH + +K + +  D   L T S 
Sbjct: 265 LLFTGSYDSTVAIW-----------DLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSL 311

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           DK++ +W      +  ECIS  + H+  V  V   +   ++ S S D TV+IW     + 
Sbjct: 312 DKTIRVWNY----KTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWH---VES 362

Query: 190 ECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
             C  L GH  T W +  +    +    SGSDD T+R+W
Sbjct: 363 RTCYTLRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 76/169 (44%), Gaps = 26/169 (15%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
            +GH + +  + +++   LL T S D +V IW+        + I  L  H+  VK + + 
Sbjct: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSN----KLIRRLSGHTDGVKTLYFD 302

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD-FEKSNSNVRLCSGSDDG 223
           ++   L + S D T+R+W       EC +   GH  +V S D F+K      + SGS D 
Sbjct: 303 EAK--LVTGSLDKTIRVWNY--KTGECISTYRGHTDSVMSVDAFKKI-----IVSGSADK 353

Query: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
           TV+IW +E           +     + HT  V  V   PK +   +GSD
Sbjct: 354 TVKIWHVES----------RTCYTLRGHTEWVNCVKLHPKSFTCFSGSD 392

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 107/279 (38%), Gaps = 79/279 (28%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSV- 63
           KL++ L+ H D   ++  +   ++ TGS D+ I++ + ++ + I       H  +V SV 
Sbjct: 284 KLIRRLSGHTDGVKTLYFDEAKLV-TGSLDKTIRVWNYKTGECISTY--RGHTDSVMSVD 340

Query: 64  AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGEL 123
           A++    I+ +GS D TV IW            +E+     + GH   + CV        
Sbjct: 341 AFK---KIIVSGSADKTVKIW-----------HVESRTCYTLRGHTEWVNCVKLHPKSFT 386

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI--------------------- 162
             + S D ++ +W+         C+ V + H   V+ VI                     
Sbjct: 387 CFSGSDDTTIRMWDI----RTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEG 442

Query: 163 ---------------------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECC 192
                                        +S+P    L S S D+T+++W       +C 
Sbjct: 443 DDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV--QTGQCI 500

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
               GH   VW    + +  N R+ SGS DG+++IW L+
Sbjct: 501 RTQFGHVEGVW----DIAADNFRIISGSHDGSIKIWDLQ 535

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 16/109 (14%)

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           LL + SYD TV IW  C +  +    L+GH   V +  F+++    +L +GS D T+R+W
Sbjct: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRVW 318

Query: 229 CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
             +   GE    +       + HT +V SV+ + K  I S  +D  + I
Sbjct: 319 NYK--TGECISTY-------RGHTDSVMSVD-AFKKIIVSGSADKTVKI 357

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 108/254 (42%), Gaps = 31/254 (12%)

Query: 2   AGLKLLKSLALHDDK--CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKT 59
           +G KL      HDD   C   D +   +   G  D  +KL D    + I  ++   H  T
Sbjct: 392 SGKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAME--GHVAT 449

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           +  +    + N++A GS D+TV +W  +D     E    +E L  ++ H +E+  +    
Sbjct: 450 ISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYI-- 507

Query: 120 DGELLATCSRDKSVWIWEA------DEMGEEFECISVLQE---HSQDVKHVIWHQSLPL- 169
           DG  L T S+DK++  W+             F  +S  +     S +   ++   + P+ 
Sbjct: 508 DGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPII 567

Query: 170 ---------LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGS 220
                    LA+ + D  +R+W D     E   VL GH   + S  F+ +     + SGS
Sbjct: 568 GSIQSFDAALATGTKDGLIRLW-DM-RTGEVVRVLEGHMDAITSLKFDATT----IISGS 621

Query: 221 DDGTVRIWCLEDDN 234
            DGT+R+W L  +N
Sbjct: 622 LDGTIRLWDLRSNN 635

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 98/234 (41%), Gaps = 34/234 (14%)

Query: 8   KSLALHDDKCW-SVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDT------AHKKT- 59
           KSL+L  D  + +V +N  G        R + L   R   +++ LDD        H +T 
Sbjct: 17  KSLSLRVDGGFNAVSINPSG--------RDVVLASRRGLYVVD-LDDPFSPPRWLHHRTS 67

Query: 60  --VRSVAWRPHSNIL--AAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
             V  V W PH         + +    +W   +   N  N +E     I+ GH   I  +
Sbjct: 68  WEVADVQWSPHPAKPYWVVSTSNQKAMVW---NLSRNSTNAIE----HILHGHFRAITDI 120

Query: 116 AW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
            +  H  E+LATCS D  V  W+       +   S  +  +  VK   W+     + +SS
Sbjct: 121 NFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVK---WNFRNSNIMASS 177

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           + D V IW D          L GHEG+V + DF K+     + S S+DGTV+ W
Sbjct: 178 HSDHVCIW-DLRKGCTPLYTLQGHEGSVNNIDFNKAKE-TEIMSSSNDGTVKFW 229

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 25/159 (15%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           +L  GS+D+TV+IW           DL T +L+  + GH + +K + +  D + L T S 
Sbjct: 346 LLFTGSYDTTVAIW-----------DLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSL 392

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           DK++ +W         ECIS  + H+  V  V  H+   ++ S S D TV++W     + 
Sbjct: 393 DKTIRVWNY----ITGECISTYRGHTDSVMSVDSHKK--IIVSGSADKTVKVWH---VES 443

Query: 190 ECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
             C  L GH  T W +  +    +    S SDD T+R+W
Sbjct: 444 RTCYTLKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMW 480

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 105/272 (38%), Gaps = 71/272 (26%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           KL++ L  H D   ++  ++  ++ TGS D+ I++ +  + + I       H  +V SV 
Sbjct: 365 KLIRRLTGHSDGVKTLYFDDQKLI-TGSLDKTIRVWNYITGECISTY--RGHTDSVMSVD 421

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
              H  I+ +GS D TV +W            +E+     ++GH   + CV         
Sbjct: 422 --SHKKIIVSGSADKTVKVW-----------HVESRTCYTLKGHTEWVNCVKLHPKSFSC 468

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI-----------WHQSLP----- 168
            +CS D ++ +W+         C+ V + H   V+ VI            H+  P     
Sbjct: 469 YSCSDDTTIRMWDI----RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDD 524

Query: 169 -----------------------------LLASSSYDDTVRIWKDCDDDWECCAVLNGHE 199
                                         L S + D+T+++W+       C     GH 
Sbjct: 525 IASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWE--VRSGRCIRTQFGHV 582

Query: 200 GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
             VW    + +  N R+ SGS DG+++IW L+
Sbjct: 583 EGVW----DIAADNFRIISGSHDGSIKIWDLQ 610

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 71/168 (42%), Gaps = 24/168 (14%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
            +GH + +  + +++   LL T S D +V IW+        + I  L  HS  VK + + 
Sbjct: 330 FKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDL----FTGKLIRRLTGHSDGVKTLYFD 383

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
                L + S D T+R+W       EC +   GH  +V S D  K      + SGS D T
Sbjct: 384 DQK--LITGSLDKTIRVWNYITG--ECISTYRGHTDSVMSVDSHKK----IIVSGSADKT 435

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
           V++W +E           +     K HT  V  V   PK +   + SD
Sbjct: 436 VKVWHVES----------RTCYTLKGHTEWVNCVKLHPKSFSCYSCSD 473

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 98/224 (43%), Gaps = 42/224 (18%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H  TV S ++ P +  L +GS D TV +W           D  T L++  +GH + +  
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSM---------DTHTALVS-YKGHNHPVWD 572

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           V++S  G   AT S D++  +W  D +      + +   H  DV  V +H +   + + S
Sbjct: 573 VSFSPLGHYFATASHDQTARLWSCDHI----YPLRIFAGHLNDVDCVSFHPNGCYVFTGS 628

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLC-------SGSDDGTVRI 227
            D T R+W     D     +  GH   V S         + +C       +GS+DG + +
Sbjct: 629 SDKTCRMWDVSTGD--SVRLFLGHTAPVIS---------IAVCPDGRWLSTGSEDGIINV 677

Query: 228 WCLEDDNGEYEQEWIQESILPKAHTR-AVYSVNWSPKGYIASTG 270
           W +    G+  ++        + H + A+YS+++S +G +  +G
Sbjct: 678 WDI--GTGKRLKQM-------RGHGKNAIYSLSYSKEGNVLISG 712

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 113/273 (41%), Gaps = 46/273 (16%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDL-------ETELLAIIEGHENEIKCVAWSHDGEL 123
           I AAG  DS + IW  D    N+ N         E      + GH   +   ++S D + 
Sbjct: 480 IAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKY 539

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PL---LASSSYDDTV 179
           L + S DK+V +W  D        +   + H+    H +W  S  PL    A++S+D T 
Sbjct: 540 LLSGSEDKTVRLWSMD----THTALVSYKGHN----HPVWDVSFSPLGHYFATASHDQTA 591

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
           R+W  CD  +    +  GH   V    F  +   V   +GS D T R+W +    G+  +
Sbjct: 592 RLW-SCDHIYP-LRIFAGHLNDVDCVSFHPNGCYV--FTGSSDKTCRMWDVS--TGDSVR 645

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELT----H 295
            ++        HT  V S+   P G   STGS+  ++      + W +     L     H
Sbjct: 646 LFL-------GHTAPVISIAVCPDGRWLSTGSEDGII------NVWDIGTGKRLKQMRGH 692

Query: 296 GVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           G    N +  + Y SK+  +LI+ G D  V VW
Sbjct: 693 G---KNAIYSLSY-SKEGNVLISGGADHTVRVW 721

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 20/234 (8%)

Query: 8   KSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWR 66
           K+L  H    +S   + +   + +GS D+ ++L  + +   +  +    H   V  V++ 
Sbjct: 519 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTAL--VSYKGHNHPVWDVSFS 576

Query: 67  PHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLAT 126
           P  +  A  S D T  +W  D              L I  GH N++ CV++  +G  + T
Sbjct: 577 PLGHYFATASHDQTARLWSCD----------HIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 127 CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCD 186
            S DK+  +W+        + + +   H+  V  +        L++ S D  + +W D  
Sbjct: 627 GSSDKTCRMWDVSTG----DSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVW-DIG 681

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
                  +    +  ++S  + K   NV L SG  D TVR+W L+    E   E
Sbjct: 682 TGKRLKQMRGHGKNAIYSLSYSKE-GNV-LISGGADHTVRVWDLKKATTEPSAE 733

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 90/223 (40%), Gaps = 49/223 (21%)

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATC----------SRDKSVWI 135
           KD+ G +D++ ++ ++    E  E+E+K      D  L +            + D  + I
Sbjct: 376 KDNTGDDDKDKIKDKIAKDEEKKESELKVDGEKKDSNLSSPARDILPLPPKTALDLKLEI 435

Query: 136 WEADEMGEEFE-----------CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK- 183
            +  E  +  +           C+   Q  ++D+  + +     + A+   D  ++IW  
Sbjct: 436 QKVKESRDAIKLDNLQLALPSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSL 495

Query: 184 ---------------DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
                          D D+D   C  L GH GTV+S+ F  S  N  L SGS+D TVR+W
Sbjct: 496 DGSSLNNPNIALNNNDKDED-PTCKTLVGHSGTVYSTSF--SPDNKYLLSGSEDKTVRLW 552

Query: 229 CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGS 271
            ++                 K H   V+ V++SP G+  +T S
Sbjct: 553 SMDTHTALVSY---------KGHNHPVWDVSFSPLGHYFATAS 586

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 105/240 (43%), Gaps = 26/240 (10%)

Query: 99  TELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
           ++++ +   H+  I C+ WS D + +A+ S D +V I         +  I  L  H+  V
Sbjct: 59  SKMMKLTTTHKECINCLCWSPDSKCIASGSEDFTVEITHI-----IYGRIRRLMGHTAPV 113

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
             + ++    +L SSS D++++ W            ++ H   V S D  K +S++ L S
Sbjct: 114 ISICYNNKGNILCSSSMDESIKEWHVLSG--TALKTMSAHSDAVVSIDIPKFDSSI-LSS 170

Query: 219 GSDDGTVRIW------CLEDDNGEYEQEWIQE-SILPKAHTRAVYSVNWSPKGYIASTGS 271
           GS DG +RI+      CL+     Y+++WI E  ++P      + +V +S  G      S
Sbjct: 171 GSYDGLIRIFDTESGHCLK--TLTYDKDWIAEDGVVP------ISTVKFSRNGKFLLVKS 222

Query: 272 DGRLVIYKESEDGWIVECI---HELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              +V   E   G +V      H+ T    + N    + Y      L+I+  D G + VW
Sbjct: 223 LDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCGLELIYPQGKDPLVISGNDSGSMCVW 282

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 97/246 (39%), Gaps = 52/246 (21%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVS----IWGKDDDGYNDENDLETELLAIIEGHE 109
           T HK+ +  + W P S  +A+GS D TV     I+G+               +  + GH 
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGR---------------IRRLMGHT 110

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV-IWHQSLP 168
             +  + +++ G +L + S D+S+  W     G   + +S    HS  V  + I      
Sbjct: 111 APVISICYNNKGNILCSSSMDESIKEWHVLS-GTALKTMSA---HSDAVVSIDIPKFDSS 166

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLN------GHEGTVWSSDFEKSNSNVRLCSGSDD 222
           +L+S SYD  +RI+    +   C   L         +G V  S  + S +   L   S D
Sbjct: 167 ILSSGSYDGLIRIFD--TESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLD 224

Query: 223 GTVRIWCLEDDNGEYEQEWIQESIL-PKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKES 281
             V++W       EY +  +  + L P   T+A    N             G  +IY + 
Sbjct: 225 NVVKLW-------EYTRGTVVRTFLWPHQETKAKLKYNC------------GLELIYPQG 265

Query: 282 EDGWIV 287
           +D  ++
Sbjct: 266 KDPLVI 271

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCS 128
            +L  GS+DST+ IW           DL T +L+  + GH + +K + +  D   L T S
Sbjct: 313 RLLFTGSYDSTIGIW-----------DLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGS 359

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188
            DK++ +W         ECIS  + HS  V  V  +Q   ++ S S D TV++W     +
Sbjct: 360 LDKTIRVWNY----ITGECISTYRGHSDSVLSVDSYQK--VIVSGSADKTVKVWH---VE 410

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              C  L GH  T W +  +    +    S SDD T+R+W
Sbjct: 411 SRTCYTLRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMW 448

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/294 (20%), Positives = 110/294 (37%), Gaps = 79/294 (26%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           KL++ L+ H D   ++  ++  ++ TGS D+ I++ +  + + I       H  +V SV 
Sbjct: 333 KLIRRLSGHSDGVKTLYFDDRKLI-TGSLDKTIRVWNYITGECISTY--RGHSDSVLSVD 389

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
              +  ++ +GS D TV +W            +E+     + GH   + CV         
Sbjct: 390 --SYQKVIVSGSADKTVKVW-----------HVESRTCYTLRGHTEWVNCVKLHPKSFSC 436

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI---------------------- 162
            +CS D ++ +W+         C+ V + H   V+ +I                      
Sbjct: 437 FSCSDDTTIRMWDI----RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQ 492

Query: 163 ----------------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECCAVLNG 197
                                   +++P    L S   D+T+++W       +C     G
Sbjct: 493 DDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV--KTGKCIRTQFG 550

Query: 198 HEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW------CLEDDNGEYEQEWIQES 245
           H   VW    + +  N R+ SGS DG++++W      C+   NG   Q   Q +
Sbjct: 551 HVEGVW----DIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHT 600

>Scas_702.16
          Length = 816

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 93/237 (39%), Gaps = 29/237 (12%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDD-------GYNDENDLETEL---LAIIEGHE 109
           + +V   P    +A G  D  + IW  D            DE  ++ EL   LA +  H 
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRHT 79

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEADE-------MGEEFE-----CISVLQEHSQD 157
             + C+ +S +G+ LA+ S D+ + IW  DE        G E E         L  H  D
Sbjct: 80  GSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVAHDND 139

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLC 217
           ++ + W     LL S   D  V IW      +E     + H+  V    F+ +N      
Sbjct: 140 IQDICWAPDSSLLVSVGLDRAVIIWNGI--TFEKLKRFDVHQSHVKGVIFDPANK--YFA 195

Query: 218 SGSDDGTVRIWCLED--DNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGS 271
           + SDD T++I+      D     +  + E       T     ++WSP G +IA+  +
Sbjct: 196 TASDDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWSPDGQHIAAPNA 252

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 11/74 (14%)

Query: 215 RLCSGSDDGTVRIWCLED-----------DNGEYEQEWIQESILPKAHTRAVYSVNWSPK 263
           R+ +G  DG +RIW ++            D    ++E  +       HT +V  + +SP 
Sbjct: 31  RVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRHTGSVTCLKFSPN 90

Query: 264 GYIASTGSDGRLVI 277
           G   ++GSD R+++
Sbjct: 91  GKYLASGSDDRILL 104

>Scas_713.50
          Length = 983

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 81/192 (42%), Gaps = 24/192 (12%)

Query: 5   KLLKSLALH-------DDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAH 56
           K +  L LH        D   SV V+     +A    D  +K+  + S +    L    H
Sbjct: 553 KFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSL--YGH 610

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
           K  V S+     S ++   S D  + IWG D        D    L A    H++ I  V 
Sbjct: 611 KLPVLSIDISFDSKMIITSSADKNIKIWGLD------FGDCHKSLFA----HQDSIMNVK 660

Query: 117 WSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYD 176
           +  +     +CS+D  +  W+    G++FECI  L  H  +V  +        + SSS+D
Sbjct: 661 FVPESHNFFSCSKDGIIKYWD----GDKFECIQKLAAHQSEVWALAIANDASFVVSSSHD 716

Query: 177 DTVRIWKDCDDD 188
            ++RIW++ +D+
Sbjct: 717 HSIRIWEETEDE 728

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 96/243 (39%), Gaps = 34/243 (13%)

Query: 99  TELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECIS--------- 149
           T++  I E H+  I  +  + DG+ L T S DKSV  W      E     S         
Sbjct: 501 TQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGL 560

Query: 150 ---VLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD 206
                 E S D+  V        LA S  D+TV+++    D  +    L GH+  V S D
Sbjct: 561 HHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSID 618

Query: 207 FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY- 265
              S  +  + + S D  ++IW L  D G+  +          AH  ++ +V + P+ + 
Sbjct: 619 I--SFDSKMIITSSADKNIKIWGL--DFGDCHKSLF-------AHQDSIMNVKFVPESHN 667

Query: 266 IASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHV 325
             S   DG +  +    DG   ECI +L     E     W    + D   ++++  D  +
Sbjct: 668 FFSCSKDGIIKYW----DGDKFECIQKLAAHQSEV----WALAIANDASFVVSSSHDHSI 719

Query: 326 NVW 328
            +W
Sbjct: 720 RIW 722

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 117/298 (39%), Gaps = 56/298 (18%)

Query: 22  VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTV 81
           +N+G +   GS       VD +S +  E      HK+T          N+LA G  D  V
Sbjct: 88  LNDGLVPPPGS-------VDAKSSKPAETTFLQHHKET----------NLLAVGYNDGVV 130

Query: 82  SIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE-ADE 140
            +W    D Y+        +L  + GH + I  + +   G  L + SRD ++ +W+   E
Sbjct: 131 KVW----DLYSKT------VLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSE 180

Query: 141 MGEEFECISVLQEHSQDVKHVIW----------HQSLPLLASSSYDDTVRIWKDCDDDWE 190
           +G     +  L+ H +D    IW             L  L S+S D  ++IW D     +
Sbjct: 181 VG-----LYKLRSH-KDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIW-DLKIQ-Q 232

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW--CLEDDNGEYEQEWIQESILP 248
           C      H G  WS     +  N  + + S D  V+ W   L+DD      + I++ I  
Sbjct: 233 CVETHIAHTGECWSL----AVRNDLVITTSSDSQVKFWQLSLQDDTVPNGSKLIEKGIYE 288

Query: 249 KAHTRAVYSVNWSPK----GYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNM 302
           K   +   +V +       G+     +D  + I++  ++  I + + +    + E  M
Sbjct: 289 KQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKEEEISKALKKREKRLTEKGM 346

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 18/174 (10%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H  TV S ++ P +  L +GS D TV +W           D  T L+   +GH + +  
Sbjct: 531 GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSM---------DTHTALVN-YKGHNHPVWD 580

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           V +S  G   A+ S D++  +W  D +      + +   H+ DV  V +H +   + + S
Sbjct: 581 VKFSPLGHYFASASHDQTARLWACDHI----YPLRIFAGHTNDVDTVSFHPNGCYVFTGS 636

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            D T R+W     D     +  GH   V S+  + S     L +GS+DG + +W
Sbjct: 637 SDKTCRMWDVSTGD--SVRLFLGHTAPVLST--QVSPDGRWLATGSEDGVICLW 686

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 115/282 (40%), Gaps = 63/282 (22%)

Query: 71  ILAAGSFDSTVSIWGKDD-------------DGYNDENDLETELLAIIEGHENEIKCVAW 117
           + AAG  DS + IW  D              D ++ +N   T     + GH   +   ++
Sbjct: 487 LAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCST-----LVGHSGTVYSTSF 541

Query: 118 SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PL---LASS 173
           S D   L + S DK+V +W  D        +   + H+    H +W     PL    AS+
Sbjct: 542 SPDNMYLVSGSEDKTVKLWSMD----THTALVNYKGHN----HPVWDVKFSPLGHYFASA 593

Query: 174 SYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
           S+D T R+W  CD  +    +  GH   V +  F  +   V   +GS D T R+W +   
Sbjct: 594 SHDQTARLWA-CDHIYP-LRIFAGHTNDVDTVSFHPNGCYV--FTGSSDKTCRMWDVS-- 647

Query: 234 NGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHEL 293
            G+  + ++        HT  V S   SP G   +TG          SEDG I  C+ ++
Sbjct: 648 TGDSVRLFL-------GHTAPVLSTQVSPDGRWLATG----------SEDGVI--CLWDI 688

Query: 294 THGV-------YETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
             G        +  N V  + + +K+  +LI+ G D  V VW
Sbjct: 689 GTGKRIKQMRGHGKNAVHSLSF-NKEGNVLISGGADHSVRVW 729

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 6/106 (5%)

Query: 13  HDDKCWSVDVNNGGI-MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H     S  V+  G  +ATGS D  I L DI + + I+++     K  V S+++    N+
Sbjct: 658 HTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHG-KNAVHSLSFNKEGNV 716

Query: 72  LAAGSFDSTVSIW----GKDDDGYNDENDLETELLAIIEGHENEIK 113
           L +G  D +V +W    G  + G   E      +  I      +IK
Sbjct: 717 LISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITASINQDIK 762

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 100/247 (40%), Gaps = 57/247 (23%)

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
           L +G  D T+ IW  +   +N    L+         H   ++ +++S+  +   TCS D 
Sbjct: 136 LISGDADGTIKIWQPN---FNMVKVLD-------RAHTECMRDISFSYSDQKFVTCSDDN 185

Query: 132 SVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWEC 191
            + IW      +E     VL  H  DVK   WH  + L+ S S D+ +++W D       
Sbjct: 186 VLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLW-DPRTGRNV 240

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW----------CLEDDNGEYEQEW 241
             +L G + TV  + F+ +  N+ L   S D +++I+           + DD       W
Sbjct: 241 STIL-GLKHTVIKTKFQPTQGNL-LAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSW 298

Query: 242 --IQESI----------------------------LPKAHTRAVYSVNWSPKGYIASTGS 271
             I E+I                            +P AH ++V S+ +SP G+I ++ +
Sbjct: 299 HPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGHILASAA 358

Query: 272 DGRLVIY 278
             R + +
Sbjct: 359 KDRTIRF 365

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 95/246 (38%), Gaps = 21/246 (8%)

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK----CVA 116
           R   ++ H+  L     +ST +      D Y D   +            N++K     + 
Sbjct: 27  RLYFYKKHAIPLRTIQPESTYTADIMPPDAYRDHRRVLNIPTKFTHLSSNKVKHVIPAIT 86

Query: 117 WSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYD 176
           W+ +G  L   +      +W     G  F   S++Q H   V  + +  +   L S   D
Sbjct: 87  WTPEGRRLVVATYSGEFSLWN----GSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDAD 142

Query: 177 DTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGE 236
            T++IW+    ++    VL+    T    D   S S+ +  + SDD  ++IW     NG+
Sbjct: 143 GTIKIWQP---NFNMVKVLD-RAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFS--NGQ 196

Query: 237 YEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHG 296
                 QE +L   H   V S +W PK  +  +GS   L+   +   G  V  I  L H 
Sbjct: 197 ------QERVL-SGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHT 249

Query: 297 VYETNM 302
           V +T  
Sbjct: 250 VIKTKF 255

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 7/113 (6%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP-HSNILAAGSFDSTVSI 83
           G ++A  S D+ IK+ D+R  Q + EL          S++W P +  I + G ++  +  
Sbjct: 260 GNLLAVVSKDKSIKIYDMR--QHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAI-- 315

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
             K  D  +D ++       I   HE  +  +A+S  G +LA+ ++D+++  W
Sbjct: 316 --KHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFW 366

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 20/175 (11%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           V+S  W P   ++ +GS D+ + +W    D     N     +  I+      IK      
Sbjct: 208 VKSCDWHPKMGLIVSGSKDNLIKLW----DPRTGRN-----VSTILGLKHTVIKTKFQPT 258

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ-SLPLLASSSYDDT 178
            G LLA  S+DKS+ I++  +   E + I        D   + WH  +  + +   Y+  
Sbjct: 259 QGNLLAVVSKDKSIKIYDMRQHMRELQTI----RDDMDYMSLSWHPINETIFSVGCYNGA 314

Query: 179 VR----IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           ++    +  + +    C  +   HE +V S  +  S     L S + D T+R W 
Sbjct: 315 IKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAY--SPVGHILASAAKDRTIRFWA 367

 Score = 35.0 bits (79), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK----DDDGYNDENDLETELLAIIEGHEN 110
           AH+K+V S+A+ P  +ILA+ + D T+  W +    D + ++D      ++ A   G  N
Sbjct: 337 AHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKVNAWYFGINN 396

Query: 111 EIKCV 115
            I  V
Sbjct: 397 NINAV 401

>Kwal_14.1611
          Length = 334

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 102/247 (41%), Gaps = 23/247 (9%)

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           +   I GHE+ +  +++   G  +ATCS D+ + ++       E++     + H   V  
Sbjct: 1   MKPFITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVG 60

Query: 161 VIW--HQSLPLLASSSYDDTVRIWKDCDDDWECCA-------VLNGHEGTVWSSDFEKSN 211
           + W   +   ++AS SYD  V +W++  D  EC          LN   G ++S  F   +
Sbjct: 61  LDWASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGH 120

Query: 212 SNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESIL------PKAHTRAVYSVNWSPKGY 265
             ++L +  +DG +RI+  E       + W   S +      P +H ++ + + W P  +
Sbjct: 121 LGLKLGAIGNDGILRIY--EAMEPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRF 178

Query: 266 ----IASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGD 321
               +     D  L+  K+      V    E   G+  +  V W     +   L+ TA  
Sbjct: 179 SPEKLIVCALDQALIYQKDKAGKLYVAAKLEGHAGLIRS--VSWAPSVGRWYQLIATACK 236

Query: 322 DGHVNVW 328
           DG V ++
Sbjct: 237 DGKVRIF 243

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 25/126 (19%)

Query: 55  AHKKTVRSVAWRPH----SNILAAGSFDSTVSIWGKDDDGYNDEN--------------- 95
            H   +RSV+W P       ++A    D  V I+   +   +D++               
Sbjct: 210 GHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQVEEESENGS 269

Query: 96  -----DLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISV 150
                 L+ EL++  + H  E+  V+W+  G +L++   D  V +W+A     EF+C+SV
Sbjct: 270 ESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKA-SYSSEFKCMSV 328

Query: 151 LQEHSQ 156
           +    +
Sbjct: 329 ISAQQK 334

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 120/304 (39%), Gaps = 53/304 (17%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDD-------TAHKKTVRSVAWRP--HSNILAAG 75
           G  +AT S+D+ IK+     F+++ E ++        AH  +V  + W    +  I+A+ 
Sbjct: 21  GRHVATCSSDQHIKV-----FRLVRETNEWQLSDSWKAHDSSVVGLDWASPEYGRIIASV 75

Query: 76  SFDSTVSIWGKDDDGYNDENDLETELLAI--IEGHENEIKCVAWSHDGELLATCSRDKSV 133
           S+D  V++W ++ D         T+L  +    G    +K  A  H G  L     D  +
Sbjct: 76  SYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVK-FAPGHLGLKLGAIGNDGIL 134

Query: 134 WIWEADE--------MGEEFECI-SVLQEHSQDVKHVIW---HQSLPLLASSSYDDTVRI 181
            I+EA E        +  E + + S    H Q    + W     S   L   + D  +  
Sbjct: 135 RIYEAMEPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFSPEKLIVCALDQALIY 194

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSDFEKSNSN--VRLCSGSDDGTVRIWCL----EDDNG 235
            KD        A L GH G + S  +  S       + +   DG VRI+ L    +DD  
Sbjct: 195 QKDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQD 254

Query: 236 EYEQEWI------QESILPKA-----------HTRAVYSVNWSPKGYI-ASTGSDGRLVI 277
               + +          +P +           H   V+SV+W+  G I +S G DG++ +
Sbjct: 255 AMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRL 314

Query: 278 YKES 281
           +K S
Sbjct: 315 WKAS 318

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 60/140 (42%), Gaps = 31/140 (22%)

Query: 91  YNDENDLETELLAIIEGHENEIKCVAWSHD----GELLATCSRDKSVWIWEADEMGE--- 143
           Y  +   +  + A +EGH   I+ V+W+       +L+AT  +D  V I++  E  +   
Sbjct: 194 YQKDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQ 253

Query: 144 -----------------------EFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
                                  + E +S   +H  +V  V W+ +  +L+S+  D  VR
Sbjct: 254 DAMSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVR 313

Query: 181 IWK-DCDDDWECCAVLNGHE 199
           +WK     +++C +V++  +
Sbjct: 314 LWKASYSSEFKCMSVISAQQ 333

>Scas_629.12
          Length = 671

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 79/180 (43%), Gaps = 27/180 (15%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           +RSV + P    LA G+ D  + IW          +  E +++ +++GHE ++  + +  
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIW----------DIQERKIVMVLKGHEQDVYSLDYFP 439

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTV 179
           +GE L + S D++V IW+        +C   L          +       +A+ S D  V
Sbjct: 440 NGEKLVSGSGDRTVRIWDL----RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAV 495

Query: 180 RIW--------KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
           R+W        +  D + E      GH  +V+S  F +  + V   SGS D TV++W + 
Sbjct: 496 RVWDSTTGFLVERLDSENELGT---GHRDSVYSVVFTRDGNEV--VSGSLDKTVKLWNMR 550

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 17/137 (12%)

Query: 108 HENEIKCVAWSHDGELLAT-CSRDKSVWIWEADEMGEEFECISVLQEHSQD--------- 157
           H + + CV +S+DG+ LAT C++   ++     E+  +    SV    +           
Sbjct: 327 HSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPST 386

Query: 158 ---VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNV 214
              ++ V +      LA+ + D  +RIW     + +   VL GHE  V+S D+  +    
Sbjct: 387 DLYIRSVCFSPDGEFLATGAEDKLIRIWD--IQERKIVMVLKGHEQDVYSLDYFPNGE-- 442

Query: 215 RLCSGSDDGTVRIWCLE 231
           +L SGS D TVRIW L 
Sbjct: 443 KLVSGSGDRTVRIWDLR 459

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 76/193 (39%), Gaps = 58/193 (30%)

Query: 19  SVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDD-----TAHKKTVRSVAWRPHSNILA 73
           +V  N+G  +A GS DR +++ D  +  ++E LD      T H+ +V SV +    N + 
Sbjct: 477 AVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVV 536

Query: 74  AGSFDSTVSIW-----GKDDDGYNDEN--------------------------------- 95
           +GS D TV +W     G  ++  ND+                                  
Sbjct: 537 SGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGS 596

Query: 96  --------DLET-ELLAIIEGHENEIKCVAWSHDGEL------LATCSRDKSVWIWEADE 140
                   D E+   L +++GH N +  VA ++   L       AT S D    IW+  +
Sbjct: 597 KDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIWKYSK 656

Query: 141 MGEEFECISVLQE 153
           +  E E I  +QE
Sbjct: 657 ISGEEEKIKEVQE 669

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 122/301 (40%), Gaps = 50/301 (16%)

Query: 6   LLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVR--SV 63
            L  L  H+   W++   +G I+ +GSTDR +++ +I + +         H  TVR   V
Sbjct: 292 FLLELNGHEGGVWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVFK--GHTSTVRCLEV 349

Query: 64  AWRPHSNILAAGSFDSTVSIW----------GKDDDGYNDENDLETELLAIIEGHENEIK 113
                S  +  GS D+T+ +W          G  +  +    +     + ++ GH + ++
Sbjct: 350 VEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVR 409

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS 173
            V  S  G ++ + S D ++ +W+   M    + + +L  H+  V   I+        S+
Sbjct: 410 TV--SGHGRIVISGSYDHNLMVWDIISM----KLLYILTGHTDRVYSTIYDYKRNRCISA 463

Query: 174 SYDDTVRIW--KDCDDDWECCAV--------------LNGHEGTVWSSDFEKSNSNVRLC 217
           S D TV IW  ++ +++     +              L GH   V         SN  L 
Sbjct: 464 SMDTTVMIWDLENIENNGTTTTINDGASIKVVGSMKCLYGHTALVGLLCL----SNKFLV 519

Query: 218 SGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
           S + DG++R W    D  +Y +++         HT      ++S    I  +GS+ +  +
Sbjct: 520 SAAADGSIRGW----DPNDYSRKFSFH------HTNLAAITSFSMNDNILVSGSERQFNV 569

Query: 278 Y 278
           Y
Sbjct: 570 Y 570

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 61/120 (50%), Gaps = 13/120 (10%)

Query: 69  SNILAAGSFDSTVSIWGKDD---DGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLA 125
           +N++    F++   I G DD   + Y+ ENDL    L  + GHE  +  + +  DG++L 
Sbjct: 260 TNVVTCLQFENNYIITGADDKKINVYDAENDL---FLLELNGHEGGVWALKFV-DGKILV 315

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK--HVIWHQSLPLLASSSYDDTVRIWK 183
           + S D+SV IW      E  +C  V + H+  V+   V+ +     + + S D+T+ +WK
Sbjct: 316 SGSTDRSVRIWNI----ETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWK 371

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/257 (19%), Positives = 100/257 (38%), Gaps = 37/257 (14%)

Query: 8   KSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP 67
           +++   D +   +++ N   +   +  + ++L DIR+           H+  V SV+++ 
Sbjct: 26  RTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQ 85

Query: 68  HSNILAAGSFDSTVSIWGKDDDG--YNDENDLETELLAIIEGHENEIKC----------- 114
            +  +   S D T+ +W         N +++     + I       I C           
Sbjct: 86  DNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 115 -------------------VAWSHDGELLATCSRDKSVWIWEADEM--GEEFECISVLQE 153
                              ++ + DG +LA  +   + ++WE          + ++  + 
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205

Query: 154 HSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSN 213
           HS  +  ++    +  LA+ S D T R+W   DDD++    L+GH+  VW   F  S  +
Sbjct: 206 HSTYITRILLSSDVKHLATCSADHTARVWS-IDDDFKLETTLDGHQRWVWDCAF--SADS 262

Query: 214 VRLCSGSDDGTVRIWCL 230
             L + S D  VR+W L
Sbjct: 263 AYLVTASSDHYVRLWDL 279

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/299 (19%), Positives = 109/299 (36%), Gaps = 90/299 (30%)

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
           K  + ++ W P    L   +++   S+W      +N E        +I++ H++ +  + 
Sbjct: 81  KHVIPALTWTPEGRRLVVATYNGEFSLWS--GSSFNFE--------SIMQAHDSAVTVMT 130

Query: 117 WSHDGELLATCSRDKSVWIWEADEM------GEEFECI---------------------- 148
           +SH G+ + + S D  + IW+ +            EC+                      
Sbjct: 131 YSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLK 190

Query: 149 ----------SVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGH 198
                      VL  H  DVK   WH  + L+ S S D+ ++ W        C + + G 
Sbjct: 191 IWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWD--PRSGSCVSTMLGF 248

Query: 199 EGTVWSSDFEKSNSNVRLCSGSDDGTVRIW----------CLEDDNGEYEQEW--IQESI 246
           + T+ S+ F+    N+ L   S D T +++           + DD      +W  I E++
Sbjct: 249 KHTIISTKFQPKQGNL-LSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPIDETV 307

Query: 247 ---------------------------LPKAHTRAVYSVNWSPKGYIASTGSDGRLVIY 278
                                      +P AH + V S+ +SP G+I ++ S  R + +
Sbjct: 308 FTVGCYDGSIKHFDLSQENQPNKPTHNIPYAHEKCVTSLAYSPIGHIMASASKDRTIRF 366

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 79/192 (41%), Gaps = 19/192 (9%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I  + W+ +G  L   + +    +W     G  F   S++Q H   V  + +  +   + 
Sbjct: 84  IPALTWTPEGRRLVVATYNGEFSLWS----GSSFNFESIMQAHDSAVTVMTYSHTGDWMV 139

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLN-GHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           S S D  ++IW+    ++    V++  H   V    F  S ++ +  S SDD  ++IW  
Sbjct: 140 SGSADGELKIWQP---NFNMVKVMDQAHMECVREISF--SPTDQKFVSCSDDNVLKIWNF 194

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECI 290
              NG+      QE +L   H   V S +W PK  +  +GS   L+ + +   G  V  +
Sbjct: 195 S--NGQ------QERVL-SGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTM 245

Query: 291 HELTHGVYETNM 302
               H +  T  
Sbjct: 246 LGFKHTIISTKF 257

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 9/49 (18%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK---------DDDGYNDE 94
           AH+K V S+A+ P  +I+A+ S D T+  W +         DD  YN+E
Sbjct: 338 AHEKCVTSLAYSPIGHIMASASKDRTIRFWTRSRAVDPNAFDDPTYNNE 386

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 110/233 (47%), Gaps = 26/233 (11%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K +++L+ H D+   +  NN  ++++GS DRKI   D+R+ +   E  DT H + V  + 
Sbjct: 351 KCIRTLSGHVDRVACLSWNNH-VLSSGSRDRKILHRDVRAPEPFFEQIDT-HSQEVCGLK 408

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGEL 123
           W  + N LA+G  D+ V ++    DG      L   +L+ +E H   +K +AWS H   +
Sbjct: 409 WNVNENKLASGGNDNMVYVY----DG-----TLRQPMLS-MEEHTAAVKAMAWSPHTRGV 458

Query: 124 LAT--CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PLLASSSYDD-TV 179
           LAT   + DK + IW   +  +  E  +  Q     + +++W ++   ++ S  Y    +
Sbjct: 459 LATGGGTADKKLKIWNISKAVKLNEVDTGSQ-----LCNMLWSKNTDEIITSHGYSKYNL 513

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232
            +W       E  AVL GH   V         + V   SG+ D T+R W L D
Sbjct: 514 TLWNYP--TLEPMAVLKGHSFRVLHLTLSADGTTV--VSGAGDETLRYWKLFD 562

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQ 156
           L+ + +  + GH + + C++W  +  +L++ SRD+ +   +       FE I     HSQ
Sbjct: 348 LKNKCIRTLSGHVDRVACLSW--NNHVLSSGSRDRKILHRDVRAPEPFFEQIDT---HSQ 402

Query: 157 DVKHVIWHQSLPLLASSSYDDTVRIW 182
           +V  + W+ +   LAS   D+ V ++
Sbjct: 403 EVCGLKWNVNENKLASGGNDNMVYVY 428

>Scas_603.5
          Length = 589

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 100/228 (43%), Gaps = 24/228 (10%)

Query: 17  CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGS 76
           C   D++   +   G  +  IK+ D+ +   + +LDD  H  +V  +   P S  L  GS
Sbjct: 299 CLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDD--HIASVTCMQLHPDSKTLITGS 356

Query: 77  FDSTVSIWGKDDDGYNDENDLET-----ELLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
            D+T+ +W   D G   +  L++       +   E H  EI  V++  D E L + SRDK
Sbjct: 357 KDATLKLW---DLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY--DNEYLLSASRDK 411

Query: 132 SVWIWEADEMGEEFECISVLQEHSQ--DVK--HVIWHQSL-PLLASSSYDDTVRIWKDCD 186
           S+  W+    G   + +     H+   ++K   V   QS+   LA+ S D  +R+W    
Sbjct: 412 SIRQWDL-TTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWD--L 468

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDN 234
              +    L  H+G + S  F+ +    ++ +GS D  + +  L   N
Sbjct: 469 RSGKVVRTLLKHQGPITSLQFDST----KIITGSTDANISVSDLRTGN 512

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 130/295 (44%), Gaps = 44/295 (14%)

Query: 36  KIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEN 95
           K+K   ++  Q+I+E       K +  +   P  +++A GS+   +S+          +N
Sbjct: 165 KLKQFSLKGMQVIDE-------KPISEINTSPGGDLMACGSWSGNLSLV---------DN 208

Query: 96  DLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS 155
            L +++         +I  + WS D + +  C+ D  + I+++   G+E   + +L ++ 
Sbjct: 209 SL-SKIYCNRSLSGTKISGLDWSVDSKNIFVCTHDGRIVIYDS---GDE-TTVKILYKND 263

Query: 156 QDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN-GHEGTVWSSDFEKSNSNV 214
                V  H     + S+S+D T   W   D   +   ++  GH   V+S  F    S V
Sbjct: 264 ARFAQVRCHPCNSFIGSTSFDKT---WILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLV 320

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGS-DG 273
              +   D    IW +            +  +  + H++ +YSV+WS  GY  ++GS DG
Sbjct: 321 --STAGLDAIALIWDIRSG---------KNIMSLQGHSKPIYSVDWSQNGYQLASGSGDG 369

Query: 274 RLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            + ++   + G  VE I  L H     ++V  V++  ++   L+++G D  VN++
Sbjct: 370 TIKVWDIRKKGN-VETI--LAH----NSIVSQVKFNKQNGGYLVSSGYDKKVNIF 417

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           + I EGH  E+  +++ +DG L++T   D    IW+        + I  LQ HS+ +  V
Sbjct: 298 ILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDI----RSGKNIMSLQGHSKPIYSV 353

Query: 162 IWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
            W Q+   LAS S D T+++W D         +L  H   V    F K N    + SG D
Sbjct: 354 DWSQNGYQLASGSGDGTIKVW-DIRKKGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYD 411

Query: 222 DGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVN 259
               ++    D N      WI+E  L + H   V S++
Sbjct: 412 K---KVNIFNDGN------WIKERSL-EGHLDKVMSID 439

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 108/268 (40%), Gaps = 44/268 (16%)

Query: 10  LALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHS 69
           L  H+   W++      I+ +GSTDR +++ ++++ +         H  TVR +    H 
Sbjct: 403 LVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVF--RGHTSTVRCLDVVEHG 460

Query: 70  NI--LAAGSFDSTVSIWGKDDDGYNDENDLETE----------LLAIIEGHENEIKCVAW 117
            I  +  GS D+T+ +W   D    D N                + ++ GH   ++ V  
Sbjct: 461 GIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTV-- 518

Query: 118 SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDD 177
           S  G ++ + S D ++ +W+  +M    + + VL  H+  +   ++        S+S D 
Sbjct: 519 SGHGNIVVSGSYDHNLMVWDIAKM----KLLYVLTGHTDRIYSTLYDHKRKRCISASMDT 574

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR------------------LCSG 219
           TV++W   D +       NG    + S+   K + +VR                  L S 
Sbjct: 575 TVKVWDLSDINN------NGPVSQINSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSA 628

Query: 220 SDDGTVRIWCLEDDNGEYEQEWIQESIL 247
           + DG++R W   D +  +      +S +
Sbjct: 629 AADGSLRGWDASDYSKRFSFHHTNQSAI 656

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 14/133 (10%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
           ++GH  ++    +  +G  + T + DK + +++AD   E+F+   V  E        +W 
Sbjct: 362 LDGHRTKV-VTCFQFEGNYIITGADDKRINVYDADR--EQFKLELVGHEGG------VWA 412

Query: 165 QSLP---LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
                  +L S S D TVRIW       +C  V  GH  TV   D  +      + +GS 
Sbjct: 413 LKYAGDEILVSGSTDRTVRIWNV--KAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 222 DGTVRIWCLEDDN 234
           D T+ +W L D N
Sbjct: 471 DNTLHVWKLPDPN 483

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 125/279 (44%), Gaps = 50/279 (17%)

Query: 25  GGIMAT-GSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           GG++   G+ + +++L D+ S  +++ ++D AH   + S+        L  GS D TV  
Sbjct: 441 GGLLVILGTRNGELQLFDLASSSLLDTIED-AHDAAIWSLDLTSDGKRLVTGSADKTVKF 499

Query: 84  WGKDDDGYNDENDL----ETELLAIIEGHE-------NEIKCVAWSHDGELLATCSRDKS 132
           W      +  EN L    + + L +++ H        ++I CV  S D   LA    D +
Sbjct: 500 W-----DFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNT 554

Query: 133 VWIWEADEM-------GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185
           V ++  D M       G +   +S+  + S D K +I         +SS D  ++IW   
Sbjct: 555 VKVFFLDSMKFYLSLYGHKLPVLSI--DISFDSKMII---------TSSADKNIKIW--G 601

Query: 186 DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQES 245
            D  +C   L  H+ ++ +  F   + N   C  S D  V+ W     +GE + E IQ+ 
Sbjct: 602 LDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSC--SKDAVVKYW-----DGE-KFECIQKL 653

Query: 246 ILPKAHTRAVYSVNWSPK-GYIASTGSDGRLVIYKESED 283
               AH   V+++  +   G++ S+  D  + I++E+ED
Sbjct: 654 Y---AHQSEVWALAVATDGGFVVSSSHDHSIRIWEETED 689

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 111/276 (40%), Gaps = 40/276 (14%)

Query: 4   LKLLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           +K   SL  H     S+D++ +  ++ T S D+ IK+  +      + L   AH+ ++ +
Sbjct: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSL--FAHQDSIMN 620

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE 122
           V + P S+   + S D+ V  W    DG       + E +  +  H++E+  +A + DG 
Sbjct: 621 VKFLPQSHNFFSCSKDAVVKYW----DGE------KFECIQKLYAHQSEVWALAVATDGG 670

Query: 123 LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
            + + S D S+ IWE  E                    V   +         Y+DT+   
Sbjct: 671 FVVSSSHDHSIRIWEETE------------------DQVFLEEEKEKELEEQYEDTLLTS 712

Query: 183 ---KDCDDDWECCAVLNGHE---GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGE 236
               + DD ++  A   G E     V     E   +  RL    D G   I  LE  N +
Sbjct: 713 LEEGNGDDAFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRD 772

Query: 237 ---YEQEWIQESILPKAHTRAVYSVNWSPKGYIAST 269
              ++++ + E+ +       + +VN +P+ YI  T
Sbjct: 773 MKLWQRKKLGEAPIKPQGNAVLIAVNKTPEQYIMDT 808

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 33/243 (13%)

Query: 99  TELLAIIE-GHENEIKCVAWSHDGELLATCSRDKSVWIWEAD-----EMGEEFECISVLQ 152
           + LL  IE  H+  I  +  + DG+ L T S DK+V  W+         G + + + VL+
Sbjct: 462 SSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLK 521

Query: 153 EH-------SQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSS 205
            H       + D+  V        LA S  D+TV+++    D  +    L GH+  V S 
Sbjct: 522 LHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVF--FLDSMKFYLSLYGHKLPVLSI 579

Query: 206 DFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY 265
           D   S  +  + + S D  ++IW L  D G+  +          AH  ++ +V + P+ +
Sbjct: 580 DI--SFDSKMIITSSADKNIKIWGL--DFGDCHKSLF-------AHQDSIMNVKFLPQSH 628

Query: 266 IASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHV 325
              + S   +V Y    DG   ECI +L    Y      W    + D   ++++  D  +
Sbjct: 629 NFFSCSKDAVVKY---WDGEKFECIQKL----YAHQSEVWALAVATDGGFVVSSSHDHSI 681

Query: 326 NVW 328
            +W
Sbjct: 682 RIW 684

 Score = 35.0 bits (79), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 70/171 (40%), Gaps = 35/171 (20%)

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVL---NGHEGTVWSSDFEKSNSNVRLCSGS 220
           H+   LLA    D  +++W     D     VL   NGH+  +    F+   +  RL SGS
Sbjct: 88  HKDTDLLAVGYADGVIKVW-----DLMSKTVLLNFNGHKAAITLLQFD--GTGTRLISGS 140

Query: 221 DDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKE 280
            D  + +W L  + G Y+          ++H  ++       + ++ ST  DG + +   
Sbjct: 141 KDSNIIVWDLVGEVGLYKL---------RSHKDSITGFWCQGEDWLISTSKDGMIKL--- 188

Query: 281 SEDGWIVECIHELTHGVYETNMVKWVE---YGSKDVILLITAGDDGHVNVW 328
               W ++     TH   ET++    E      KD  LLIT G D  V +W
Sbjct: 189 ----WDLK-----THQCIETHIAHTGECWGLAVKDD-LLITTGTDSQVKIW 229

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 99/248 (39%), Gaps = 33/248 (13%)

Query: 2   AGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVR 61
           +G   L + AL D   W  D+  G +++  S        D R  +  E     AHK T  
Sbjct: 36  SGPGQLITSALEDVNIW--DIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDT-- 91

Query: 62  SVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDG 121
                   ++LA G  D  + +W          + +   +L    GH+  I  + +   G
Sbjct: 92  --------DLLAVGYADGVIKVW----------DLMSKTVLLNFNGHKAAITLLQFDGTG 133

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
             L + S+D ++ +W  D +GE    +  L+ H   +    W Q    L S+S D  +++
Sbjct: 134 TRLISGSKDSNIIVW--DLVGE--VGLYKLRSHKDSITG-FWCQGEDWLISTSKDGMIKL 188

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
           W D     +C      H G  W    +    ++ + +G+ D  V+IW L+ +N +   + 
Sbjct: 189 W-DLKTH-QCIETHIAHTGECWGLAVK---DDLLITTGT-DSQVKIWKLDIENDKMGGKL 242

Query: 242 IQESILPK 249
            +  I  K
Sbjct: 243 TEMGIFEK 250

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/318 (20%), Positives = 122/318 (38%), Gaps = 64/318 (20%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH   V ++ +    + L +G  D  + IW  +   +N    L+       + H   ++ 
Sbjct: 121 AHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN---FNMVKVLD-------QAHMECVRD 170

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           V++S       TCS D  + IW      +E     VL  H  DVK   WH ++ L+ S S
Sbjct: 171 VSFSGTDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWDVKSCDWHPTMGLIVSGS 226

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW------ 228
            D+ +++W       +C + + G + T+  + F+ +  N+ L   + D + +I+      
Sbjct: 227 KDNLIKLWD--PRSGQCISTILGFKHTIIKTKFQPTKGNL-LAVVAKDKSCKIFDIRQNM 283

Query: 229 ----CLEDDNGEYEQEW--IQESI---------------------------LPKAHTRAV 255
                  D++      W  I ESI                           +P AH + +
Sbjct: 284 KELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIPYAHDKCI 343

Query: 256 YSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNM--------VKWVE 307
            S++++P G+I ++ S  R + +             + T+   + N         +  V 
Sbjct: 344 TSLSYNPVGHILASASKDRTIRFWTRSRPMDPNAFDDPTYNNKKVNAWYFGINNNINAVR 403

Query: 308 YGSKDVILLITAGDDGHV 325
             ++D I    A  DGH+
Sbjct: 404 PKTEDGIAPPPANTDGHL 421

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 82/211 (38%), Gaps = 24/211 (11%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           I  + W+ +G  L   +      +W     G  F   S++Q H   V  + +  +   L 
Sbjct: 84  IPAIKWTPEGRRLVVATYSGEFSLWN----GSTFNFESIMQAHDSAVTTMEYSHAGDWLI 139

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLN-GHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           S   D  ++IW+    ++    VL+  H   V    F  ++S    CS  DD  ++IW  
Sbjct: 140 SGDSDGIIKIWQP---NFNMVKVLDQAHMECVRDVSFSGTDSKFVTCS--DDNILKIWNF 194

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECI 290
              NG+      QE +L   H   V S +W P   +  +GS   L+   +   G  +  I
Sbjct: 195 S--NGQ------QERVL-SGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTI 245

Query: 291 HELTHGVYETNMVKWVEYGSKDVILLITAGD 321
               H + +T         +K  +L + A D
Sbjct: 246 LGFKHTIIKTKFQP-----TKGNLLAVVAKD 271

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 51/127 (40%), Gaps = 26/127 (20%)

Query: 24  NGGIMATGSTDRKIKLVDI-------RSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGS 76
           N  I   G  D  +K  D+        SF  I      AH K + S+++ P  +ILA+ S
Sbjct: 304 NESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIPY----AHDKCITSLSYNPVGHILASAS 359

Query: 77  FDSTVSIWGK---------DDDGYNDEN------DLETELLAIIEGHENEIKCVAWSHDG 121
            D T+  W +         DD  YN++        +   + A+    E+ I     + DG
Sbjct: 360 KDRTIRFWTRSRPMDPNAFDDPTYNNKKVNAWYFGINNNINAVRPKTEDGIAPPPANTDG 419

Query: 122 ELLATCS 128
            L +T S
Sbjct: 420 HLGSTGS 426

>Kwal_27.12239
          Length = 316

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 77/186 (41%), Gaps = 32/186 (17%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
           T H + +  + W P S  +A  S D T+ I           + +  EL  ++ GH   + 
Sbjct: 55  TLHSRPLSDLCWSPDSQCIATASDDFTIII----------THIVFGELHRLV-GHTAPVT 103

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP-LLAS 172
            V ++  G LL +CS D+S+ IW+          +  L  HS+ V  +      P +L+S
Sbjct: 104 SVKYTMKGNLLCSCSMDESIKIWDI----LSGTLLRTLSAHSEPVVSIDLPPFDPSILSS 159

Query: 173 SSYDDTVRIWKDC----------DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
            SYD  +RI+             D DW+         G V  S  + S +   L   S D
Sbjct: 160 GSYDGLIRIFDTATGHCLKTLTYDKDWQ------SENGVVPISQVKFSRNGKYLLVKSLD 213

Query: 223 GTVRIW 228
           G ++IW
Sbjct: 214 GILKIW 219

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 41/112 (36%), Gaps = 8/112 (7%)

Query: 217 CSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
           C  S +G     C++ D   +  E    +     H+R +  + WSP     +T SD   +
Sbjct: 23  CKISPNGKYVAICVDVDIVVFNLEDQSSTTFSTLHSRPLSDLCWSPDSQCIATASDDFTI 82

Query: 277 IYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           I      G     +H L         VK+   G+    LL +   D  + +W
Sbjct: 83  IITHIVFGE----LHRLVGHTAPVTSVKYTMKGN----LLCSCSMDESIKIW 126

>Kwal_26.8776
          Length = 433

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 112/277 (40%), Gaps = 33/277 (11%)

Query: 5   KLLKSLALHDD--KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           KL++ +  H+   +C   D  +    ATGS D  IK+ D+ S ++  +L  T H  TVRS
Sbjct: 112 KLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKL--KLTLTGHVMTVRS 169

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDG 121
           VA      ++ + S D  V  W           DLE    +    GH + +  V      
Sbjct: 170 VAVSQRHPLMFSASEDKMVKCW-----------DLERNAAIRDYHGHFSGVNTVDVHPTL 218

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
           +L+A+  RD  V +W+          +  L  H   +  V      P + S S D TVR+
Sbjct: 219 DLIASAGRDAVVRLWDI----RTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATVRL 274

Query: 182 WKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
           W D     +   +L  H  +V +     + S+V   S SD   VR W   D  G+    +
Sbjct: 275 W-DIRAG-KATKILTHHSKSVRAIAAHPAESSVATASTSD---VRSWRHSD--GQLLTNY 327

Query: 242 IQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIY 278
             E I        + S++ +  G +   G DG L  +
Sbjct: 328 HSEGI------GIINSLSVNADGVLFGGGDDGNLSFF 358

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 110/271 (40%), Gaps = 38/271 (14%)

Query: 60  VRSVAWRPHSNI-LAAGSFDSTVSIWGKDDDGYNDENDLETELLAI-IEGHENEIKCVAW 117
           VR V   P  N   A GS D+T+ +W           D+ +  L + + GH   ++ VA 
Sbjct: 124 VRCVCPDPVDNAWFATGSNDTTIKVW-----------DMASGKLKLTLTGHVMTVRSVAV 172

Query: 118 SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDD 177
           S    L+ + S DK V  W+     E    I     H   V  V  H +L L+AS+  D 
Sbjct: 173 SQRHPLMFSASEDKMVKCWDL----ERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDA 228

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
            VR+W D          L GH+  +        +  +  C  S D TVR+W +       
Sbjct: 229 VVRLW-DIRTRLPVM-TLAGHKSPINQVKCFPVDPQIMSC--SSDATVRLWDIRAG---- 280

Query: 238 EQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGV 297
                + + +   H+++V ++   P     +T S   +  ++ S DG ++   H  + G+
Sbjct: 281 -----KATKILTHHSKSVRAIAAHPAESSVATASTSDVRSWRHS-DGQLLTNYH--SEGI 332

Query: 298 YETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              N +     G     +L   GDDG+++ +
Sbjct: 333 GIINSLSVNADG-----VLFGGGDDGNLSFF 358

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 98/247 (39%), Gaps = 61/247 (24%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFD-STVSIWG 85
           ++A G T  + +L D+  F +I++L  +  +  V +V+       LA GS     + ++ 
Sbjct: 274 LLAVGFTSGEFRLYDLPDFTLIQQL--SMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYE 331

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF 145
              + Y          +   +GH +    +A+S DG  + T S D  + +W+   +   F
Sbjct: 332 WQSESY----------ILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWD---ITSGF 378

Query: 146 ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD------------DWECCA 193
            C++  +EH+  V  V + +   ++ SSS D TVR W                  + C A
Sbjct: 379 -CLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLA 437

Query: 194 V------------------------------LNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
           V                              L+GHEG V    F + NS   L S S D 
Sbjct: 438 VDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENS--VLASASWDK 495

Query: 224 TVRIWCL 230
           T+RIW +
Sbjct: 496 TIRIWSI 502

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 36/161 (22%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G  + T S D KIK+ DI S   +   ++  H  +V +V +     ++ + S D TV  
Sbjct: 356 DGSRVVTASEDGKIKVWDITSGFCLATFEE--HTSSVTAVQFAKRGQVMFSSSLDGTVRA 413

Query: 84  W------------GKDDDGYN----------------DENDLET------ELLAIIEGHE 109
           W            G +   +N                D  D+        +LL  + GHE
Sbjct: 414 WDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHE 473

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISV 150
             + C+++S +  +LA+ S DK++ IW      ++ E I V
Sbjct: 474 GPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEV 514

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/283 (20%), Positives = 104/283 (36%), Gaps = 75/283 (26%)

Query: 113 KC--VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQE-----HSQDVKHVIWHQ 165
           KC  V +S DG L A  S  + + IW+  ++ ++ +    ++      H QD+  + W Q
Sbjct: 98  KCSAVKFSPDGRLFALAS-GRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQ 156

Query: 166 SLPLLASSSYDDTVRIWK-DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
               + ++S D + +IW  D ++        NGH   V  + F  S+   ++ + S DG 
Sbjct: 157 DSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFF--SHDQEKIYTVSKDGA 214

Query: 225 VRIWCL-------------------EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY 265
           V +W                     E D  +Y     ++     A+   V  V + P   
Sbjct: 215 VFVWEFTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFF-YANQAKVKCVTFHPATR 273

Query: 266 IASTG-SDGRLVIYKESEDGWIVECIHELTHGVYETNMV------KWVEYGSKDV----- 313
           + + G + G   +Y   +       I +L+ G    N V      +W+ +GS  +     
Sbjct: 274 LLAVGFTSGEFRLYDLPD----FTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLV 329

Query: 314 --------IL--------------------LITAGDDGHVNVW 328
                   IL                    ++TA +DG + VW
Sbjct: 330 YEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVW 372

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 90/228 (39%), Gaps = 28/228 (12%)

Query: 67  PHSNILAAGSFDSTVSIWGKDD-------DGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           P S  LA G  D  + IW   D          + + D+  + L+ +  H   +  V +S 
Sbjct: 27  PDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSP 86

Query: 120 DGELLATCSRDKSVWIWEAD------EMGEEFECI------SVLQEHSQDVKHVIWHQSL 167
           DG+ LA+ S D+ + IWE +        G E   I        L  H  D++ + W    
Sbjct: 87  DGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDS 146

Query: 168 PLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
            ++ S   D  + IW      +E     + H+  V    F+ +N      + SDD T+++
Sbjct: 147 SIMVSVGLDRAIIIWNGS--TFEKVKRFDVHQSHVKGVVFDPANK--YFATASDDRTIKM 202

Query: 228 WCLEDDNGEYE---QEWIQESILPKAHTRAVYSVNWSPKG-YIASTGS 271
           +      GE     +  I E       T     ++WSP G +IA+  +
Sbjct: 203 FRYH-KTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNA 249

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 215 RLCSGSDDGTVRIWCLED-------DNGEYEQEWIQESILPKA-HTRAVYSVNWSPKGYI 266
           RL +G  DG +RIW + D        N   +++ + + +   + H  +V +V +SP G  
Sbjct: 31  RLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKY 90

Query: 267 ASTGSDGRLVIYKESEDG 284
            ++GSD R+++  E E G
Sbjct: 91  LASGSDDRILLIWELEGG 108

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 66/157 (42%), Gaps = 29/157 (18%)

Query: 4   LKLLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKL----------------VDIRSFQ 46
           +K L +++ H     +V  + +G  +A+GS DR + +                 DI  + 
Sbjct: 66  MKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWN 125

Query: 47  IIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIE 106
           +   L   AH   ++ + W P S+I+ +   D  + IW          N    E +   +
Sbjct: 126 VRRRL--VAHDNDIQDICWAPDSSIMVSVGLDRAIIIW----------NGSTFEKVKRFD 173

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGE 143
            H++ +K V +    +  AT S D+++ ++   + GE
Sbjct: 174 VHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTGE 210

>Scas_721.32
          Length = 822

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 92/218 (42%), Gaps = 32/218 (14%)

Query: 16  KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTA-----HKKTVRSVAWRPHSN 70
           K WS+D         GS+ ++I+     S    +  D+T+     H   V S ++ P + 
Sbjct: 512 KLWSLD---------GSSLKQIQEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNR 562

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
            L +GS D TV +W           D  T L++  +GH + +  V +S  G   AT S D
Sbjct: 563 YLLSGSEDKTVRLWS---------TDTYTSLVS-YKGHNHPVWDVQFSPLGHYFATASHD 612

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
           ++  +W  D +      + +   H  DV  V +H +   + + S D T R+W     D  
Sbjct: 613 QTARLWSCDHI----YPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD-- 666

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              +  GH   V  +    S     L +GS+DG + +W
Sbjct: 667 SVRLFLGHTAPVLCTAV--SPDGRWLATGSEDGIINLW 702

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 115/285 (40%), Gaps = 49/285 (17%)

Query: 62  SVAWRPHSNILAAGSFDSTVSIWGKDDDGYN----------DENDLETELLAIIEGHENE 111
           S+ +   S ++AAG  DS + +W  D               +  D+       + GH   
Sbjct: 492 SLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSGA 551

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH-QSLPL- 169
           +   ++S D   L + S DK+V +W  D     +  +   + H+    H +W  Q  PL 
Sbjct: 552 VYSTSFSPDNRYLLSGSEDKTVRLWSTD----TYTSLVSYKGHN----HPVWDVQFSPLG 603

Query: 170 --LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
              A++S+D T R+W  CD  +    +  GH   V    F  +   V   +GS D T R+
Sbjct: 604 HYFATASHDQTARLW-SCDHIYP-LRIFAGHLSDVDCVSFHPNGCYV--FTGSSDKTCRM 659

Query: 228 WCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIV 287
           W +    G+  + ++        HT  V     SP G   +TGS+  ++      + W +
Sbjct: 660 WDIS--TGDSVRLFL-------GHTAPVLCTAVSPDGRWLATGSEDGII------NLWDI 704

Query: 288 ECIHELT----HGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
                L     HG    + + + + G+    +L++ G D  V VW
Sbjct: 705 GTAKRLKVMRGHGKNAIHSLSYCKEGN----VLVSGGADHSVRVW 745

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 74/179 (41%), Gaps = 32/179 (17%)

Query: 13  HDDKCWSVDVNN-GGIMATGSTDRKIKL------VDIRSFQIIEELDDTAHKKTVRSVAW 65
           H+   W V  +  G   AT S D+  +L        +R F          H   V  V++
Sbjct: 590 HNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIF--------AGHLSDVDCVSF 641

Query: 66  RPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELL 124
            P+   +  GS D T  +W           D+ T + + +  GH   + C A S DG  L
Sbjct: 642 HPNGCYVFTGSSDKTCRMW-----------DISTGDSVRLFLGHTAPVLCTAVSPDGRWL 690

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH-QSLPLLASSSYDDTVRIW 182
           AT S D  + +W+        + + V++ H ++  H + + +   +L S   D +VR+W
Sbjct: 691 ATGSEDGIINLWDIGTA----KRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVW 745

>Scas_721.7
          Length = 325

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 93/217 (42%), Gaps = 35/217 (16%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           NG ++A      +I + D+++ + I  +  T+H   +  VAW P +  LA+ S D T+ I
Sbjct: 26  NGRLIAVTQL-TQILIYDLQT-RAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEI 83

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGE 143
                        L    L  + GH   +  + ++  G LL T S D+S+ IW+    G 
Sbjct: 84  -----------THLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFH-GA 131

Query: 144 EFECISVLQEHSQDV--KHVIWHQSLPLLASSSYDDTVRIWKD----C------DDDWEC 191
             + IS    HS+ V    +   +   +LAS S+D  +R++      C      D DW+ 
Sbjct: 132 ILKTISA---HSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWK- 187

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
                  +G V  S    S +   L   S DG V+IW
Sbjct: 188 -----SDDGVVPISQVRFSPNGKFLLVSSFDGIVKIW 219

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 7   LKSLALHDDKCWSVDVNNGG-IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAW 65
           L  L  H     S+  N+ G ++ T S D  IK+ D     I++ +  +AH ++V S++ 
Sbjct: 91  LHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTI--SAHSESVVSLSI 148

Query: 66  RPH--SNILAAGSFDSTVSIW 84
            P   S++LA+GSFD  + ++
Sbjct: 149 CPDRDSSVLASGSFDGLIRLF 169

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 8/85 (9%)

Query: 244 ESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMV 303
            SI+P +H   +  V WSP     ++ SD   +       G    C+H L         +
Sbjct: 49  HSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHLTHG----CLHRLMGHTAPVISL 104

Query: 304 KWVEYGSKDVILLITAGDDGHVNVW 328
            + + G+    LL T+  D  + +W
Sbjct: 105 TYNDSGN----LLFTSSMDESIKIW 125

>Scas_465.4
          Length = 1002

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 124/280 (44%), Gaps = 41/280 (14%)

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           + P    ++AG+    V IW    D +     LET+L  ++ GHE  I     S +G  +
Sbjct: 145 FSPEKVYISAGTVMGGVLIW----DLF-----LETKLYNLV-GHEGSIFYATISDNGRYI 194

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKD 184
            +CS D+S+ +W   + GEE  C      H+  + ++ +  +   L S S D+T R+W  
Sbjct: 195 TSCSDDRSIKLWNL-QTGEEL-CTG--WGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

Query: 185 CDDDWECCAVLNGHE-------GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
             D+      L   +         VW  D ++ +  V + SG +DG +++  ++D     
Sbjct: 251 LQDEGNGNTSLTLSQIYEVHLIKNVWGVDIQEKDM-VAVTSG-NDGRLKLTKIQDTKTMN 308

Query: 238 EQE--WIQESILPKAHTRAVYSVNWSPKGY------IASTGSDGRLVIYKESEDGWIVEC 289
            QE  +  E I    H+   +S     KG+      + +  S G+++ Y E ++ W +  
Sbjct: 309 AQEVSFSLEDI--STHSVIKFSKGEIIKGFQKFEFGLIAITSLGKIIQYFECDNLWKLLL 366

Query: 290 IHE------LTHGVYETNMVKWVEYGSKDVILLITAGDDG 323
           + E      +THG+ E N+V +    +K   LL+    DG
Sbjct: 367 VSENLVSYSVTHGIMEHNIVTFS--NNKSDALLLKLSQDG 404

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
           +L  GS+DSTV+IW  D    N        L+  + GH + +K + +  D + + T S D
Sbjct: 324 LLFTGSYDSTVAIW--DTKSGN--------LIRRLTGHTDGVKGIYF--DDQKMITASLD 371

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
           K++ +W          CIS  + H   V  V  ++   ++ S+S D TV++W     +  
Sbjct: 372 KTIRVWNYITGS----CISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH---VESR 422

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            C  L GH  T W +  +    +    S SDD T+R+W
Sbjct: 423 TCYTLRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMW 458

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 94/227 (41%), Gaps = 42/227 (18%)

Query: 13  HDDKCWSVDVNNGGIMATGSTDRKIKL--VDIRSFQIIEELDDTAHKKTVRSVAWRPHSN 70
           H D   SVD +   I+ + S D+ +K+  V+ R+   +       H + V  V   P S 
Sbjct: 391 HQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLR-----GHTEWVNCVKLHPKSF 444

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETE-LLAIIEGHENEIKCV--AWSHDGELLATC 127
              + S D T+ +W           D+ T   + +  GH  +++ V      D E L   
Sbjct: 445 TCYSSSDDKTLRMW-----------DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV- 492

Query: 128 SRDKSVWIWEADEMGEEF--ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185
             D+ +      E+ E+F  +C  +   + +   H         L S S D+T+++W+  
Sbjct: 493 --DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLWEV- 540

Query: 186 DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232
                C     GH   VW    + +  N R+ SGS D ++++W L++
Sbjct: 541 -SSGRCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVWDLQN 582

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 103/232 (44%), Gaps = 26/232 (11%)

Query: 62  SVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDG 121
           S+    H  ++ AG+  + + +W  D            + +  + GHE  I  V  S++G
Sbjct: 144 SIKVLRHKVLVNAGTIMNGIIVWELDSK----------KKIHTLRGHEGSIFYVTTSNNG 193

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
           +LLA+CS D+S+ IW+        + +S    H+  + ++ +      L S S D T R+
Sbjct: 194 KLLASCSDDRSIIIWDMVSG----KLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRV 249

Query: 182 WKDCDDDWECCAVLNGH-EGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
           W   +D+     +   H    VW  D E+  +N+   SG +DG +++  L   N     E
Sbjct: 250 WNYKNDELTIKDIFESHLTKNVWGVDVEE--TNLIAISGGNDGRLKVTELVPHNRSCNIE 307

Query: 241 WIQESI-------LPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGW 285
              ESI       + KA+   V   +W   G +  T S+G ++ Y ++ + W
Sbjct: 308 LSLESISEQCDGFIHKAN-EIVKGFHWFDFGLVLIT-SEGNILEYLQNIEEW 357

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 113/273 (41%), Gaps = 27/273 (9%)

Query: 5   KLLKSLALHDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSV 63
           K + +L  H+   + V   NNG ++A+ S DR I + D+ S +++       H   + ++
Sbjct: 172 KKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRA--WGHTARIWNL 229

Query: 64  AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEG---HENEIKCVAWSHD 120
            +      L + S D T  +W   +D    ++  E+ L   + G    E  +  ++  +D
Sbjct: 230 KFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGND 289

Query: 121 GELLAT--CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS----- 173
           G L  T     ++S  I  + E   E +C   + + ++ VK   W     +L +S     
Sbjct: 290 GRLKVTELVPHNRSCNIELSLESISE-QCDGFIHKANEIVKGFHWFDFGLVLITSEGNIL 348

Query: 174 SYDDTVRIWK--DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
            Y   +  WK  D DD +   ++  G+E T++       N+   L S   D    +    
Sbjct: 349 EYLQNIEEWKFLDYDDRFFSFSITQGNENTIFF-----MNNKCLLTSFKFDKFGSVLQKV 403

Query: 232 DDNGEYEQEWIQESI--LPKAHTRAVYSVNWSP 262
           D    YE E + +++  L   HT   Y +  SP
Sbjct: 404 D----YELELLTKTVNCLSVRHTAHFYLIIESP 432

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 95/241 (39%), Gaps = 30/241 (12%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDK----------SVWIWEADEMGEEFECISVLQ-E 153
           + GH  EI CV  S DG+LLA+  +            S   W       EF  +++ +  
Sbjct: 567 LYGHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITRLR 626

Query: 154 HSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAV--LNGHEGTVWSSDFEKSN 211
            S+D +H++         S S D    +W   DDD           H   +W  D+  ++
Sbjct: 627 FSKDNRHLL---------SVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPAS 677

Query: 212 SNVRLCSGSDDGTVRIWCLEDDNGEYEQE---WIQESILPKAHTRAVYSVNWSPKGYIAS 268
                 + S D TV+IW L+   G +E E    ++E+I   A T  +       +  +A 
Sbjct: 678 CGTAFVTASRDKTVKIWRLDGQEGRFEVESNLKLKEAITAVAVTPRLI----EGRLLLAF 733

Query: 269 TGSDGRLVIYKESEDGWI-VECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNV 327
               G + IY  SE  ++ V  +          N ++W     K+ I+L  A  D  V +
Sbjct: 734 GLESGAVHIYTYSERAFLQVLQLDSAIAPADRINRIRWNPAHHKENIMLSVASADSSVRI 793

Query: 328 W 328
           +
Sbjct: 794 Y 794

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 90/255 (35%), Gaps = 66/255 (25%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++A+G+ DR I+L  I++   IEE D T  K     +             F  T  +   
Sbjct: 232 MLASGAQDRYIRLWRIKANNNIEEEDPTKLKLLSNKIY-----------KFQVTADL--- 277

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
                     L     A+I GH++ I  + W      L   + D SV +WE DE+   + 
Sbjct: 278 ---------HLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWV 328

Query: 147 CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD 206
           C S L E S                                  +  +   G  G  WS  
Sbjct: 329 CASRLGEFSS---------------------------------KGASTATGSAGGFWSCL 355

Query: 207 FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPK--AHTRAVYSVNWSPKG 264
           +  +     + +    G+ R+W    D G +EQ       LP     TR+V  V WSP G
Sbjct: 356 WFATGDAEYILANGKTGSWRMWENRGDGGSWEQ-------LPAITGPTRSVTDVAWSPSG 408

Query: 265 -YIASTGSDGRLVIY 278
            Y+ ++  D    +Y
Sbjct: 409 SYLLASSLDQTTRLY 423

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 25/203 (12%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           AH   V SV +     +L + S D+T+++W  D+           EL   +EG ++ +  
Sbjct: 77  AHNAEVTSVKFIGAEKLLVSASADATINVWRGDE---------RWELAQTLEGPKSSVTS 127

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP----LL 170
           +A +    L+     D ++ +W   E  + F   S        +   +  Q L     +L
Sbjct: 128 LAVA--AGLIVAGFADGTLSVWS--EHDDAFVLSSQFLIRKGFLPLALALQKLSDGCYML 183

Query: 171 ASSSYDDTVRIWKDC---DDDWECCAVLNGHEGTVWSSDFE-KSNSNV--RLCSGSDDGT 224
           A S     + ++  C     D E  A + GHE   W  D   +SN      L SG+ D  
Sbjct: 184 AVSGTSTDLMVYSVCVAATVDVELSATVEGHED--WIKDLAFRSNGPGDWMLASGAQDRY 241

Query: 225 VRIWCLEDDNGEYEQEWIQESIL 247
           +R+W ++ +N   E++  +  +L
Sbjct: 242 IRLWRIKANNNIEEEDPTKLKLL 264

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 76/158 (48%), Gaps = 17/158 (10%)

Query: 103 AIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
            ++  H      + WS DG+ +AT S D SV I         +  +     H+  V  + 
Sbjct: 49  TLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHL-----SYGLLHTFIGHTAPVISLT 103

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           +++   LL +SS D++++IW   +        ++ H   V S D   ++S++ L SGS D
Sbjct: 104 FNRKGNLLFTSSMDESIKIWDTLNGSLM--KTISAHSEAVVSVDVPMNDSSI-LSSGSYD 160

Query: 223 GTVRIW------CLEDDNGEYEQEWIQES-ILPKAHTR 253
           G +RI+      CL+     Y+++W +E+ ++P +  +
Sbjct: 161 GLIRIFDAETGHCLK--TLTYDKDWKRENGVVPISQVK 196

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 75/186 (40%), Gaps = 32/186 (17%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
           T+H +    + W P    +A  S D +V I             L   LL    GH   + 
Sbjct: 52  TSHARPFSELCWSPDGQCIATASDDFSVEII-----------HLSYGLLHTFIGHTAPVI 100

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV-IWHQSLPLLAS 172
            + ++  G LL T S D+S+ IW+    G   + IS    HS+ V  V +      +L+S
Sbjct: 101 SLTFNRKGNLLFTSSMDESIKIWDTLN-GSLMKTIS---AHSEAVVSVDVPMNDSSILSS 156

Query: 173 SSYDDTVRIW----KDC------DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
            SYD  +RI+      C      D DW+         G V  S  + S +   L   S D
Sbjct: 157 GSYDGLIRIFDAETGHCLKTLTYDKDWK------RENGVVPISQVKFSENARYLLVKSLD 210

Query: 223 GTVRIW 228
           G V+IW
Sbjct: 211 GVVKIW 216

>Scas_673.11
          Length = 434

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/252 (19%), Positives = 105/252 (41%), Gaps = 38/252 (15%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H  +V ++A  P   ++  G  D+   +W               +    +EGH   +   
Sbjct: 68  HTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQ--------PPKFAGTLEGHTESVVAS 119

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLL----A 171
           A++HDG+ L T      + + ++++ G ++   S LQE    V+ V+W +  P++    A
Sbjct: 120 AFTHDGQFLVTADMTGKIMVHKSNKSGSQWSLTSTLQE----VEEVVWLKCHPVISGVFA 175

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNG--HEGTVWSSDF---EKSNSNVRLCSGSDDGTVR 226
             + D +V  ++  D+D     +++G  H+      +F   ++  + + L + S D ++ 
Sbjct: 176 FGATDGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGEFINIDQGENVLELVTCSVDSSIV 235

Query: 227 IW-CL---------EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
            W C          +D+    E  W+  ++ P   T           G IA+  ++G L 
Sbjct: 236 GWNCFTAQPTFKITKDEIKGLEAPWVSLAVAPSKMTNG-------NSGIIAAGANNGVLA 288

Query: 277 IYKESEDGWIVE 288
           I   +  G +++
Sbjct: 289 IINCNNAGAVLQ 300

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 27/60 (45%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF 207
           ++   +H+  V  +  H +LPL+ +   D+   +W       +    L GH  +V +S F
Sbjct: 62  VAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLEGHTESVVASAF 121

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 79/171 (46%), Gaps = 21/171 (12%)

Query: 60  VRSVAWRPHSNI-LAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAW 117
           VR VA  P  N     GS D+T+ +W           DL T +L   + GH   ++ VA 
Sbjct: 142 VRCVAIDPVDNEWFITGSNDTTMKVW-----------DLATGKLKTTLAGHVMTVRDVAV 190

Query: 118 SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDD 177
           S     L + S DK+V  W+     E+ + I     H   V+ V  H +L L+A++  D 
Sbjct: 191 SDRHPYLFSVSEDKTVKCWDL----EKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDS 246

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            +++W D         ++ GH+G +  +  + +  + ++ S S D TVR+W
Sbjct: 247 VIKLW-DMRTRIPVITLV-GHKGPI--NQVQCTPVDPQVVSSSTDATVRLW 293

 Score = 31.6 bits (70), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 66/170 (38%), Gaps = 49/170 (28%)

Query: 16  KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAG 75
           +C  VD      + + STD  ++L D+ + + ++ L  T HK++VR+ A  P    +A+ 
Sbjct: 273 QCTPVDPQ----VVSSSTDATVRLWDVVAGKTMKVL--THHKRSVRATALHPKEFSVASA 326

Query: 76  SFDSTVSIWG------------------------KDD-----------------DGYNDE 94
             D   S WG                        +DD                  G+  +
Sbjct: 327 CTDDIRS-WGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQ 385

Query: 95  NDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE 144
           +    E++  +EG E  + C  +   G  L T   DKS+ IW+ DE   +
Sbjct: 386 SLATREMVGSLEG-ERSVLCSTFDKTGLRLITGEADKSIKIWKQDETATK 434

>Kwal_56.24163
          Length = 729

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 20/165 (12%)

Query: 63  VAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENE-IKCVAWS-- 118
           VA+ P   +  A+   D TV IW       N            ++ HE   +  V +   
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSLGQPTAN----------FTLQAHETRGVNYVDYYPL 52

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
            D   L T S D++V IW+         C++ L+ H  +V + ++H SLP++ S S D T
Sbjct: 53  QDKPYLITSSDDRTVKIWDYQTKS----CVATLEGHMANVSYAVFHPSLPIILSGSEDGT 108

Query: 179 VRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
           +++W    + ++    LN      W      +     + SG D+G
Sbjct: 109 LKVWN--SNTYKLEKTLNLGLERSWCIATHPTGKRNYIASGFDNG 151

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (48%), Gaps = 17/115 (14%)

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEH-SQDVKHVIWH--QSLPLLASSSYD 176
           D    A+   D +V IW   +    F     LQ H ++ V +V ++  Q  P L +SS D
Sbjct: 9   DPSTFASACLDHTVKIWSLGQPTANF----TLQAHETRGVNYVDYYPLQDKPYLITSSDD 64

Query: 177 DTVRIWKDCDDDWE---CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            TV+IW     D++   C A L GH   V  + F  S   +   SGS+DGT+++W
Sbjct: 65  RTVKIW-----DYQTKSCVATLEGHMANVSYAVFHPSLPII--LSGSEDGTLKVW 112

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW 84
           + T S DR +K+ D ++   +  L+   H   V    + P   I+ +GS D T+ +W
Sbjct: 58  LITSSDDRTVKIWDYQTKSCVATLE--GHMANVSYAVFHPSLPIILSGSEDGTLKVW 112

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 112/237 (47%), Gaps = 34/237 (14%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRS----FQIIEELDDTAHKKTV 60
           K +++L+ H D+   +  NN  ++ +GS D +I   D+R     F+ IE     +H + V
Sbjct: 335 KCIRTLSGHIDRVACLSWNNH-VLTSGSRDHRILHRDVRMPDPFFETIE-----SHTQEV 388

Query: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-H 119
             + W    N LA+G  D+ V ++         E   ++ +L   E H+  +K +AWS H
Sbjct: 389 CGLKWNVADNKLASGGNDNVVHVY---------EGTSKSPILTFDE-HKAAVKAMAWSPH 438

Query: 120 DGELLATC--SRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PLLASSSYD 176
              +LAT   + D+ + IW  +   +    +S +   SQ + +++W ++   L+ S  Y 
Sbjct: 439 KRGVLATGGGTADRRLKIWNVNTSIK----MSDIDSGSQ-ICNMVWSKNTNELVTSHGYS 493

Query: 177 D-TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232
              + +W DC+   +  A+L GH   V       SN    + SG+ D T+R W L D
Sbjct: 494 KYNLTLW-DCNS-MDPIAILKGHSFRVL--HLTLSNDGTTVVSGAGDETLRYWKLFD 546

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 88/180 (48%), Gaps = 20/180 (11%)

Query: 5   KLLKSLALHDDKCWS-VDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSV 63
           ++L + +L DD  +S +D ++  ++A  +  + I L D  +  ++  L DT ++ T  S+
Sbjct: 253 RVLDAPSLADDFYYSLIDWSSTDVLAV-ALGKSIFLTDNNTGDVVH-LCDTENEYT--SL 308

Query: 64  AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGEL 123
           +W    + LA G  +  V I+          + ++ + +  + GH + + C++W  +  +
Sbjct: 309 SWIGAGSHLAVGQANGLVEIY----------DVMKRKCIRTLSGHIDRVACLSW--NNHV 356

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK 183
           L + SRD  +   +       FE I   + H+Q+V  + W+ +   LAS   D+ V +++
Sbjct: 357 LTSGSRDHRILHRDVRMPDPFFETI---ESHTQEVCGLKWNVADNKLASGGNDNVVHVYE 413

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 79/192 (41%), Gaps = 32/192 (16%)

Query: 48  IEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEG 107
           +     T+H +++  + W P S  +A  S D T+ I           N +    L  + G
Sbjct: 47  LSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEI-----------NHITYGRLHRLVG 95

Query: 108 HENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL 167
           H   +  + ++  G LL + S D+S+ IW+    G   + IS    HS+ V  +      
Sbjct: 96  HTAPVLSLVYTSKGNLLCSASMDESIKIWDV-LTGTLLKTIS---AHSEPVVSIDMPVCD 151

Query: 168 P-LLASSSYDDTVRIWKDC----------DDDWECCAVLNGHEGTVWSSDFEKSNSNVRL 216
           P +L+S SYD  +RI+             D DW+         G V  S  + S +   L
Sbjct: 152 PSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWK------SENGVVPISQVKFSVNGKYL 205

Query: 217 CSGSDDGTVRIW 228
              S DG ++IW
Sbjct: 206 LVKSLDGVLKIW 217

>Scas_558.3
          Length = 725

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 111/247 (44%), Gaps = 32/247 (12%)

Query: 37  IKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEND 96
           + L+DI S           H   V +++++ H + + +GS+D+T  +W            
Sbjct: 82  VSLLDIESIDKDPLYTLIGHHSNVCALSYK-HMSAIISGSWDTTAKVW------------ 128

Query: 97  LETELLAIIEGHENEI-KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS 155
           +   L   +EGH+  +      S +     T S D++V +W+ +++ + F  I     HS
Sbjct: 129 INGALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLWKENKLLKTFSGI-----HS 183

Query: 156 QDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR 215
             ++++    S   +A+ S D T++I    D D     VL+GHE  V++    K     +
Sbjct: 184 DVIRNIEVLSSGKEIATCSNDGTIKI---SDLDGNIKQVLSGHESFVYNVKLSKQGD--K 238

Query: 216 LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRL 275
           L S  +D ++RIW   D N  +    I++ I  K    +++ V+  P G I    SD  +
Sbjct: 239 LVSCGEDRSLRIW---DINNNFN---IKQVI--KLPAVSIWCVDTLPNGDIVVGCSDNTV 290

Query: 276 VIYKESE 282
            I+ E +
Sbjct: 291 RIFTEDQ 297

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 73/176 (41%), Gaps = 23/176 (13%)

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEG-HENEIKCVAWSHDGELLATCS 128
           N     S D TV +W             E +LL    G H + I+ +     G+ +ATCS
Sbjct: 155 NTFITASADRTVKLWK------------ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCS 202

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188
            D ++ I + D   ++     VL  H   V +V   +    L S   D ++RIW D +++
Sbjct: 203 NDGTIKISDLDGNIKQ-----VLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIW-DINNN 256

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244
           +    V+     ++W  D   +  N  +  G  D TVRI+  ED      Q  I E
Sbjct: 257 FNIKQVIKLPAVSIWCVD---TLPNGDIVVGCSDNTVRIFT-EDQTRVASQSEIDE 308

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 25/130 (19%)

Query: 14  DDKCWSVDVNNGGIMATGSTDRKIKL----VDIRSFQIIEELDDTAHKKTVRSVAWRPHS 69
           D K  SV+ N      T S DR +KL      +++F  I       H   +R++      
Sbjct: 146 DAKIISVEENT---FITASADRTVKLWKENKLLKTFSGI-------HSDVIRNIEVLSSG 195

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
             +A  S D T+ I           +DL+  +  ++ GHE+ +  V  S  G+ L +C  
Sbjct: 196 KEIATCSNDGTIKI-----------SDLDGNIKQVLSGHESFVYNVKLSKQGDKLVSCGE 244

Query: 130 DKSVWIWEAD 139
           D+S+ IW+ +
Sbjct: 245 DRSLRIWDIN 254

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 111/256 (43%), Gaps = 48/256 (18%)

Query: 24  NGGIMATGSTDRKIKLVDIRS-FQIIEELDD-------------TAHKKTVRSVAWRPHS 69
           N  I+A+GS D KI + +I   + + E +D+             + H + V  + + P +
Sbjct: 105 NDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLA 164

Query: 70  -NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
            NILA+ S D TV IW           D+  E +     H + +  +++S+DG+ L T S
Sbjct: 165 ENILASSSLDYTVKIW-----------DISQEEVKFTLKHPDMVTSMSFSYDGKHLVTVS 213

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHS-QDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD 187
           RDK + +W  D   E  + +S    HS    + V+W      +A++ +    R+      
Sbjct: 214 RDKKLRVW--DVRAE--KIVSEGPAHSGAKNQRVVWLGDTDKVATTGFS---RLSDRQIG 266

Query: 188 DWECCAVLNGHEGTVWSSD--------FEKSNSNVRLCSGSDDGTVRIWCLEDDN----G 235
            W+   +  G+ G  ++ D        F   ++ +   +G  DG +R +  ++D      
Sbjct: 267 VWDAFNLEKGNLGGFYNVDQSSGILMPFYDDSNRILYVAGKGDGNIRYFEFQNDELYELS 326

Query: 236 EYEQEWIQE--SILPK 249
           EY+    Q   ++ PK
Sbjct: 327 EYQSTEPQRGFAVAPK 342

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 67/148 (45%), Gaps = 23/148 (15%)

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPK-- 249
             +  GH   V  +DF   N ++ + SGSDDG + IW + +D G +  E++ E   PK  
Sbjct: 86  VPLFRGHTAQVLDTDFSPFNDHI-VASGSDDGKIGIWEIPEDYGLH--EYVDEEGNPKDL 142

Query: 250 -------AHTRAVYSVNWSP--KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYET 300
                   H+R V  + + P  +  +AS+  D  + I+  S++    E    L H     
Sbjct: 143 KPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQE----EVKFTLKH----P 194

Query: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328
           +MV  + + S D   L+T   D  + VW
Sbjct: 195 DMVTSMSF-SYDGKHLVTVSRDKKLRVW 221

>Kwal_23.6240
          Length = 913

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 81/216 (37%), Gaps = 58/216 (26%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           +GH +    V +S DG  + T S D  + IW+         C+   QEH+  V  + + +
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGF----CLVTFQEHTAAVSALAFAK 393

Query: 166 SLPLLASSSYDDTVRIW-----------------------KDCDDDWECCA--------- 193
              +L S+S D TVR W                        D   +  C           
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 194 ----------VLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQ 243
                      L+GHEG V    F + NS   L S S D T+RIW +   + + E   + 
Sbjct: 454 WSVQTGQLVETLDGHEGPVSCLSFSQENS--VLASASWDKTIRIWSIFGRSQQVEPLEVY 511

Query: 244 ESILPKAHTRAVYSVNWSPKGY-IASTGSDGRLVIY 278
             +L         S++  P G  +A+   DG+++ +
Sbjct: 512 ADVL---------SLSVRPDGNEVAAATLDGQILFF 538

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 20/131 (15%)

Query: 25  GGIMATGSTDRKIK---LVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDS-T 80
           G ++ + S D  ++   LV  R+F+        A +     +A  P   ++ AGS DS  
Sbjct: 395 GQVLFSASLDGTVRAWDLVRYRNFRTFT----AAERIQFNCLAADPSGEVVCAGSVDSFA 450

Query: 81  VSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEAD 139
           V +W            ++T +L+  ++GHE  + C+++S +  +LA+ S DK++ IW   
Sbjct: 451 VHVWS-----------VQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIF 499

Query: 140 EMGEEFECISV 150
              ++ E + V
Sbjct: 500 GRSQQVEPLEV 510

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 112/291 (38%), Gaps = 49/291 (16%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H+K V+ VA  P   +L +            D+DG     +   + +      +  +  +
Sbjct: 54  HRKNVQCVALNPQGTLLLS-----------VDEDGRAILVNFRAKTVLHHFNFKEPVSDL 102

Query: 116 AWSHDGELLA-TCSRDKSVWIWEADEMGEEFECISVLQE-----HSQDVKHVIWHQSLPL 169
            +S DG++ A  C R   V +W+  ++ E+ +    ++      H  ++  + W +    
Sbjct: 103 KFSPDGKVFAIACGR--FVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRF 160

Query: 170 LASSSYDDTVRIWK-DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
           L S+S D T RIW  D  +         GH   V  + F  S    R+ + S DG V  W
Sbjct: 161 LISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFF--SADQERIYTVSKDGAVFQW 218

Query: 229 CLEDDNGEYEQEWIQES-ILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIV 287
                 G    E  +E+ I P     ++YS   + K Y  ++ +  + V +  + +  +V
Sbjct: 219 EYTPRPGFESPEQDEETEIDP-----SLYSWRITKKNYFYASQARVKCVTFHANSNTLVV 273

Query: 288 ---------------ECIHELTHGVYETNMV------KWVEYGSKDVILLI 317
                            I +L+ G    N V      +W+ +GS  +  L+
Sbjct: 274 GFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDSGEWLAFGSSKLGQLL 324

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 68/160 (42%), Gaps = 16/160 (10%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G  + T S D KIK+ D+ S   +    +  H   V ++A+     +L + S D TV  
Sbjct: 352 DGSRVVTASEDGKIKIWDVVSGFCLVTFQE--HTAAVSALAFAKRGQVLFSASLDGTVRA 409

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK-SVWIWEADEMG 142
           W  D   Y +                 +  C+A    GE++   S D  +V +W      
Sbjct: 410 W--DLVRYRN-------FRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSV---- 456

Query: 143 EEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +  + +  L  H   V  + + Q   +LAS+S+D T+RIW
Sbjct: 457 QTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIW 496

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 132/330 (40%), Gaps = 52/330 (15%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI--LAAGSFDSTV 81
            G ++ +   D +  LV+ R+  ++   +    K+ V  + + P   +  +A G F   V
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHFN---FKEPVSDLKFSPDGKVFAIACGRF---V 119

Query: 82  SIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
            +W K  D   D          +  GH + I  + WS D   L + S+D +  IW  D  
Sbjct: 120 QVW-KTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQ 178

Query: 142 GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK----------DCDDDWEC 191
            +    ++    H   V    +      + + S D  V  W+          + D++ E 
Sbjct: 179 EKGLASVT-FAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEI 237

Query: 192 CAVLNG----HEGTVWSSDFE------KSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
              L       +   ++S          +NSN  L  G ++G  R++ L       E   
Sbjct: 238 DPSLYSWRITKKNYFYASQARVKCVTFHANSNT-LVVGFNNGEFRLYELP------EFTL 290

Query: 242 IQESILPKAHTRAVYSVNWSPKGYIASTGSD--GRLVIYKESEDGWIVECIHELTHGVYE 299
           IQ+  + +    AV +V  +  G   + GS   G+L++Y+   + +I++       G ++
Sbjct: 291 IQQLSMGQ---NAVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSESYILK-----QQGHFD 342

Query: 300 -TNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            TN V +   GS+    ++TA +DG + +W
Sbjct: 343 ATNAVTYSPDGSR----VVTASEDGKIKIW 368

>Scas_720.45
          Length = 755

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 16/123 (13%)

Query: 63  VAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-- 119
           VA+ P   N  A+G  D TV +W       N           +  G E  +  V +    
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWSLGQATPN---------FTLNSGQEKGVNYVDYYPLP 53

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTV 179
           D   L T S D +  +W+         C++ L+ H  +V   ++H +LP++ S S D T+
Sbjct: 54  DKPYLITSSDDLTCKVWDYQTKS----CVATLEGHMANVSFAVFHPTLPIIISGSEDGTL 109

Query: 180 RIW 182
           +IW
Sbjct: 110 KIW 112

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 16/121 (13%)

Query: 114 CVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ--SLPLL 170
           CVA++  D    A+   D++V +W    +G+     ++     + V +V ++     P L
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWS---LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYL 58

Query: 171 ASSSYDDTVRIWKDCDDDWE---CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
            +SS D T ++W     D++   C A L GH   V  + F  +   +   SGS+DGT++I
Sbjct: 59  ITSSDDLTCKVW-----DYQTKSCVATLEGHMANVSFAVFHPTLPII--ISGSEDGTLKI 111

Query: 228 W 228
           W
Sbjct: 112 W 112

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 76/187 (40%), Gaps = 32/187 (17%)

Query: 53  DTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112
           +T H + +  + W P S  +A+GS D TV I             LE   L  + GH   +
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEI-----------THLEYGRLHKLRGHSAPV 99

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV-IWHQSLPLLA 171
             V ++  G LL T S D+S+  W+          +  +  HS  V  +        +L+
Sbjct: 100 LSVVFNCKGNLLCTASVDESIKQWDV----LSGTLLKTMSAHSDPVVSIDTPDCDATILS 155

Query: 172 SSSYDDTVRIWKD----C------DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
           S SYD  +RI+      C      D DW+        +G V  S  + S +   L   S 
Sbjct: 156 SGSYDGLIRIFDTESGHCLKTLTYDKDWQ------TDDGVVPISQVKFSRNGKFLLVRSL 209

Query: 222 DGTVRIW 228
           DG V++W
Sbjct: 210 DGVVKLW 216

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 96/231 (41%), Gaps = 26/231 (11%)

Query: 108 HENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL 167
           H   I  + WS D   +A+ S D +V I        E+  +  L+ HS  V  V+++   
Sbjct: 54  HTEPINDICWSPDSACVASGSEDFTVEITHL-----EYGRLHKLRGHSAPVLSVVFNCKG 108

Query: 168 PLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
            LL ++S D++++ W            ++ H   V S D    ++ + L SGS DG +RI
Sbjct: 109 NLLCTASVDESIKQWDVLSGTL--LKTMSAHSDPVVSIDTPDCDATI-LSSGSYDGLIRI 165

Query: 228 W------CLEDDNGEYEQEW-IQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKE 280
           +      CL+     Y+++W   + ++P      +  V +S  G      S   +V   +
Sbjct: 166 FDTESGHCLK--TLTYDKDWQTDDGVVP------ISQVKFSRNGKFLLVRSLDGVVKLWD 217

Query: 281 SEDGWIVECIHELT---HGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              G +V    + +      Y   M           ++++  G+DG++ VW
Sbjct: 218 FIRGCVVRTFKDASGESRMKYSCGMDFLYPDSEAADVMVVVGGEDGNICVW 268

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 91/228 (39%), Gaps = 43/228 (18%)

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS 173
           C   S DG  +A   R  ++ ++   + G    C      H++ +  + W      +AS 
Sbjct: 19  CARVSPDGRYVAVADR-TAICVYSVGDGG----CARYETTHTEPINDICWSPDSACVASG 73

Query: 174 SYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE-KSNSNVRLCSGSDDGTVRIWCLED 232
           S D TV I      ++     L GH   V S  F  K N    LC+ S D +++ W    
Sbjct: 74  SEDFTVEITH---LEYGRLHKLRGHSAPVLSVVFNCKGN---LLCTASVDESIKQW---- 123

Query: 233 DNGEYEQEWIQESILP--KAHTRAVYSVNWSP--KGYIASTGSDGRLVIYKESEDGWIVE 288
                  + +  ++L    AH+  V S++ +P     I S+GS   L+   ++E G    
Sbjct: 124 -------DVLSGTLLKTMSAHSDPVVSID-TPDCDATILSSGSYDGLIRIFDTESG---H 172

Query: 289 CIHELTH--------GVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           C+  LT+        GV   + VK+   G      L+    DG V +W
Sbjct: 173 CLKTLTYDKDWQTDDGVVPISQVKFSRNGK----FLLVRSLDGVVKLW 216

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 103/227 (45%), Gaps = 30/227 (13%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK 159
           EL+  + GHE  I  +  S   +L+A+CS D+S+ +W+  E G+E   +S+   H+  + 
Sbjct: 170 ELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDR-ETGKE---LSIGWSHTARIW 225

Query: 160 HVIWHQSLPLLASSSYDDTVRIWKDCDDD-----WECCAVLNGH-EGTVWSSDFEKSNSN 213
           ++ +  +   L S S D T R+W    +D      +   +  GH    VW  D    N  
Sbjct: 226 NLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWGVDV---NDE 282

Query: 214 VRLCSGS-DDGTVRIWCLEDDNGE------YEQEWIQESI-LPKAHTRAVYSVNWSPKGY 265
            R+ + S +DG + +  L  D         YE   I+++  +       +    W   G 
Sbjct: 283 KRIIATSGNDGRINVIDLNTDTNSGDEVIGYEIADIEKAAGISFEKDEIIKGFYWFKFGL 342

Query: 266 IASTGSDGRLVIYKESEDGWIVECI-------HELTHGVYETNMVKW 305
           +  T S GR++ ++     W  +C+       + +T+G+YE+N+V +
Sbjct: 343 VCIT-SQGRVLAFQTETKQW-RQCLLDSRFASYSITNGIYESNIVFF 387

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 7/124 (5%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
           +EGHE  I C   S DG L+A+CS D+S+ +W   E GE+   + +   H+  +  + + 
Sbjct: 177 LEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSL-ETGEQ---VGIAWGHTARIWDLRFL 232

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHE-GTVWSSDFEKSNSNVRLCSGSDDG 223
           +    L S S D T R+W    +  +  AV + H+  +VW+ D ++   ++   +  +DG
Sbjct: 233 RVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDVQE--DDMVAVTAGNDG 290

Query: 224 TVRI 227
            +R+
Sbjct: 291 RLRL 294

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 88/208 (42%), Gaps = 41/208 (19%)

Query: 40  VDIRSFQIIEELDDTAHKKTVRSVAWRP-HSNILAAGSFDSTVSIWGKDDDGYNDENDLE 98
           +DI+  + +     T H + V  V + P   N+LA+ S D TV +W           ++E
Sbjct: 128 IDIKPVKFL-----TGHARKVGHVLYHPVAENVLASSSGDYTVKLW-----------NVE 171

Query: 99  TELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS-QD 157
           T    I   H + +  +++S+DG  LAT +RDK + +W   E     + +S    H+   
Sbjct: 172 TGKDMITLKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREE----KIVSEGPAHTGAK 227

Query: 158 VKHVIWHQSLPLLASSSY----DDTVRIWKDCDDDWECCAVLNGHEGTVWSSD------- 206
            + V+W  +   LA++ +    D  + I       W+   +  G  G  ++ D       
Sbjct: 228 NQRVVWLGNSDRLATTGFSKLSDRQIGI-------WDAFNIEKGDLGGFYTVDQSSGILM 280

Query: 207 -FEKSNSNVRLCSGSDDGTVRIWCLEDD 233
            F    + +    G  DG +R +  ++D
Sbjct: 281 PFYDEGNKILYLVGKGDGNIRYYEFQND 308

>Scas_720.83d
          Length = 915

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 95/247 (38%), Gaps = 61/247 (24%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFD-STVSIWG 85
           ++  G T+ + +L ++  F ++++L  +  +  + +VA       LA GS     + ++ 
Sbjct: 272 MLVVGFTNGEFRLYELPHFTLLQQL--SMGQNPINTVAVNSSGEWLAFGSSKLGQLLVYE 329

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF 145
              + Y          +   +GH +    + +S DG  + T + D  + +W+        
Sbjct: 330 WQSESY----------ILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGF--- 376

Query: 146 ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD------------DWECCA 193
            C++  QEH+  V  V + +   +L SSS D TVR W                  + C A
Sbjct: 377 -CLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLA 435

Query: 194 V------------------------------LNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
           V                              L+GHEG V    F + NS   L S S D 
Sbjct: 436 VDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENS--VLASASWDK 493

Query: 224 TVRIWCL 230
           TVR+W +
Sbjct: 494 TVRVWSI 500

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 61/131 (46%), Gaps = 20/131 (15%)

Query: 25  GGIMATGSTDRKIK---LVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDST- 80
           G ++ + S D  ++   L+  R+F+        A +     +A  P   ++ AGS D+  
Sbjct: 397 GQVLFSSSLDGTVRAWDLIRYRNFRTFT----AAERIQFNCLAVDPSGEVVCAGSLDNFD 452

Query: 81  VSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEAD 139
           + +W            ++T +LL  + GHE  + C+A+S +  +LA+ S DK+V +W   
Sbjct: 453 IHVWS-----------VQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIF 501

Query: 140 EMGEEFECISV 150
              ++ E   V
Sbjct: 502 GRSQQVEPFDV 512

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 66/160 (41%), Gaps = 16/160 (10%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G  + T + D KIK+ D+ S   +    +  H  +V  V +     +L + S D TV  
Sbjct: 354 DGSRVVTAAEDGKIKVWDVVSGFCLATFQE--HTSSVTQVQFAKRGQVLFSSSLDGTVRA 411

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK-SVWIWEADEMG 142
           W  D   Y +                 +  C+A    GE++   S D   + +W      
Sbjct: 412 W--DLIRYRN-------FRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV---- 458

Query: 143 EEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +  + +  L  H   V  + + Q   +LAS+S+D TVR+W
Sbjct: 459 QTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVW 498

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 53/130 (40%), Gaps = 10/130 (7%)

Query: 13  HDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H     ++D+N  G ++ +   D +  L + ++  ++   +    K+    V + P   +
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAILTNFKAKTVLHHFN---FKEKCYQVKFSPDGKL 110

Query: 72  --LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
             LA G F   + IW K  D   D          +  GH  +I  + WS D   + + S+
Sbjct: 111 FALATGRF---LQIW-KTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIISTSK 166

Query: 130 DKSVWIWEAD 139
           D +  IW  D
Sbjct: 167 DLTARIWSID 176

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 93/238 (39%), Gaps = 60/238 (25%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           +GH +    + +S DG  + T + D  + +W+   +   F C++  +EH+  V  V + +
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWD---VASGF-CLATFEEHTSAVTAVQFAK 393

Query: 166 SLPLLASSSYDDTVRIWKDCDD------------DWECCAV------------------- 194
              +L S+S D TVR W                  + C AV                   
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 195 -----------LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQ 243
                      L+GHEG V    F  S  N  L S S D T+RIW +   + + E   + 
Sbjct: 454 WSVQTGQLLDTLSGHEGPVSCLAF--SMENAVLASASWDKTIRIWSIFGRSQQVEPLEVF 511

Query: 244 ESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDGWI--VECIHELTHGVY 298
             IL         ++  +P G ++A +   G+L I+  +    I  ++C  ++  G +
Sbjct: 512 ADIL---------AITITPDGKHVAVSTLKGQLTIFDIASGKQIGNIDCRKDIISGRF 560

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 131/334 (39%), Gaps = 37/334 (11%)

Query: 13  HDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H     + DVN  G ++ +  TD +  LV+ ++  ++   +    K    SV + P    
Sbjct: 54  HRKNIATFDVNKQGTLLLSVDTDGRAILVNFKTRNVLHHFN---FKDKCYSVKFSPDGRY 110

Query: 72  --LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
             LA G F   + IW K  D   D          +  GH  +I    WSHD   L T S+
Sbjct: 111 FALAVGRF---LQIW-KTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTSK 166

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D +  +W  +   +E    + L  H   V    ++ +   + + S D  V  W+      
Sbjct: 167 DLTSRVWSINSEDKEL-VATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWEYISKAQ 225

Query: 190 ECCAVLNGHEGTVWS---------SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
           +        E    S         + F  + + V+ C+   +  + I      NGE+   
Sbjct: 226 KEGLDEEDLEDEDLSKLSWRITKKNFFYANQAKVKCCTFHINSNLLIVGFS--NGEFRLY 283

Query: 241 WIQESILPKAHTRA-----VYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTH 295
            + E ++ +  +         SVN S +     +   G+L++Y+   + +I++       
Sbjct: 284 EMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQLLVYEWQSESYILK-----QQ 338

Query: 296 GVYE-TNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           G ++ TN + +   GS+    ++TA +DG + VW
Sbjct: 339 GHFDATNSLTYSPDGSR----VVTAAEDGKIKVW 368

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 23/146 (15%)

Query: 25  GGIMATGSTDRKIK---LVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDST- 80
           G ++ + S D  ++   L+  R+F++         +     +A  P   +++AGS DS  
Sbjct: 395 GQVLFSASLDGTVRAWDLIRYRNFRVFT----ATERVQFTCLAVEPSGEVVSAGSTDSFD 450

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
           V +W               +LL  + GHE  + C+A+S +  +LA+ S DK++ IW    
Sbjct: 451 VFVWSVQTG----------QLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIFG 500

Query: 141 MGEEFECISVLQE-----HSQDVKHV 161
             ++ E + V  +      + D KHV
Sbjct: 501 RSQQVEPLEVFADILAITITPDGKHV 526

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 68/160 (42%), Gaps = 16/160 (10%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G  + T + D KIK+ D+ S   +   ++  H   V +V +     +L + S D TV  
Sbjct: 352 DGSRVVTAAEDGKIKVWDVASGFCLATFEE--HTSAVTAVQFAKKGQVLFSASLDGTVRA 409

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK-SVWIWEADEMG 142
           W  D   Y +                 +  C+A    GE+++  S D   V++W      
Sbjct: 410 W--DLIRYRN-------FRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSV---- 456

Query: 143 EEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +  + +  L  H   V  + +     +LAS+S+D T+RIW
Sbjct: 457 QTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIW 496

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 112/231 (48%), Gaps = 26/231 (11%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K +++L+ H D+   +  NN  I+++GS DR I   D+R      E  +T H++ +  + 
Sbjct: 409 KCIRTLSGHLDRVACLSWNNH-ILSSGSRDRTILHRDVRMADPFFEKIET-HEQEICGLK 466

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGEL 123
           W  + N LA+G  D+ V ++    DG +      T  L+I E H+  +K +AWS H   +
Sbjct: 467 WNTNDNKLASGGNDNMVFVY----DGTS-----RTPFLSINE-HKAAVKAMAWSPHKQGI 516

Query: 124 LAT--CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PLLASSSYDD-TV 179
           LAT   + D+++ +W  +   +    ++ +   SQ V +++W  +   ++ S  Y    +
Sbjct: 517 LATGGGTADRTLKMWNVNTSVK----LNDVDTGSQ-VCNMVWSTNTDEIVTSHGYSKYNL 571

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
            IW+    + E  A+L GH   V       S     + SG+ D T+R W L
Sbjct: 572 TIWEAS--NLEPLAILKGHSFRVL--HLTLSADGTTIVSGAGDETLRYWKL 618

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 78/193 (40%), Gaps = 35/193 (18%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW 84
           G  +A G  +  +++ D+   + I  L  + H   V  ++W  H  IL++GS D T+   
Sbjct: 388 GSHLAIGQGNGIVEIYDVTKEKCIRTL--SGHLDRVACLSWNNH--ILSSGSRDRTI--- 440

Query: 85  GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE 144
                  + +  +       IE HE EI  + W+ +   LA+   D  V++++    G  
Sbjct: 441 ------LHRDVRMADPFFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYD----GTS 490

Query: 145 FECISVLQEHSQDVKHVIW---HQSLPLLASSSYDDTVRIW--------KDCDDDWECCA 193
                 + EH   VK + W    Q +      + D T+++W         D D   + C 
Sbjct: 491 RTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVNTSVKLNDVDTGSQVCN 550

Query: 194 VLNGHEGTVWSSD 206
           +       VWS++
Sbjct: 551 M-------VWSTN 556

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 22/187 (11%)

Query: 54  TAHKKTVRSVAWRPHSN-ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112
           T H++ V  V + P +  +LA+ S D TV +W           ++E     I+  H + +
Sbjct: 137 TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLW-----------NVEQGTNPIVLTHPDMV 185

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS-QDVKHVIWHQSLPLLA 171
             +++S+ G  LAT  RDK + +W+      + E +S    HS    + V+W  +   LA
Sbjct: 186 TSMSFSYGGTYLATVCRDKMLRVWDI----RKGEVVSEGMGHSGPKNQRVVWLGNSDRLA 241

Query: 172 SSSY----DDTVRIWKDCD-DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
           ++ +    D  + +W   + +  +     N  + +     F   ++ +   +G  DG +R
Sbjct: 242 TTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGKGDGNIR 301

Query: 227 IWCLEDD 233
            +  +DD
Sbjct: 302 YYEFQDD 308

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 14/91 (15%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL---------EDDNGEYEQEWIQ 243
            +  GH   V  +DF+  +  + L SGSDDG + +W +         +D++G  E   + 
Sbjct: 75  PLFRGHTAQVLDTDFDPFDERM-LVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEH--VA 131

Query: 244 ESILPKAHTRAVYSVNWSP--KGYIASTGSD 272
                  H R V  V + P  +G +AS+  D
Sbjct: 132 PVKFLTGHQRKVGHVLYHPTAQGVLASSSLD 162

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 19/161 (11%)

Query: 13  HDDKCWSVDVNNGGI-MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H D   S+  + GG  +AT   D+ +++ DIR  +++ E    +  K  R V W  +S+ 
Sbjct: 181 HPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQR-VVWLGNSDR 239

Query: 72  LAAGSF----DSTVSIWGKDDDGYNDEN---------DLETELLAIIEGHENEIKCVAWS 118
           LA   F    D  +++W    D +N E          D  + +L       N+I  VA  
Sbjct: 240 LATTGFSKLSDRQIAVW----DAFNLEKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGK 295

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK 159
            DG +     +D  ++     +  E     +V  + S +VK
Sbjct: 296 GDGNIRYYEFQDDELYELSEFQSTEPQRGFAVAPKRSVNVK 336

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 65/145 (44%), Gaps = 15/145 (10%)

Query: 7   LKSLALHDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAW 65
           L +   H     SV    NG IM + S D  +K  D+  F+       T  +     +A 
Sbjct: 391 LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTAT-ERIQFSCLAA 449

Query: 66  RPHSNILAAGSFDST-VSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGEL 123
            P   ++ AGS D+  + +W            ++T +LL  + GHE  + C+++S +  +
Sbjct: 450 DPTGEVVCAGSLDNYDIQVWS-----------VQTGQLLDTLSGHEGPVSCLSFSRENSI 498

Query: 124 LATCSRDKSVWIWEADEMGEEFECI 148
           LA+ S DK++ +W      ++ E I
Sbjct: 499 LASASWDKTIRVWSIFGRSQQVEPI 523

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 80/201 (39%), Gaps = 53/201 (26%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           +GH + +  +A+S DG  + T + D  + IW+   +   F C++  +EH+  V  V + +
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIWD---IVSGF-CLATFEEHTSSVTSVQFAK 408

Query: 166 SLPLLASSSYDDTVRIW-----------------------KDCDDDWECCA--------- 193
           +  ++ SSS D TV+ W                        D   +  C           
Sbjct: 409 NGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQV 468

Query: 194 ----------VLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ---- 239
                      L+GHEG V    F + NS   L S S D T+R+W +   + + E     
Sbjct: 469 WSVQTGQLLDTLSGHEGPVSCLSFSRENS--ILASASWDKTIRVWSIFGRSQQVEPIEAY 526

Query: 240 -EWIQESILPKAHTRAVYSVN 259
            + +  S+ P     AV ++N
Sbjct: 527 SDVLDISMRPDGKQVAVSTLN 547

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H   + S+ W   S  + + + D T  I+  +     +E DL +   A   GH + +   
Sbjct: 161 HFADITSLTWSRDSRFIISTAKDMTARIYSVN----AEEKDLASMTFA---GHRDYVMGA 213

Query: 116 AWSHDGELLATCSRDKSVWIWE 137
            +S D E + T S+D +++ WE
Sbjct: 214 FFSADQEKIYTVSKDGALFQWE 235

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 61/335 (18%), Positives = 129/335 (38%), Gaps = 40/335 (11%)

Query: 13  HDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H      +DVN  G ++ +   D +  LV+I++  +I   +    K  V  V +     +
Sbjct: 70  HRRNIARIDVNAQGTLLLSVDVDGRAILVNIKTRNVIHHFN---FKDKVNDVKFSTDGKL 126

Query: 72  --LAAGSFDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEIKCVAWSHDGELLATCS 128
             LA G F   + IW     G + E      +   +  GH  +I  + WS D   + + +
Sbjct: 127 FALACGRF---LQIWRTP--GVSAERQFAPFVRYRVHAGHFADITSLTWSRDSRFIISTA 181

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188
           +D +  I+  +   ++   ++    H   V    +      + + S D  +  W+   + 
Sbjct: 182 KDMTARIYSVNAEEKDLASMT-FAGHRDYVMGAFFSADQEKIYTVSKDGALFQWEYTKNP 240

Query: 189 WECCAVLNGHEGT--------VWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ- 239
                     E             + F   N+ V+  +   D  + I      NGE+   
Sbjct: 241 ALAEEDDEDEELDLSKYSWRITKKNYFYAKNAKVKCAAFHADSNMLIVGFS--NGEFRMY 298

Query: 240 -----EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELT 294
                 +IQ+  + +     V +VN S +     + + G+L++Y+   + +I++      
Sbjct: 299 ELPDFTFIQQLSMGQNAVNTV-AVNRSGEWLAFGSSTLGQLLVYEWQSESYILK-----Q 352

Query: 295 HGVYET-NMVKWVEYGSKDVILLITAGDDGHVNVW 328
            G ++  N + +   G++    ++TA +DG + +W
Sbjct: 353 QGHFDALNALAYSPDGAR----IVTAAEDGKIKIW 383

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 121/292 (41%), Gaps = 63/292 (21%)

Query: 17  CWSVD--VNNGGIMATGSTDRKIKLVD--------IRSFQIIEELDDTAHKKTVRSVAWR 66
           C+S+   V N  ++A G T  KI +          I +F +  EL+   H+  V+S+ +R
Sbjct: 156 CFSLSNVVGNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELE--GHEDWVKSIQFR 213

Query: 67  ----PHSNILAAGSFDSTVSIWG-KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDG 121
               P   +L +GS D  + IW  + +D  +D  D ET+L  +                 
Sbjct: 214 HQETPGDYLLCSGSQDRYIRIWRIRTNDLIDDSEDDETKLTLL----------------- 256

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
                 S+     I E   +G  FE + +   H   V  + WH+S   L +S+ D  V I
Sbjct: 257 -----SSKQHKFHISEDLRIGINFEALII--GHDDWVSSLQWHESKLQLLASTADTAVMI 309

Query: 182 WKDCDDD--WECCAVL-----------NGHEGTVWSSD-FEKSNSNVRLCSGSDDGTVRI 227
           W+  +    W C + L            G  G  WS   FE++ ++  L +G   G+ RI
Sbjct: 310 WEPDESSGVWVCSSRLGEMSSKGASTATGSSGGFWSCLWFEENGADYILTNGK-TGSWRI 368

Query: 228 WCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIY 278
           W  +D+    ++  I  ++ P      V  V W+P G Y+ ST  D    ++
Sbjct: 369 WEAKDEIMCEQRVGITGAVRP------VTDVAWAPCGKYLLSTSLDQTTRLF 414

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 90/236 (38%), Gaps = 68/236 (28%)

Query: 58  KTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAW 117
           K  +  ++    N+LA G+    +++W   D            + A ++GHE E+ CV +
Sbjct: 15  KQTQVCSYNKARNVLAFGA-GKNIALWNPLDADCRG-------IYATLKGHEAEVTCVKF 66

Query: 118 SHDGELLATCSRDKSV--WIWEADEMGEEFECISVLQEHSQDV----------------- 158
               ++L + S D  V  W ++A E  EE ECI  +  +S  +                 
Sbjct: 67  MPGTDILVSASEDHHVKLWKYKAPE-SEELECIQTITHYSHTIVSIETLAGLIVIGSAGG 125

Query: 159 -------------KHVIWHQ-SLP------------------LLASSSYDDTVRIWK--- 183
                         ++I H+ SLP                  LLA       + I+    
Sbjct: 126 LVSIWVPETEGSDTYIISHEYSLPRNVFPLCFSLSNVVGNKYLLAIGGTTVKIFIYSFVL 185

Query: 184 ---DCDDDWECCAVLNGHEGTVWSSDF--EKSNSNVRLCSGSDDGTVRIWCLEDDN 234
                 +++   A L GHE  V S  F  +++  +  LCSGS D  +RIW +  ++
Sbjct: 186 SEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTND 241

>Kwal_47.17567
          Length = 590

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 108/241 (44%), Gaps = 28/241 (11%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQI-IEELDDTAHKKTVRSV 63
           K ++++  H D+   +  NN  I+ +GS DR+I   D+R+ Q   EE+    H + V  +
Sbjct: 359 KCIRTIPGHIDRVACLSWNNH-ILTSGSRDRRILHRDVRTPQSSFEEI--RTHNQEVCGL 415

Query: 64  AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGE 122
            W    N LA+G  D+ V ++    DG +    L+      +E H   +K +AWS H   
Sbjct: 416 KWNVEDNKLASGGNDNAVFVY----DGTSRLPFLK------LEEHTAAVKAMAWSPHRRG 465

Query: 123 LLAT--CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PLLASSSYDD-T 178
           +LAT   + DK + IW      +  +  +  Q     V ++IW ++   ++ S  Y    
Sbjct: 466 ILATGGGTADKRLKIWNVKTSVKLHDVDTASQ-----VCNMIWSKNTNEIITSHGYSKYN 520

Query: 179 VRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYE 238
           + +W    +  E  A+L GH   V         + V   SG+ D T+R W L + +    
Sbjct: 521 LTLWD--GNTLEPMAILKGHSFRVLHMTLSTDGTTV--VSGAGDETLRYWKLFEKSKSQA 576

Query: 239 Q 239
           Q
Sbjct: 577 Q 577

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 71/144 (49%), Gaps = 19/144 (13%)

Query: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATG--STDRKIKLVDIRSFQIIEELDDTAHKK 58
           +  LKL +  A      WS   +  GI+ATG  + D+++K+ ++++   + ++D  +   
Sbjct: 442 LPFLKLEEHTAAVKAMAWSP--HRRGILATGGGTADKRLKIWNVKTSVKLHDVDTASQ-- 497

Query: 59  TVRSVAWRPHSN--ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
            V ++ W  ++N  I + G     +++W        D N LE   +AI++GH   +  + 
Sbjct: 498 -VCNMIWSKNTNEIITSHGYSKYNLTLW--------DGNTLEP--MAILKGHSFRVLHMT 546

Query: 117 WSHDGELLATCSRDKSVWIWEADE 140
            S DG  + + + D+++  W+  E
Sbjct: 547 LSTDGTTVVSGAGDETLRYWKLFE 570

>Scas_719.52
          Length = 628

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 100/237 (42%), Gaps = 42/237 (17%)

Query: 21  DVNNGGIMATGSTDRKI---KLVDIRSFQIIEELDD-----------TAHKKTVRSVAWR 66
           D  N  I+A+ S D KI   K+ +  SFQ   + D            + H + V  V + 
Sbjct: 90  DPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFH 149

Query: 67  PHS-NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLA 125
           P + N+LA+ S D TV +W           ++ET    I   H + +  +++S+ G  LA
Sbjct: 150 PVAENVLASSSLDYTVKLW-----------NIETGEAVITLKHPDMVTSMSFSYGGNHLA 198

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHS-QDVKHVIWHQSLPLLASSSYDDTVRIWKD 184
           T  RDK + +W+      E + +S    H+    + V+W  +   LA++ +    R+   
Sbjct: 199 TVCRDKKLRVWDI----REGKIVSEGPAHAGAKNQRVVWLGNSDRLATTGFS---RLSDR 251

Query: 185 CDDDWECCAVLNGHEGTVWSSD--------FEKSNSNVRLCSGSDDGTVRIWCLEDD 233
               W+   +  G  G  ++ D        F    + +   +G  DG +R +  ++D
Sbjct: 252 QIGIWDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKILYLAGKGDGNIRYYEFQND 308

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 11/85 (12%)

Query: 185 CDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD-------NGEY 237
           C D      +  GH   V  +DF+  N ++ + S SDD  + IW + +D       + + 
Sbjct: 70  CPDQ---VPLFRGHTAQVLDTDFDPFNDHI-IASSSDDSKIGIWKIPEDYSFQHYLDPDG 125

Query: 238 EQEWIQESILPKAHTRAVYSVNWSP 262
           E + I+       H+R V  V + P
Sbjct: 126 EPKNIKPVKFLSGHSRKVGHVLFHP 150

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 6/135 (4%)

Query: 101 LLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFEC-ISVLQEHSQDV 158
           L   +EGH   +  +A S     LL + SRDK++  W+     ++F   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIV 68

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           +     ++     S S+D T+R+W       E      GH+G V S   +K  S   + S
Sbjct: 69  QDCTLTENGAYALSGSWDKTLRLWDVATG--ETFQTFVGHKGDVMSVAIDKKAS--MIIS 124

Query: 219 GSDDGTVRIWCLEDD 233
           GS D ++++W ++ D
Sbjct: 125 GSRDKSIKVWSIKGD 139

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 82/207 (39%), Gaps = 44/207 (21%)

Query: 40  VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET 99
           V ++SF+         H   V+      +     +GS+D T+ +W           D+ T
Sbjct: 56  VPVKSFK--------GHSHIVQDCTLTENGAYALSGSWDKTLRLW-----------DVAT 96

Query: 100 -ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
            E      GH+ ++  VA      ++ + SRDKS+ +W       + +C++ L  H+   
Sbjct: 97  GETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSI-----KGDCLATLIGHND-- 149

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDD-----WECCAVLNGHEGTVWSSDFEKSNSN 213
               W   + +  SS  DD V +    +D      W   A +  +  +     +  S S 
Sbjct: 150 ----WVSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSP 205

Query: 214 VR--LCSGSDDGTVRIW-----CLEDD 233
            R  LC+ +  G ++I+     CL DD
Sbjct: 206 NRYWLCAATASG-IKIFSLDPQCLLDD 231

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 66/158 (41%), Gaps = 20/158 (12%)

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLAI-IEGHENEIKCVAWSHDGELLATCSRD 130
            A GS D+T+ IW           DL    L I + GH   ++ +A S     + + S D
Sbjct: 138 FATGSNDTTIKIW-----------DLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASED 186

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
           K V  W+     E    I     H   V  V  H SL ++A++  D  VR+W D     E
Sbjct: 187 KLVKCWDL----ERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLW-DIRSRSE 241

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
              VL GH+  +        +  +  CSG  D TVR+W
Sbjct: 242 -IMVLPGHKSPINKVKCLPVDPQIISCSG--DATVRLW 276

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 69/168 (41%), Gaps = 18/168 (10%)

Query: 16  KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAG 75
           +C  VD  +    ATGS D  IK+ D+ + ++  ++    H  +VR +A       + + 
Sbjct: 126 RCVCVDPVDNEWFATGSNDTTIKIWDLAAGKL--KITLIGHVMSVRDIAISKRHPYMFSA 183

Query: 76  SFDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEIKCVAWSHDGELLATCSRDKSVW 134
           S D  V  W           DLE    +    GH + +  V      +++AT  RD  V 
Sbjct: 184 SEDKLVKCW-----------DLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVR 232

Query: 135 IWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +W+     E    I VL  H   +  V      P + S S D TVR+W
Sbjct: 233 LWDIRSRSE----IMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLW 276

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 92/212 (43%), Gaps = 49/212 (23%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           M + S D+ +K  D+     I +     H   V +V   P  +I+A    D+ V +W   
Sbjct: 180 MFSASEDKLVKCWDLERNTAIRDFH--GHLSGVHTVDVHPSLDIIATAGRDAVVRLW--- 234

Query: 88  DDGYNDENDLETEL-LAIIEGHE---NEIKCVAWSHDGELLATCSRDKSVWIWEADEMGE 143
                   D+ +   + ++ GH+   N++KC+    D ++++ CS D +V +W+      
Sbjct: 235 --------DIRSRSEIMVLPGHKSPINKVKCLPV--DPQIIS-CSGDATVRLWDIIAG-- 281

Query: 144 EFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVW 203
             +   VL  HS++++ +  H +    AS S +D VR WK               EG + 
Sbjct: 282 --KASKVLTHHSRNIRDLTLHPAEFSFASVSTND-VRSWK-------------LPEGQLL 325

Query: 204 SSDFEKSNSNVR----------LCSGSDDGTV 225
            ++F+  N+ +           L +G DDGT+
Sbjct: 326 -TNFQSQNTGILNTVSINHDNVLLAGGDDGTL 356

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATC 127
           H N+L AG  D T+  +     G+  ++ + TE+   +E  E  I C  +   G  L T 
Sbjct: 343 HDNVLLAGGDDGTLCFYDYKT-GHKYQSMMTTEVAGSLES-ERSILCSTFDVTGTRLITG 400

Query: 128 SRDKSVWIWE 137
             DKS+ IW+
Sbjct: 401 EGDKSIKIWK 410

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 68/165 (41%), Gaps = 19/165 (11%)

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
           HQ + L+    Y+ T          W+   V+NGH G V     +  + N    +GS+D 
Sbjct: 89  HQQISLM--ERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVD-NEWFATGSNDT 145

Query: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESED 283
           T++IW L    G+ +   I        H  +V  +  S +     + S+ +LV   + E 
Sbjct: 146 TIKIWDLA--AGKLKITLI-------GHVMSVRDIAISKRHPYMFSASEDKLVKCWDLER 196

Query: 284 GWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              +   H    GV+  ++     + S D+I   TAG D  V +W
Sbjct: 197 NTAIRDFHGHLSGVHTVDV-----HPSLDII--ATAGRDAVVRLW 234

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 116/302 (38%), Gaps = 79/302 (26%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYN--DENDLE-TELLAIIEGHEN 110
           + H   +R+V +   + +++AG+ D T+ +W   +D     DE ++E  + LAI+EGH+ 
Sbjct: 139 SGHSGPIRAVHYISSTRLVSAGN-DRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKA 197

Query: 111 EIKCVAWSHDGELLATCSRDKSVWIWEADEMG---------------------------- 142
            +  +  S D  L A+C    S+W     EM                             
Sbjct: 198 PVVSIDVSKDRILSASCDNTVSLWSTNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGS 257

Query: 143 -EEFECISVLQEHSQDVKHVIWHQSLPLLA-SSSYDDTVRIW----KDCDD----DWECC 192
                 +++ + HS  V+ VI+ +S   +  S S D T++ W      C D     +   
Sbjct: 258 IRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLL 317

Query: 193 AV-----------------------------------LNGHEGTVWSSDFEKSNSNVRLC 217
           +V                                   L GH+  V + D    N  + +C
Sbjct: 318 SVAQLPKLNLLACGSSARHITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYM-IC 376

Query: 218 SGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
           S S DGTV++W +  +   Y      ++++ K     V++V W+    I S G D ++ I
Sbjct: 377 SASHDGTVKVWDVRSNTAMYTITREDKNVV-KGVNDKVFAVKWAKGVGIISGGQDKKIQI 435

Query: 278 YK 279
            K
Sbjct: 436 NK 437

>Kwal_26.7570
          Length = 218

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 61/147 (41%), Gaps = 17/147 (11%)

Query: 55  AHKKTVRSVAWRP-HSNILAAGSFDSTVSIWG--KDDDGYNDENDLETELLAIIEGHENE 111
            H   V S+A  P   N+L +GS D ++  W    DD  Y          +    GH + 
Sbjct: 15  GHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVP-------VRSFRGHSHI 67

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           ++    + DGE   + S DK+V +WE        +CI     H  DV  V   +    + 
Sbjct: 68  VQDCTVTPDGEYALSASWDKTVRLWEL----ATGKCIQRFVGHKSDVLSVTIDRRASQIV 123

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGH 198
           S+S D TV++W       EC   L GH
Sbjct: 124 SASRDKTVKVWNTLG---ECMVTLLGH 147

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/258 (18%), Positives = 98/258 (37%), Gaps = 37/258 (14%)

Query: 7   LKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWR 66
           L+++   D +   +++ N   +   +  + I+L DI++           H+  V SV+++
Sbjct: 25  LRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQ 84

Query: 67  PHSNILAAGSFDSTVSIWGKDDDGY--NDENDLETELLAIIEGHENEIKC---------- 114
             +  +   S D T+ +W         N +++     + I       I C          
Sbjct: 85  QDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWD 144

Query: 115 --------------------VAWSHDGELLATCSRDKSVWIWEADEM--GEEFECISVLQ 152
                               ++ + DG +L   +   + ++WE          +  +  +
Sbjct: 145 LGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFK 204

Query: 153 EHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNS 212
            H   +  V+    +  +A+ S D T RIW   +D++   + L+GH+  VW   F  S  
Sbjct: 205 AHPSYITRVLLSSDVKHMATCSADHTARIWS-VEDNFNLESTLDGHQRWVWDCAF--SAD 261

Query: 213 NVRLCSGSDDGTVRIWCL 230
           +  L + S D  VR+W L
Sbjct: 262 SAYLVTASSDHYVRLWDL 279

 Score = 35.0 bits (79), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 90/228 (39%), Gaps = 19/228 (8%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           +A  EGH   +  V++  D + + T S D ++ +W+          +    +H+  V  V
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDI-----RSPSVPRNYKHNAPVNEV 122

Query: 162 IWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
           + H +   L S   D  +RIW   ++  +C   L   +     S    S+ ++ L + ++
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGEN--QCTHQLTPEDDVPLQSLSVASDGSM-LVAANN 179

Query: 222 DGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK-GYIASTGSDGRLVIYKE 280
            G   +W + +     +   ++ +   KAH   +  V  S    ++A+  +D    I   
Sbjct: 180 KGNCYVWEMPN---HTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARI--- 233

Query: 281 SEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               W VE    L   +       W    S D   L+TA  D +V +W
Sbjct: 234 ----WSVEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 76/204 (37%), Gaps = 65/204 (31%)

Query: 169 LLASSSYDDTVRIWK--------------------DCDDDWECCAV-------------- 194
           LL S+ YD T+R W+                    +  +D +  A               
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 195 -------LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESIL 247
                    GH G V S  F++ N    + + S+DGT+++W             I+   +
Sbjct: 64  NSNPVASFEGHRGNVTSVSFQQDNK--WMVTSSEDGTIKVWD------------IRSPSV 109

Query: 248 PK--AHTRAVYSVNWSP-KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVK 304
           P+   H   V  V   P +G + S   DG + I+   E+    +C H+LT    E ++  
Sbjct: 110 PRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN----QCTHQLT---PEDDVPL 162

Query: 305 WVEYGSKDVILLITAGDDGHVNVW 328
                + D  +L+ A + G+  VW
Sbjct: 163 QSLSVASDGSMLVAANNKGNCYVW 186

>Scas_695.15
          Length = 327

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/262 (19%), Positives = 100/262 (38%), Gaps = 43/262 (16%)

Query: 8   KSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP 67
           +++   D +   +++ N   +   +  + ++L DIR+           HK  V SV+++ 
Sbjct: 46  RTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQ 105

Query: 68  HSNILAAGSFDSTVSIWG----------KDDDGYND------------------------ 93
            +  +   S D T+ +W           K +   N+                        
Sbjct: 106 DNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGTIKIWDL 165

Query: 94  -ENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM--GEEFECISV 150
            EN    +L  I +     ++ ++ + DG +L   +     ++WE          + I+ 
Sbjct: 166 GENQCTHQL--IPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINK 223

Query: 151 LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK--DCDDDWECCAVLNGHEGTVWSSDFE 208
              H   +  V+    +  +A+ S D T +IW   + +DD+     L+GH+  VW   F 
Sbjct: 224 FSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAF- 282

Query: 209 KSNSNVRLCSGSDDGTVRIWCL 230
            S  +  L + S D  VR+W L
Sbjct: 283 -SADSAYLVTASSDHYVRLWDL 303

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 15/133 (11%)

Query: 7   LKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWR 66
           L+SL++  D    V  NN G              D  + + I +   +AHK  +  V   
Sbjct: 183 LQSLSVASDGSMLVAANNKGDCYVWEMPNH---TDASNLKPINKF--SAHKDYITRVVLS 237

Query: 67  PHSNILAAGSFDSTVSIW--GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
                +A  S D T  IW  G+ +D +N    LET L    +GH+  +   A+S D   L
Sbjct: 238 SDVKHMATCSADRTAKIWSVGETEDDFN----LETTL----DGHQRWVWDCAFSADSAYL 289

Query: 125 ATCSRDKSVWIWE 137
            T S D  V +W+
Sbjct: 290 VTASSDHYVRLWD 302

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 77/175 (44%), Gaps = 25/175 (14%)

Query: 60  VRSVAWRPHSNI-LAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAW 117
           VR V   P  N   A GS DST+ +W           DL T +L   ++GH   ++ +  
Sbjct: 116 VRCVCVDPVDNAWFATGSNDSTIRVW-----------DLATGKLKVTLQGHIMTVRDICI 164

Query: 118 SHDGELLATCSRDKSVWIW--EADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSY 175
           S     + + S+DK V  W  E + +  +F   ++   HS D+     H SL L+ S+  
Sbjct: 165 SARHPYMFSASQDKLVKCWDLERNTVVRDFHG-TLSGVHSVDL-----HPSLDLIVSAGR 218

Query: 176 DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           D  VR+W        C   L GH G +  +       + ++ S S D TV++W L
Sbjct: 219 DSVVRVWD--IRSRSCVLTLAGHRGPI--NKVRCLPVDPQIVSCSTDATVKLWDL 269

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 67/158 (42%), Gaps = 17/158 (10%)

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           A + Y++ V         W+   V+NGH G V     +  + N    +GS+D T+R+W L
Sbjct: 85  ALARYEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVD-NAWFATGSNDSTIRVWDL 143

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECI 290
               G+ +       +  + H   V  +  S +     + S  +LV   + E   +V   
Sbjct: 144 A--TGKLK-------VTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDF 194

Query: 291 HELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           H    GV+  ++     + S D  L+++AG D  V VW
Sbjct: 195 HGTLSGVHSVDL-----HPSLD--LIVSAGRDSVVRVW 225

>Kwal_27.11126
          Length = 996

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 113/245 (46%), Gaps = 28/245 (11%)

Query: 96  DLETEL-LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEH 154
           DLE+E  L     HE  I  V  S +G+  A+CS D+S+ +W+     +  + +S    H
Sbjct: 167 DLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDL----KSGQLLSTAWGH 222

Query: 155 SQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEG----TVWSSDFEKS 210
           +  + ++++  +   + S S D T R+W   +D+    A +  HEG    +VW  D +  
Sbjct: 223 TARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASV--HEGHLLKSVWGLDVD-- 278

Query: 211 NSNVRLCSGSDDGTVRIWCLE------DDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG 264
           N  +   +  +DG +++  L+      D+      E I+ + +       +   +W   G
Sbjct: 279 NERMIAATSGNDGRIKLTDLKAKSRVGDETMSSSLEDIEAAGVAMKPKEIIKGFHWFKFG 338

Query: 265 YIASTGSDGRLVIYKESEDGW------IVECIHELTHGVYETNMVKWVEYGSKDVILLIT 318
            IA T S+G+++ +++S   W           + +T G+ E N++ +    S+  +L+I 
Sbjct: 339 LIAMT-SEGQVLKFEQSSKKWSSILNDSTFSNYSITAGLQELNLIVFCS--SQCDLLVIK 395

Query: 319 AGDDG 323
             DDG
Sbjct: 396 FNDDG 400

>Kwal_33.15475
          Length = 783

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 112/292 (38%), Gaps = 76/292 (26%)

Query: 71  ILAAGSFDSTVSIWGKD-DDGYNDENDLETELLAIIEGHENEIKCVAW---SHDGELLAT 126
           +LA G  +  V I+     DG  +   L  EL    EGHE+ +K + +   S    LLAT
Sbjct: 163 LLAIGGTNPRVFIYSFTLQDGTLNNFQLAAEL----EGHEDWVKAMDFYEESPGNMLLAT 218

Query: 127 CSRDKSVWIWE---------ADEMGEEFECISVLQEHSQ-----DVKHVI---------- 162
            S+D+ + +W          +DE  +EF+   +  + S+     D+K  I          
Sbjct: 219 GSQDRYIRLWRIRTNELIDNSDE--DEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHD 276

Query: 163 -------WHQSLPLLASSSYDDTVRIWKDCDDD--WECCAVL-----------NGHEGTV 202
                  WH+  P L +S+ D  V +W+   D   W C + L            G  G  
Sbjct: 277 DWISCLKWHKERPQLLASTADTAVMVWEPDADSGVWICASRLGELSSKGASTATGSSGGF 336

Query: 203 WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
           WS  +    +   + +    G+ R+W  ++  G     W Q+  +    T+AV  V WSP
Sbjct: 337 WSCSWFTHKNRDHILTNGKTGSWRMWVSDELEG-----WKQQLAI-TGPTKAVTDVAWSP 390

Query: 263 KG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDV 313
            G Y+ +T  D               +    ++   Y+ N   W E+    +
Sbjct: 391 NGLYMLATSLD---------------QTTRLISRCNYDANAGSWFEFARPQI 427

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 87/214 (40%), Gaps = 39/214 (18%)

Query: 80  TVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEAD 139
           T+++W   D  ++        +   ++GH  E+ CV +     L+ + S D  V +W  +
Sbjct: 34  TIALWKPLDPAHHG-------VYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFE 86

Query: 140 EMGEE-FECISVLQEHSQDVKHVIWHQSL--PLLASSSYDDTVRIWKDCDDD-------- 188
           E  ++  +C+ V+  H    KH I   S+   +L+    D +V +W   ++         
Sbjct: 87  EKDQDALKCVQVIDHH----KHTITSLSVISNILSVGCADGSVSLWLTENNQAILLHSFN 142

Query: 189 -----WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGS-DDGTVRIWCLEDDNGEYEQEWI 242
                +  C  L   EG  +      +N  V + S +  DGT+  + L  +  E  ++W+
Sbjct: 143 LQTNVYPLCMALKLVEGDKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAE-LEGHEDWV 201

Query: 243 QESILPKAHTRAVYSVNWSPKGYIASTGSDGRLV 276
                     +A+     SP   + +TGS  R +
Sbjct: 202 ----------KAMDFYEESPGNMLLATGSQDRYI 225

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 43/232 (18%), Positives = 85/232 (36%), Gaps = 12/232 (5%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVW--IWEADEMGEEFECISVLQEHSQDVKHVI 162
           + GH  EI C+  + D  ++A+  R  ++   + +  +     +     Q H+  +  + 
Sbjct: 546 LYGHGYEISCLDVNADSSIIASACRSNNLQHAVIKFFDAKTWLQLKPTKQFHNLTITRLR 605

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN---GHEGTVWSSDFEKSNSNVRLCSG 219
           +      L S S D    +WK      E          H   +W  D+  +       + 
Sbjct: 606 FSSDSESLLSVSRDRQWAVWKKNSATNEFELTFKNEKAHTRIIWDCDWAPTEFGHVFVTA 665

Query: 220 SDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYK 279
           S D  ++ W L +D  +YEQ+   +  +P     +V+    + K  +A+   +G + ++ 
Sbjct: 666 SRDKHIKAWKLSEDGQQYEQQHALKLAVPVTAI-SVFPGLHNGKLLVAAGLENGNIQVFT 724

Query: 280 ESEDGWIVECIHELTHGVYETNMV---KWVEYGSKDVILLITAGDDGHVNVW 328
                    C  E+       + V   +W     K  ILL     D  + V+
Sbjct: 725 YDNQ---FRCYSEIDTRFTPADRVSRLRWSSNQEKGRILLAVTSADHSIRVF 773

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 68/161 (42%), Gaps = 16/161 (9%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
            +A    D  +K+  + S +    L    HK  V S+     S ++   S D  + IWG 
Sbjct: 539 FLAVSLLDNTVKVFFLDSMKFFLSL--YGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
           D        D    L A    H++ I  V +  +     +CS+D +V  W+    G  F+
Sbjct: 597 D------FGDCHKSLFA----HQDSIMNVKFLPESHNFFSCSKDGTVKYWD----GNSFD 642

Query: 147 CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD 187
           CI  L  H  +V  +        + S S+D ++R+W++ +D
Sbjct: 643 CIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWEETED 683

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 13/138 (9%)

Query: 4   LKLLKSLALHDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           +K   SL  H     S+D++ +  ++ T S D+ IK+  +      + L   AH+ ++ +
Sbjct: 557 MKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSL--FAHQDSIMN 614

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE 122
           V + P S+   + S D TV  W        D N  +   +  + GH+ E+  +A S DG+
Sbjct: 615 VKFLPESHNFFSCSKDGTVKYW--------DGNSFDC--IQKLYGHQGEVWALAVSSDGQ 664

Query: 123 LLATCSRDKSVWIWEADE 140
            + + S D+S+ +WE  E
Sbjct: 665 AVVSVSHDRSIRVWEETE 682

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 86/193 (44%), Gaps = 30/193 (15%)

Query: 23  NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRP----------HSNIL 72
           N+ G + TG+ + ++K  +I++ ++++ + D      + + A +P           + IL
Sbjct: 32  NSPGQVITGALE-EVKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFIL 90

Query: 73  AAGSFDSTVSIWGKDDDGYNDENDLETE-LLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
           A G  D T+ IW           D++T+ +L +   H + I  + +   G  L + SRD 
Sbjct: 91  AVGYADGTIKIW-----------DMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDA 139

Query: 132 SVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWEC 191
           ++ +W  D + E   C   L+ H +D    IW ++   L S S D  +++W       +C
Sbjct: 140 TIILW--DLVAETGLC--KLRSH-KDAITGIWCENDDWLISVSKDGLIKLWD--MKVHQC 192

Query: 192 CAVLNGHEGTVWS 204
                 H G  WS
Sbjct: 193 VETHMAHTGECWS 205

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 101/243 (41%), Gaps = 34/243 (13%)

Query: 99  TELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE--------ADEMGEEFECISV 150
           T L  I E H   I  +  + DG+ L T S DK+V  W+        A  + +    + +
Sbjct: 457 TMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516

Query: 151 LQEHSQDVKHVIWHQSLP----LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD 206
           + + + D+   +W   +      LA S  D+TV+++    D  +    L GH+  V S D
Sbjct: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF--FLDSMKFFLSLYGHKLPVLSMD 574

Query: 207 FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY- 265
              S+ +  + + S D  ++IW L  D G+  +          AH  ++ +V + P+ + 
Sbjct: 575 I--SHDSKLIITSSADKNIKIWGL--DFGDCHKSLF-------AHQDSIMNVKFLPESHN 623

Query: 266 IASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHV 325
             S   DG +  +    DG   +CI +L    Y      W    S D   +++   D  +
Sbjct: 624 FFSCSKDGTVKYW----DGNSFDCIQKL----YGHQGEVWALAVSSDGQAVVSVSHDRSI 675

Query: 326 NVW 328
            VW
Sbjct: 676 RVW 678

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 58/136 (42%), Gaps = 25/136 (18%)

Query: 104 IIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
           +I G   E+KC  W    GELL T  RD           G     I    E   +  ++ 
Sbjct: 37  VITGALEEVKC--WEIKTGELLKTM-RD-----------GLPPGAIDTKAEKPAEATYLQ 82

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVL---NGHEGTVWSSDFEKSNSNVRLCSG 219
           +H+   +LA    D T++IW     D +   VL   + H   +    F+++ +  RL SG
Sbjct: 83  YHEETFILAVGYADGTIKIW-----DMQTQTVLIVFHSHSSAITILRFDQTGT--RLISG 135

Query: 220 SDDGTVRIWCLEDDNG 235
           S D T+ +W L  + G
Sbjct: 136 SRDATIILWDLVAETG 151

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 6/133 (4%)

Query: 101 LLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFEC-ISVLQEHSQDV 158
           L   +EGH   +  +A S     LL + SRDK++  W+     ++F   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           +            S+S+D T+R+W       E      GH+  V S D +K  S   + S
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLWDVATG--ETYQRFVGHKSDVMSVDIDKKAS--MIIS 124

Query: 219 GSDDGTVRIWCLE 231
           GS D T+++W ++
Sbjct: 125 GSRDKTIKVWTIK 137

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 94/231 (40%), Gaps = 41/231 (17%)

Query: 40  VDIRSFQ----IIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEN 95
           V +RSF+    I+++   TA      S +W            D T+ +W           
Sbjct: 56  VPVRSFKGHSHIVQDCTLTADGAYALSASW------------DKTLRLW----------- 92

Query: 96  DLET-ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEH 154
           D+ T E      GH++++  V       ++ + SRDK++ +W       + +C++ L  H
Sbjct: 93  DVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI-----KGQCLATLLGH 147

Query: 155 SQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNV 214
           +  V  V   + +P     + DD+V I    +D       LN  +     +DF   NSN+
Sbjct: 148 NDWVSQV---RVVP--NEKADDDSVTIISAGNDKMVKAWNLNQFQ---IEADFIGHNSNI 199

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY 265
              + S DGT+     +D          ++++   +    V+S+ +SP  Y
Sbjct: 200 NTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRY 250

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 6/114 (5%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G ++A+   D +I L ++ + + +  L   + +  V S+A+ P+   LAA +  + + +
Sbjct: 207 DGTLIASAGKDGEIMLWNLAAKKAMYTL---SAQDEVFSLAFSPNRYWLAAAT-ATGIKV 262

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
           +  D     D  DL  E     +  E     +AWS DG+ L     D  + +W+
Sbjct: 263 FSLDPQYLVD--DLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 22/132 (16%)

Query: 13  HDDKCWSVDVNN-GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHS-- 69
           H     SVD++    ++ +GS D+ IK+  I+  Q +  L    H   V  V   P+   
Sbjct: 106 HKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATL--LGHNDWVSQVRVVPNEKA 162

Query: 70  -----NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
                 I++AG+ D  V  W        + N  + E  A   GH + I  +  S DG L+
Sbjct: 163 DDDSVTIISAGN-DKMVKAW--------NLNQFQIE--ADFIGHNSNINTLTASPDGTLI 211

Query: 125 ATCSRDKSVWIW 136
           A+  +D  + +W
Sbjct: 212 ASAGKDGEIMLW 223

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 66/167 (39%), Gaps = 24/167 (14%)

Query: 169 LLASSSYDDTVRIWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
           LL S+S D T+  WK   DD +         GH   V   D   +       S S D T+
Sbjct: 32  LLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV--QDCTLTADGAYALSASWDKTL 89

Query: 226 RIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGW 285
           R+W +    GE  Q ++        H   V SV+   K  +  +GS  + +        W
Sbjct: 90  RLWDVA--TGETYQRFV-------GHKSDVMSVDIDKKASMIISGSRDKTIKV------W 134

Query: 286 IV--ECIHELTHGVYETNMVKWV--EYGSKDVILLITAGDDGHVNVW 328
            +  +C+  L       + V+ V  E    D + +I+AG+D  V  W
Sbjct: 135 TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAW 181

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 114/283 (40%), Gaps = 57/283 (20%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H   V+SV     + I A+GS D TV +W +D       +D      AI+   E  +  V
Sbjct: 17  HSMDVKSVVAISDTQI-ASGSRDGTVRVWTRD------TSDSRLWSGAILHSTERYVNAV 69

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL------ 169
            +  + +L+    ++  +              +S L    QD  +++   S  +      
Sbjct: 70  CYEENEQLVFFGGQEAVIG------------AVSPLVLEVQDASYLLAGHSGNVCALEAR 117

Query: 170 ---LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
              L SSS+D T R+W++  ++      L+GH  TVW +     +   R  + S D T++
Sbjct: 118 DGQLVSSSWDQTARVWREGTEE----RALSGHNATVWHALALGYD---RFLTASADKTIK 170

Query: 227 IWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDGW 285
           +W    D   Y             HT  V  +  +P G + AS  +DG + ++  + DG 
Sbjct: 171 LWDGARDLATY-----------NVHTDVVRHLALAPDGHHFASCSNDGSVKVH--TLDGK 217

Query: 286 IVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            V         VY    VK++  G      L++ G+D  V VW
Sbjct: 218 TVRTFDGHESFVY---CVKYLPDGG-----LVSCGEDKTVRVW 252

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 102/256 (39%), Gaps = 38/256 (14%)

Query: 49  EELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGH 108
           EE   + H  TV       +   L A S D T+ +W    DG  D        LA    H
Sbjct: 138 EERALSGHNATVWHALALGYDRFLTA-SADKTIKLW----DGARD--------LATYNVH 184

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
            + ++ +A + DG   A+CS D SV +   D      + +     H   V  V +   LP
Sbjct: 185 TDVVRHLALAPDGHHFASCSNDGSVKVHTLDG-----KTVRTFDGHESFVYCVKY---LP 236

Query: 169 --LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
              L S   D TVR+W   D       V+     ++WS D      N  +  G  DG + 
Sbjct: 237 DGGLVSCGEDKTVRVW---DMSGHVRQVIRLCATSLWSLDVLP---NGDIVVGGSDGKIL 290

Query: 227 IWCLEDDNGEY--EQEWIQESILPKAHTRAVYSVN---WSPKGYIASTG-SDGRLVIYKE 280
           I+ ++        E E ++E++   A    V   +    SP   I + G S+G++V+ K 
Sbjct: 291 IFTVDPARVAPVEELEQLREAVASTAIIAKVIDFDESKLSPYETIQAPGKSEGQVVVVKA 350

Query: 281 SEDGWIVECIHELTHG 296
                ++E  H+ + G
Sbjct: 351 PSG--VIEA-HQFSGG 363

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 88/343 (25%), Positives = 139/343 (40%), Gaps = 72/343 (20%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAW-RPHSNILAAGSFDSTVSI 83
           G + ++   DR +K+ D+     + EL    H  TV  +   + + N+L  GS D+T+ +
Sbjct: 348 GTLCSSSYQDRIVKVWDLNHGIQVGEL--PGHLATVNCMQIDKKNYNMLITGSKDATLKL 405

Query: 84  WGKD--DDGYNDENDLETELLAII-------EGHENEIKCVAWSHDGELLATCSRDKSVW 134
           W  +   + Y D + L+ +   I+       E H++EI   A S D E L + SRDK ++
Sbjct: 406 WDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEI--TALSFDSEALVSGSRDKKIF 463

Query: 135 IWEADEMGEEFECISVL-----QEHSQDVKHV---------IWHQSLPL----------L 170
            W+        +CI  L       HS D+K           +     P+          L
Sbjct: 464 HWDLTTG----KCIQQLDLIFTPTHS-DIKMPARSLNNGACLLGTEAPMIGALQCYNSAL 518

Query: 171 ASSSYDDTVRIWKDCDDDWEC---CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
           A+ + D  VR+W     D        +L GH   + S  F+      +L +GS D +VRI
Sbjct: 519 ATGTKDGIVRLW-----DLRVGKPVRLLEGHTDGITSLKFDSE----KLVTGSMDNSVRI 569

Query: 228 WCLEDDNGEYEQEWIQESILPK-AHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWI 286
           W L              SIL   A+   V S+++  K         G  V   E ++ W+
Sbjct: 570 WDLR-----------TSSILDVIAYDLPVSSLDFDGKLITVGANEGGVNVFNMERDEHWM 618

Query: 287 V-ECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
             E  H L  G   +  +  V+Y       LI   +DG +NVW
Sbjct: 619 TPEPPHSL-DGDELSRRIAIVKYKDG---FLINGHNDGDINVW 657

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 70/153 (45%), Gaps = 36/153 (23%)

Query: 7   LKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELD---DTAH---KKTV 60
           + +  LH D+  ++  ++  +++ GS D+KI   D+ + + I++LD      H   K   
Sbjct: 433 IHNFELHKDEITALSFDSEALVS-GSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPA 491

Query: 61  RSV---------------AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAI 104
           RS+               A + +++ LA G+ D  V +W           DL   + + +
Sbjct: 492 RSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLW-----------DLRVGKPVRL 540

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
           +EGH + I  + +  D E L T S D SV IW+
Sbjct: 541 LEGHTDGITSLKF--DSEKLVTGSMDNSVRIWD 571

>Scas_571.4
          Length = 601

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 95/221 (42%), Gaps = 39/221 (17%)

Query: 34  DRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYN 92
           D + K +DIR  +I+     + H + V  V + P   N+LA+ S D TV IW        
Sbjct: 130 DSENKPMDIRPSKIL-----SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIW-------- 176

Query: 93  DENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQ 152
             N  + +++  ++ H + +  +A+  DG  LAT +R+K + IW+        + +S  +
Sbjct: 177 --NIKKGKVIGTLQ-HSDMVTAMAFDPDGAYLATITRNKKLTIWDIASK----QIVSQTK 229

Query: 153 EHS-QDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTV-------WS 204
            H     + V+W     ++A++ +       K  D +      L+  EGT+        S
Sbjct: 230 SHQGPKNQRVVWLGYSRIIATTGFS------KSMDREIGIWDALDLKEGTINKFYKIDQS 283

Query: 205 S----DFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
           S     F    + +    G  DG +R + L+D   +   E+
Sbjct: 284 SGILMPFYDLTNRILYVVGKGDGNIRCFELKDRKLQQLSEF 324

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD-------NGEYEQEWIQE 244
            ++  GH+G V  +DF+  N + ++ S SDDG + IW +  +       + E +   I+ 
Sbjct: 82  VSLFRGHKGQVLDTDFDPFN-DFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRP 140

Query: 245 SILPKAHTRAVYSVNWSPK 263
           S +   HTR V  V + P+
Sbjct: 141 SKILSGHTRKVGHVLFHPR 159

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSF----DS 79
           +G  +AT + ++K+ + DI S QI+ +       K  R V W  +S I+A   F    D 
Sbjct: 201 DGAYLATITRNKKLTIWDIASKQIVSQTKSHQGPKNQR-VVWLGYSRIIATTGFSKSMDR 259

Query: 80  TVSIW 84
            + IW
Sbjct: 260 EIGIW 264

>Kwal_14.1710
          Length = 574

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 94/237 (39%), Gaps = 44/237 (18%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDT--AHKKTVRSVAWRPHSNILAAGSFDSTVSIW 84
           ++ATGS   +I + D+R   I   +  T   HK  V  +A+RP    LA+GS D+TV+IW
Sbjct: 333 LIATGSKSGEIHINDVR---IKNHIVSTWEEHKGEVCGIAYRPDGLQLASGSNDNTVAIW 389

Query: 85  GKDDDGYNDENDLETELLA-IIEGHENEIKCVAWSHD-GELLAT--CSRDKSVWIWEADE 140
                      D  T L   I   H   +K +AWS D   LLAT     DK +  W    
Sbjct: 390 -----------DTRTSLPQHIKRQHTAAVKALAWSPDISNLLATGGGQTDKHIHFWNT-T 437

Query: 141 MGEEFECISVLQEHSQDVKHVIWHQSL-------PLLASSSYDDTVRIWKDCDDDWECCA 193
            G     I+        V  + W QS         ++A+    +      + D  ++   
Sbjct: 438 TGARTGSINT----GSQVSSLHWGQSYNSNAIQREIVATGGIPENAVSIYNYDTKFKVAE 493

Query: 194 VLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA 250
           +++ HE  + SS              S DGTV      D+N ++ + +      P+ 
Sbjct: 494 IVHAHEARICSSQL------------SPDGTVLATVGGDENLKFYKVFEPRRKRPQG 538

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 104/242 (42%), Gaps = 32/242 (13%)

Query: 50  ELDDTAHKKTVRS-VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGH 108
           ++D  +H +T+RS +  R    I +    ++ ++   K  + + ++  ++  +++  E H
Sbjct: 306 DVDSMSHVRTMRSGLGVR----IGSQSWLETLIATGSKSGEIHINDVRIKNHIVSTWEEH 361

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
           + E+  +A+  DG  LA+ S D +V IW+      +     + ++H+  VK + W   + 
Sbjct: 362 KGEVCGIAYRPDGLQLASGSNDNTVAIWDTRTSLPQH----IKRQHTAAVKALAWSPDIS 417

Query: 169 -LLAS--SSYDDTVRIWKDCDDDWECCAVLNGHEGTV--WSSDFEKSNSN-----VRLCS 218
            LLA+     D  +  W +        ++  G + +   W   +   NSN     +    
Sbjct: 418 NLLATGGGQTDKHIHFW-NTTTGARTGSINTGSQVSSLHWGQSY---NSNAIQREIVATG 473

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI-ASTGSDGRLVI 277
           G  +  V I+        Y+ ++    I+  AH   + S   SP G + A+ G D  L  
Sbjct: 474 GIPENAVSIY-------NYDTKFKVAEIV-HAHEARICSSQLSPDGTVLATVGGDENLKF 525

Query: 278 YK 279
           YK
Sbjct: 526 YK 527

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 94/224 (41%), Gaps = 54/224 (24%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K +++L+ H D+   +  NN  I+ +GS DRKI   D+R  +   E  +T H + V  + 
Sbjct: 324 KCIRTLSGHMDRVACLSWNNH-ILTSGSRDRKILHRDVRMPEPYFEQVET-HTQEVCGLK 381

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGEL 123
           W    N LA+G  D+ V ++    DG + +  L+      +  H   +K +AWS H   +
Sbjct: 382 WNTDENRLASGGNDNVVYVY----DGTSRKPTLK------LAEHTAAVKAIAWSPHKRGI 431

Query: 124 LATC--SRDKSVWIWEAD--------EMGEE----------------------------- 144
           LAT   + DK + IW  +        + G +                             
Sbjct: 432 LATGGGTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDY 491

Query: 145 --FECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCD 186
              E +++L+ HS  V H+        + S + D+T+R WK  D
Sbjct: 492 PSMEPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFD 535

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 90/255 (35%), Gaps = 63/255 (24%)

Query: 22  VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTV 81
           V  G  +A G  +  +++ DI   + I  L  + H   V  ++W  H  IL +GS D  +
Sbjct: 300 VGAGSHLAVGQGNGLVEIYDIVKRKCIRTL--SGHMDRVACLSWNNH--ILTSGSRDRKI 355

Query: 82  SIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
                     + +  +       +E H  E+  + W+ D   LA+   D  V++++    
Sbjct: 356 ---------LHRDVRMPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYD---- 402

Query: 142 GEEFECISVLQEHSQDVKHVIW---HQSLPLLASSSYDDTVRIW--------KDCDDDWE 190
           G   +    L EH+  VK + W    + +      + D  ++IW        +D D   +
Sbjct: 403 GTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQ 462

Query: 191 CC---------------------------------AVLNGHEGTVWSSDFEKSNSNVRLC 217
            C                                 A+L GH   V         + V   
Sbjct: 463 VCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSADGTTV--V 520

Query: 218 SGSDDGTVRIWCLED 232
           SG+ D T+R W L D
Sbjct: 521 SGAGDETLRYWKLFD 535

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 28/168 (16%)

Query: 109 ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP 168
           ENE   + W   G  LA    +  V I++  +     +CI  L  H   V  + W+  + 
Sbjct: 291 ENEYTSINWVGAGSHLAVGQGNGLVEIYDIVKR----KCIRTLSGHMDRVACLSWNNHI- 345

Query: 169 LLASSSYDDTVRIWKDCDDDWECCAVLNGHE----GTVWSSDFEKSNSNVRLCSGSDDGT 224
            L S S D  + + +D          +  H     G  W++D        RL SG +D  
Sbjct: 346 -LTSGSRDRKI-LHRDVRMPEPYFEQVETHTQEVCGLKWNTDEN------RLASGGNDNV 397

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP--KGYIASTG 270
           V ++     +G   +  ++ +     HT AV ++ WSP  +G +A+ G
Sbjct: 398 VYVY-----DGTSRKPTLKLA----EHTAAVKAIAWSPHKRGILATGG 436

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 96/211 (45%), Gaps = 21/211 (9%)

Query: 77  FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
            D+ V I  K  +   ++  ++  +++  E H +E+  + +  DG  LA+   D +V IW
Sbjct: 315 LDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIW 374

Query: 137 EADEMGEEFECISVLQEHSQDVKHVIWHQS-LPLLAS--SSYDDTVRIWKDCDDDWECCA 193
           +      + E + V + H+  VK + WH   + LLA+   S D  +  W +        +
Sbjct: 375 DT----RQDEPLWVKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFW-NTTTGARIGS 429

Query: 194 VLNGHEGTV--WSSDFEKSNSNVRLCS--GSDDGTVRIWCLEDDNGEYEQEWIQESILPK 249
           +  G + +   W   +E S+ N  + +  GS D ++ I+        Y+ + ++ + + +
Sbjct: 430 INTGSQVSSLHWGQSYEDSHMNREIVATGGSPDNSISIY-------NYDSK-VKVAEITQ 481

Query: 250 AHTRAVYSVNWSPKG-YIASTGSDGRLVIYK 279
           AH   + S   SP G  IA+ G D  L  Y+
Sbjct: 482 AHESRIVSSQLSPDGTTIATVGGDENLKFYR 512

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 78/198 (39%), Gaps = 38/198 (19%)

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           N+LA  + D ++ +W    +G   E  L TE           I  V WS+D   ++    
Sbjct: 235 NVLAI-ALDQSIYLW----NGETGEVSLLTEF------ETETITSVVWSNDDCHISIGKD 283

Query: 130 DKSVWIWEADEMGEEFECISVLQEH--SQDVKHVIWHQSLPLLASSSYD---DTVRIWKD 184
           D +  IW+ + M       S L     SQD     W  ++  + + S +   + VR+   
Sbjct: 284 DGNTEIWDVETMSHVRTMRSSLGVRICSQD-----WLDTVVCIGAKSGEIQVNDVRVKDH 338

Query: 185 CDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244
               WE       H   V    F +    ++L SG +D TV IW    D  + E  W++ 
Sbjct: 339 IVSTWE------KHTSEVCGIKFRQ--DGLQLASGGNDNTVMIW----DTRQDEPLWVK- 385

Query: 245 SILPKAHTRAVYSVNWSP 262
               + H  AV ++ W P
Sbjct: 386 ----RNHNAAVKAITWHP 399

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 118/300 (39%), Gaps = 71/300 (23%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFD-STVSIWG 85
           I+  G ++ + +L ++  F +I++L  +  +  V +VA       LA GS     + ++ 
Sbjct: 270 ILTVGFSNGEFRLYELPEFIMIQQL--SMGQNAVNTVAINSSGEWLAFGSSKLGQLIVYE 327

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEF 145
              + Y          +   +GH + +  + +S DG  + T S +  + IW+   +   F
Sbjct: 328 WQSESY----------ILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWD---VASGF 374

Query: 146 ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK---------------------- 183
            C++   EH+  V  V + +   +L S+S D TV+ W                       
Sbjct: 375 -CLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLA 433

Query: 184 -DCDDDWECCA-------------------VLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
            D   +  C                      L+GHEG +    F  SN N  L S S D 
Sbjct: 434 VDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSF--SNENGVLASASWDK 491

Query: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESE 282
           T+R+W L   + + E   +   +L         S++  P G  IA++   G+++ +  +E
Sbjct: 492 TIRVWSLFGRSQQVEPFEVFSDVL---------SISMKPDGQQIAASTLAGQILFFDVAE 542

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 20/134 (14%)

Query: 25  GGIMATGSTDRKIK---LVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDST- 80
           G ++ + S D  +K   L+  R+F+          +    S+A  P   ++ AGS DS  
Sbjct: 395 GQVLFSASLDGTVKAWDLIRYRNFRTFT----ATERIQFNSLAVDPSGEVVCAGSEDSFD 450

Query: 81  VSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEAD 139
           + +W            ++T +L+  + GHE  I C+++S++  +LA+ S DK++ +W   
Sbjct: 451 IFVWS-----------VQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLF 499

Query: 140 EMGEEFECISVLQE 153
              ++ E   V  +
Sbjct: 500 GRSQQVEPFEVFSD 513

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 21/168 (12%)

Query: 17  CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGS 76
           C+S D   G  + T S + KIK+ D+ S   +   D+  H   V +V +     +L + S
Sbjct: 348 CYSPD---GSKIVTASHEGKIKIWDVASGFCLATFDE--HAGGVSAVEFAKKGQVLFSAS 402

Query: 77  FDSTVSIWGKDDDGY-NDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK-SVW 134
            D TV  W  D   Y N      TE +        +   +A    GE++   S D   ++
Sbjct: 403 LDGTVKAW--DLIRYRNFRTFTATERI--------QFNSLAVDPSGEVVCAGSEDSFDIF 452

Query: 135 IWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +W      +  + +  L  H   +  + +     +LAS+S+D T+R+W
Sbjct: 453 VWSV----QTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVW 496

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 65/333 (19%), Positives = 131/333 (39%), Gaps = 35/333 (10%)

Query: 13  HDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H      VD+N  G ++ +   D +  L + ++  ++   +    K+ V  + + P   +
Sbjct: 54  HRKNVAVVDINKQGTLLLSIDVDGRGILANFKTRNVLHHFN---FKEKVYDLKFSPDGKL 110

Query: 72  --LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
             LA G F   + IW +  +   D          I  GH ++I  + WS D   + + S+
Sbjct: 111 FALACGRF---LQIW-RTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIISTSK 166

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD- 188
           D +  IW  +   +     +    H  +V    +      + + S D  +  W+      
Sbjct: 167 DLTARIWSVNSEEKNLAS-TTFAGHRDNVIGAYFSDDQEKIYTVSKDGALFQWEYTKKPG 225

Query: 189 -------WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
                   E    L+ +   +   +F  +N     CS     +  I  +   NGE+    
Sbjct: 226 EGEDNDEDEEDVDLSKYSWRITKKNFFHANRAKVKCSAFHAAS-NILTVGFSNGEFRLYE 284

Query: 242 IQESILPKAHT---RAVYSVNWSPKGYIASTGSD--GRLVIYKESEDGWIVECIHELTHG 296
           + E I+ +  +    AV +V  +  G   + GS   G+L++Y+   + +I++       G
Sbjct: 285 LPEFIMIQQLSMGQNAVNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYILK-----QQG 339

Query: 297 VYET-NMVKWVEYGSKDVILLITAGDDGHVNVW 328
            ++T N + +   GSK    ++TA  +G + +W
Sbjct: 340 HFDTLNGLCYSPDGSK----IVTASHEGKIKIW 368

>Kwal_56.23685
          Length = 1102

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 6/126 (4%)

Query: 104 IIEGHENEIKCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
           ++ GH   I  + +     E+LATCS D  V  W+       +   SV    +  VK   
Sbjct: 109 VLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK--- 165

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           W+     + +S++ + V IW D         VL GH  +V S DF K +    + S S+D
Sbjct: 166 WNYKNSNVMASAHSNDVYIW-DLRKGCTPLHVLQGHVNSVNSIDFSKFDE-TEIMSSSND 223

Query: 223 GTVRIW 228
           GTV+ W
Sbjct: 224 GTVKFW 229

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 104 IIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
           ++ GH   I  + ++    ++LATCS D  V  W+       F   S  +  +  VK   
Sbjct: 109 VLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVK--- 165

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           W+   P + +SS+ + + +W         C+ L GH  +V S DF +   +  + S S+D
Sbjct: 166 WNYKDPNVLASSHGNDIFVWDLRKGSTPLCS-LKGHVSSVNSIDFNRFKYS-EIMSSSND 223

Query: 223 GTVRIW 228
           GTV+ W
Sbjct: 224 GTVKFW 229

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 126/307 (41%), Gaps = 67/307 (21%)

Query: 16  KCWSVDVNNGGIMA-TGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAA 74
           + W    ++G +   TG  + +  + D ++  I+E      HK  V S+    +S IL+A
Sbjct: 168 RLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILE-----GHKAPVVSLDVASNSRILSA 222

Query: 75  GSFDSTVSIWGKD----------DDGYNDENDLETEL------------------LAIIE 106
            S+D+TV++W             ++  N  N + T                    L+++E
Sbjct: 223 -SYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLLE 281

Query: 107 GHENEIKCVAWSH-DGELLATCSRDKSVWIWEA------DEMGEEFECISVLQEHSQD-- 157
            H   ++ V + H D  +  + S+D ++  W+       D     +  +S+ Q  + +  
Sbjct: 282 SHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDTKTTSYPLLSIAQMPTLNLL 341

Query: 158 -----VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNS 212
                V+H+  H   P ++SS+     +I +           L GH+  V   D    N 
Sbjct: 342 ACGSSVRHITLHD--PRVSSSA-----KITQKQ---------LVGHKNFVVGLDTCSENE 385

Query: 213 NVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
            + LCS S DGTV++W +   +  Y     Q+  + K     V++V W+    I S G D
Sbjct: 386 YL-LCSASHDGTVKVWDVRSTSPMYTITR-QDPTVEKGVNDKVFAVKWAKSIGIISGGQD 443

Query: 273 GRLVIYK 279
            ++ I K
Sbjct: 444 KKIQINK 450

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 121/285 (42%), Gaps = 35/285 (12%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWG-KDDDG-----YNDENDLET----ELLA 103
           + H   V++V +  ++ I++AG+ D ++ +W  K+DDG       DEND E     + LA
Sbjct: 141 SGHTGAVKAVKYISNTRIVSAGN-DRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLA 199

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           I+EGH+  +  +  + +  +L+  S D +V +W    + +E   I  L+E  Q+  + I 
Sbjct: 200 ILEGHKAPVVSLDVASNSRILS-ASYDNTVALWST--IYKEMTAIDHLEE-IQNPNNKIS 255

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
             +      +  D T+R            ++L  H G V    F+  ++ V   S S D 
Sbjct: 256 TAAKKRRKLTLKDGTIR-------RRAPLSLLESHTGPVEQVIFDHGDNTVGY-SVSQDH 307

Query: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESED 283
           T++ W L               I  K  +  + S+   P   + + GS  R +   +   
Sbjct: 308 TIKTWDL----------VTARCIDTKTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPRV 357

Query: 284 GWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               +   +   G    N V  ++  S++  LL +A  DG V VW
Sbjct: 358 SSSAKITQKQLVG--HKNFVVGLDTCSENEYLLCSASHDGTVKVW 400

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 23/127 (18%)

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           + S SYD  VR W   +   +     +GH G V +  +    SN R+ S  +D ++R+W 
Sbjct: 118 IYSGSYDGVVRTW---NMSGKVEKQYSGHTGAVKAVKYI---SNTRIVSAGNDRSLRLWK 171

Query: 230 LEDDNG--------EYEQEWIQE----SILPKAHTRAVYSVNWSPKGYIASTGSDGRL-- 275
            ++D+G        E ++E I++    +IL + H   V S++ +    I S   D  +  
Sbjct: 172 TKNDDGSVSNNTGDENDEENIEDGKTLAIL-EGHKAPVVSLDVASNSRILSASYDNTVAL 230

Query: 276 --VIYKE 280
              IYKE
Sbjct: 231 WSTIYKE 237

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 203 WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP 262
           W S  + S+    + SGS DG VR W +   +G+ E+++         HT AV +V +  
Sbjct: 105 WVSALDVSDDFRHIYSGSYDGVVRTWNM---SGKVEKQY-------SGHTGAVKAVKYIS 154

Query: 263 KGYIASTGSDGRLVIYKESED 283
              I S G+D  L ++K   D
Sbjct: 155 NTRIVSAGNDRSLRLWKTKND 175

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/326 (19%), Positives = 118/326 (36%), Gaps = 86/326 (26%)

Query: 26  GIMATGSTDRKIKLVDIR--------SFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSF 77
           G+ A G  D +  +V           S  ++    +T  +  V  + W P    L  G  
Sbjct: 155 GVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVE 214

Query: 78  DSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
              + +W            +E +L  I+  H   I C+ W+ D   + TC  D    +W 
Sbjct: 215 SGELRLW-----------SVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWN 263

Query: 138 A-----------DEMGEE-------------------------------FECISVLQEHS 155
                        E G E                                + I  L+ HS
Sbjct: 264 VLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHS 323

Query: 156 QDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR 215
           + +  + +++   LL S+S D+T+R+W+    +     V  GH  ++ S+ +   ++   
Sbjct: 324 KTLTTIAYNEHNKLLLSASDDNTLRVWR--GGNLNPSHVFYGHSQSITSAHWVDDDT--- 378

Query: 216 LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAV--YSVNWSP-KGYIASTGSD 272
           + S S DG++R+W L  +           S +  A    V  ++   SP +G  A+   D
Sbjct: 379 IISTSMDGSIRVWSLASN-----------STVASATVDGVPNFTGALSPDQGKFATGTLD 427

Query: 273 GRLVIYKESEDGWIVECIHELTHGVY 298
           G +++Y       I + + +L H  Y
Sbjct: 428 GEVMVYD------IQKLLQQLNHNGY 447

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 52/261 (19%), Positives = 92/261 (35%), Gaps = 67/261 (25%)

Query: 65  WRP-HSNILAAGSFDSTVSI--WGKDDDGYNDENDLETELLA-IIEGHENEIKCVAWSHD 120
           W P H  + A G  DS  ++  +   D  +N     ET +LA    G +NE+ C+ W+  
Sbjct: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNIS---ETVVLADANTGQQNEVTCLEWAPA 205

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
           G+ L T      + +W       E +  ++L  H   +  + W+     + +   D+   
Sbjct: 206 GQSLLTGVESGELRLWSV-----EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260

Query: 181 IWK---------------------DCDDDW-----------------------ECCAVLN 196
           +W                        D  W                       +    L 
Sbjct: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320

Query: 197 GHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVY 256
           GH  T+ +  + + N    L S SDD T+R+W   + N  +         +   H++++ 
Sbjct: 321 GHSKTLTTIAYNEHNK--LLLSASDDNTLRVWRGGNLNPSH---------VFYGHSQSIT 369

Query: 257 SVNWSPKGYIASTGSDGRLVI 277
           S +W     I ST  DG + +
Sbjct: 370 SAHWVDDDTIISTSMDGSIRV 390

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 103 AIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
           A ++GHE E+ CV +  D + + + S D  V IW+  +     +CI  +Q +S   K ++
Sbjct: 53  ATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYS-HLQCIQTIQHYS---KTIV 108

Query: 163 WHQSLP-LLASSSYDDTVRIWK 183
              +LP L++    D T+ IW+
Sbjct: 109 ALSALPSLISVGCADGTISIWR 130

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 83/175 (47%), Gaps = 21/175 (12%)

Query: 22  VNNGGIMATGSTDRKIKL---VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFD 78
           V +   M + S D  +K+    D    Q I+ +    + KT+ +++  P  ++++ G  D
Sbjct: 68  VPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQH--YSKTIVALSALP--SLISVGCAD 123

Query: 79  STVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE---LLATCSRDKSVWI 135
            T+SIW ++    NDE  L  E   I +G    + C++ S   E   LLA    + +V+I
Sbjct: 124 GTISIWRQNIQ--NDEFGLAHE-FTIKKGFFYPL-CLSLSKVEEKKYLLAIGGTNVNVFI 179

Query: 136 WE---ADEMGEEFECISVLQEHSQDVKHVIW-HQSLP---LLASSSYDDTVRIWK 183
                +D   E+   ++ L+ H   VK + + HQ  P   LL S S D  +R+W+
Sbjct: 180 ASFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWR 234

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 21/129 (16%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++ +GS DR I+L  IR   +I++ ++ + K T           +L+   +   +     
Sbjct: 220 LLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLT-----------LLSNKQYKFQI----- 263

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
                +DE  +     A+I GH++ I  + W      L   + D S+ +WE DE    + 
Sbjct: 264 -----DDELRVGINFEALIMGHDDWISSLQWHESRLQLLAATADTSLMVWEPDETSGIWV 318

Query: 147 CISVLQEHS 155
           C   L E S
Sbjct: 319 CSLRLGEMS 327

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 66/160 (41%), Gaps = 10/160 (6%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEE--FECISVLQEHSQDVKHVI 162
           + GH  EI C+  S D +L+A+  R  +V          E   E    L  HS  +  + 
Sbjct: 554 LYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKPALPFHSLTITRLK 613

Query: 163 WHQSLPLLASSSYDDTVRIW-KDCDDDWECCAVLN--GHEGTVWSSDFEKSNSNVRLCSG 219
           + +    L S   D    +W ++ +D+       N   H   +W +D+          + 
Sbjct: 614 FSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLEFGNVFVTA 673

Query: 220 SDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVN 259
           S D TV++W       E   +++ E+ +   HT+AV +++
Sbjct: 674 SRDKTVKVW---RHQKEPADDYVLEASI--KHTKAVTAIS 708

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 68/144 (47%), Gaps = 29/144 (20%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGE----LLATCSRDKSVWIWEADEMGEEFECISVLQEHS 155
            ++A +EGHE+ +K +A+ H       LL + S+D+ + +W             ++ +  
Sbjct: 193 RVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLW-------RIRINDLIDDSE 245

Query: 156 QDVKHVIWHQSLPLLASSSY----DDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSN 211
           +D K       L LL++  Y    DD +R+  + +      A++ GH+   W S  +   
Sbjct: 246 EDSK------KLTLLSNKQYKFQIDDELRVGINFE------ALIMGHDD--WISSLQWHE 291

Query: 212 SNVRLCSGSDDGTVRIWCLEDDNG 235
           S ++L + + D ++ +W  ++ +G
Sbjct: 292 SRLQLLAATADTSLMVWEPDETSG 315

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 11/99 (11%)

Query: 91  YNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISV 150
           ++ EN LE +    +  H   I  + +S DG+ L +  RD+   +WE +     FE   +
Sbjct: 590 FSTENWLEIK--PALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFE---L 644

Query: 151 LQEHSQDVKHVIWHQS-LPL-----LASSSYDDTVRIWK 183
             ++ +    +IW     PL       ++S D TV++W+
Sbjct: 645 RFKNEKPHTRIIWDADWAPLEFGNVFVTASRDKTVKVWR 683

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 50/120 (41%), Gaps = 6/120 (5%)

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDT 178
           H  + +      K++ +W+  E   +    + L+ H  +V  V +      + S+S D  
Sbjct: 24  HKVKKIVAFGAGKTIALWDPIEPNNK-GVYATLKGHEAEVTCVRFVPDSDFMVSASEDHH 82

Query: 179 VRIWKDCD-DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEY 237
           V+IWK  D    +C   +  +  T+ +     S  +V    G  DGT+ IW     N E+
Sbjct: 83  VKIWKFTDYSHLQCIQTIQHYSKTIVALSALPSLISV----GCADGTISIWRQNIQNDEF 138

>Scas_652.7
          Length = 380

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 60/139 (43%), Gaps = 18/139 (12%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           A L  H+ T+ + D        R+ + S D    +W    D G Y+   +   I      
Sbjct: 57  ATLANHDKTITAVDISIHG---RIVTCSQDRNAYVWEPLSD-GSYKPTLVLLRI-----N 107

Query: 253 RAVYSVNWSPKGYIASTGSDGRL--VIYKESEDGWIVECIHELTHGVYET-NMVKWVEYG 309
           RA  SV+W+P GY  + GS  R+  V Y E E+ W V     +   +  T N + W E G
Sbjct: 108 RAATSVSWAPNGYKFAVGSSARIIAVCYYEQENNWWVS--KHIKKPIKSTINCLSWHENG 165

Query: 310 SKDVILLITAGDDGHVNVW 328
               +LL   G DG + V+
Sbjct: 166 ----VLLAAGGTDGFIRVF 180

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 84/203 (41%), Gaps = 42/203 (20%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV---- 60
           KL+ +LA HD    +VD++  G + T S DR           + E L D ++K T+    
Sbjct: 54  KLVATLANHDKTITAVDISIHGRIVTCSQDRNA--------YVWEPLSDGSYKPTLVLLR 105

Query: 61  -----RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEND--LETELLAIIEGHENEIK 113
                 SV+W P+    A GS    +++       Y  EN+  +   +   I   ++ I 
Sbjct: 106 INRAATSVSWAPNGYKFAVGSSARIIAVC-----YYEQENNWWVSKHIKKPI---KSTIN 157

Query: 114 CVAWSHDGELLATCSRDKSVWIWE-------------ADEMGEEFECISVLQEHSQD--V 158
           C++W  +G LLA    D  + ++                  G +F   S+++E  Q   +
Sbjct: 158 CLSWHENGVLLAAGGTDGFIRVFSGFIKGLDTKEAVAGSPWGSKFPFGSLIKELYQGSYI 217

Query: 159 KHVIWHQSLPLLASSSYDDTVRI 181
             V W   +  +A  ++D T+ I
Sbjct: 218 HDVEWRSKIEKVAYVAHDGTLNI 240

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 108/259 (41%), Gaps = 25/259 (9%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           M + S D+ +K  D+   ++I   D   H   V +V   P  N++A    DS V +W   
Sbjct: 187 MFSASEDKLVKCWDLEKNRVIR--DYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLW--- 241

Query: 88  DDGYNDENDLETELLAI-IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
                   D+ T+L  + + GH++ I  V        + +CS D +V +W+        +
Sbjct: 242 --------DIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDI----TAGK 289

Query: 147 CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD 206
            + VL  H + V+ +  H     ++S+  DD +R WK      E   + N         +
Sbjct: 290 TLKVLTHHKRSVRDIGIHPGEFSISSACTDD-IRSWKLP----EGQLLTNFQSEKTGIIN 344

Query: 207 FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYI 266
               N +  L +GSD+G +  +  +  + +Y+Q    E        R + +  +   G  
Sbjct: 345 TLSINQDDVLFAGSDNGVLSFYDYKTGH-KYQQLDTTEIPGSLESERGILTSTFDQTGLR 403

Query: 267 ASTG-SDGRLVIYKESEDG 284
             TG SD  + I+K+ +D 
Sbjct: 404 LITGESDKSIKIWKQDQDA 422

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 74/181 (40%), Gaps = 20/181 (11%)

Query: 5   KLLKSLALHDD--KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           KL++ +  H+   +  +VD  +    ATGS D  IK+ D+ + ++  +L  + H  TV+ 
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKL--KLTLSGHIMTVKD 177

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLE-TELLAIIEGHENEIKCVAWSHDG 121
           +        + + S D  V  W           DLE   ++    GH + +  V      
Sbjct: 178 ICISKRHPYMFSASEDKLVKCW-----------DLEKNRVIRDYHGHLSGVHTVDIHPTL 226

Query: 122 ELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRI 181
            L+AT  RD  V +W+          +  +  H   +  V      P + S S D TVR+
Sbjct: 227 NLIATAGRDSVVRLWDI----RTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRL 282

Query: 182 W 182
           W
Sbjct: 283 W 283

 Score = 34.7 bits (78), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 57/133 (42%), Gaps = 15/133 (11%)

Query: 100 ELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
           +L+ +I GH   ++ VA    D E  AT S D ++ IW+      +      L  H   V
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKL----TLSGHIMTV 175

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVL---NGHEGTVWSSDFEKSNSNVR 215
           K +   +  P + S+S D  V+ W     D E   V+   +GH   V + D   + +   
Sbjct: 176 KDICISKRHPYMFSASEDKLVKCW-----DLEKNRVIRDYHGHLSGVHTVDIHPTLN--L 228

Query: 216 LCSGSDDGTVRIW 228
           + +   D  VR+W
Sbjct: 229 IATAGRDSVVRLW 241

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 17/140 (12%)

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILP 248
           W+   V+NGH G V +   +  + N    +GS+D T++IW L    G+ +       +  
Sbjct: 119 WKLMRVINGHNGWVRTVAVDPID-NEWFATGSNDTTIKIWDLA--TGKLK-------LTL 168

Query: 249 KAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEY 308
             H   V  +  S +     + S+ +LV   + E   ++   H    GV+  ++   +  
Sbjct: 169 SGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLN- 227

Query: 309 GSKDVILLITAGDDGHVNVW 328
                 L+ TAG D  V +W
Sbjct: 228 ------LIATAGRDSVVRLW 241

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 120/289 (41%), Gaps = 74/289 (25%)

Query: 37  IKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWG----------K 86
           + + D ++  I+E      HK  V S+    +S IL+A S+D+++  W            
Sbjct: 193 VNIEDGKTLAILE-----GHKAPVVSIDVSDNSRILSA-SYDNSIGFWSTIYKEMTVVDP 246

Query: 87  DDDGYNDENDLETEL------------------LAIIEGHENEIKCVAW-SHDGELLATC 127
            +D  N  N + T                    L+++E H   ++ V + S D  +  + 
Sbjct: 247 LEDINNPNNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVEQVIFDSTDNTVGYSV 306

Query: 128 SRDKSVWIWEA------DEMGEEFECISVLQEHSQDV-------KHVIWHQSLPLLASSS 174
           S+D ++  W+       D     +  +S+ Q  + ++       +H+  H   P + +SS
Sbjct: 307 SQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSARHITLHD--PRVGASS 364

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDN 234
                ++ +           L GH+  V S D    N  + LCSGS DGTV++W +   +
Sbjct: 365 -----KVTQQQ---------LIGHKNFVSSLDTCPENEYI-LCSGSHDGTVKVWDVRSTS 409

Query: 235 GEY----EQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYK 279
             Y    E + +Q+ +  K     V++V W+ K  I S G D ++ I K
Sbjct: 410 PMYTITREDKSVQKGVNDK-----VFAVKWAEKVGIISAGQDKKIQINK 453

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           + S SYD  VR W   D         +GH G + +  +    SN RL S  +D T+R+W 
Sbjct: 118 IISGSYDGIVRTW---DLSGNVQKQYSGHSGPIRAVKYI---SNTRLVSAGNDRTLRLWK 171

Query: 230 LEDDN 234
            ++D+
Sbjct: 172 TKNDD 176

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 10/89 (11%)

Query: 195 LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRA 254
           LN      W S  +  + +  + SGS DG VR W   D +G  ++++         H+  
Sbjct: 97  LNSFSNEDWVSSLDVGDGSKHIISGSYDGIVRTW---DLSGNVQKQY-------SGHSGP 146

Query: 255 VYSVNWSPKGYIASTGSDGRLVIYKESED 283
           + +V +     + S G+D  L ++K   D
Sbjct: 147 IRAVKYISNTRLVSAGNDRTLRLWKTKND 175

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 46/96 (47%), Gaps = 15/96 (15%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYN-------------DENDLETE 100
           + H   +R+V +  ++ +++AG+ D T+ +W   +D                + N  + +
Sbjct: 141 SGHSGPIRAVKYISNTRLVSAGN-DRTLRLWKTKNDDLKLTSQQQAQEDDDDEVNIEDGK 199

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
            LAI+EGH+  +  +  S +  +L+  S D S+  W
Sbjct: 200 TLAILEGHKAPVVSIDVSDNSRILS-ASYDNSIGFW 234

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 104/231 (45%), Gaps = 26/231 (11%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K +++L+ H D+   +  N   I+++GS D KI   D+R  +   E  +T H + V  + 
Sbjct: 320 KCIRTLSGHLDRVACLSWNQH-ILSSGSKDHKILHRDVRMPEHYFETANT-HSQEVCGLK 377

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HDGEL 123
           W    N LA+G  D+ V ++    DG + +      +L   E H   +K +AWS H    
Sbjct: 378 WNVDENRLASGGNDNVVYVY----DGPSKK-----PVLKFTE-HNAAVKAMAWSPHRRAT 427

Query: 124 LAT--CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PLLASSSYDD-TV 179
           LAT   + D+ + IW  +  G     +    +    V +++W ++   ++ S  Y    +
Sbjct: 428 LATGGGTADRRLKIWNVNS-GVRLNDV----DTGSQVCNMVWSKNTDEIVTSHGYSKFNL 482

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
            +W DC    E  AVL GH   V       S     + SG+ D T+R W L
Sbjct: 483 TLW-DC-PTLEPLAVLKGHSFRVL--HLTLSTDGTTIVSGAGDETLRYWKL 529

>Scas_442.2*
          Length = 795

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 90/231 (38%), Gaps = 58/231 (25%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGE----LLATCSRDKSVWIW---------EADEMGEEFE 146
           +L A +EGHE+ IK +A+ H       LL + S+D+ + +W         + DE  E+  
Sbjct: 199 QLAAKLEGHEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDEDDEDIA 258

Query: 147 CISVLQEHSQDVKHVI------------------------WHQSLPLLASSSYDDTVRIW 182
               L  + Q   HV                         WH++   L +S+ D  + +W
Sbjct: 259 TKLALLNNKQYKFHVTDALRVCINFEALIMGHDDWISSLQWHETRLQLLASTADTALMVW 318

Query: 183 K--DCDDDWEC-----------CAVLNGHEGTVWSSD-FEKSNSNVRLCSGSDDGTVRIW 228
           +  +    W C            +   G  G  WS   F   N +  L +G   G+ R+W
Sbjct: 319 EPDEASGIWVCGLRLGELSSKGASTATGSAGGFWSCLWFSHQNKDYILTNGKT-GSWRVW 377

Query: 229 CLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIY 278
             E+ N   +QE     +     T+ V  + WSPKG Y+ ST  D    ++
Sbjct: 378 TTEEGNTLCDQE-----LGITGATKQVTDIAWSPKGEYLLSTSLDQTTRLF 423

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 16/119 (13%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
           ++I+A G+   T+++W   D+           + A ++GHE E+ CV +  D   + +CS
Sbjct: 27  THIVAFGA-GQTIALWNPLDENSQG-------VFATLKGHEAEVTCVKFITDTPYMVSCS 78

Query: 129 RDKSVWIWEADE-MGEEFE---CISVLQEHSQDVKHVIWHQSLP-LLASSSYDDTVRIW 182
            D  V IW+ +  +  E +   C+  L  +S     V+    LP L+A    D  V +W
Sbjct: 79  EDHHVKIWKQNPGVAREVDGWTCVQTLDHYSHT---VVALAVLPGLIAVGCADGKVSLW 134

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 94/236 (39%), Gaps = 18/236 (7%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKS-----VWIWEADEMGEEFECISVLQEHSQDVK 159
           + GH  EI C+  S DG+ +A+  R  +     V I+  D      E    L  H+  V 
Sbjct: 564 LYGHGYEITCLDVSPDGKFIASACRSNTPQHAVVRIFNTDNW---LEVKPPLAFHTLTVT 620

Query: 160 HVIWHQSLPLLASSSYDDTVRIW-KDCDDDWECCA--VLNGHEGTVWSSDFEKSNSNVRL 216
            + +      L S   D    +W +D + D           H   +W  D+         
Sbjct: 621 KLRFSPDSKYLLSVCRDRQWVVWERDPETDKFTLKYKTAKPHTRIIWDGDWAPLEFGNVF 680

Query: 217 CSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG--YIASTGSDGR 274
            +GS D T+++W  +++   ++   ++ S+   +   A+   +    G   IA    DG 
Sbjct: 681 VTGSRDRTIKLWKFDENKSNFD---LENSLNMTSLVTALSVXDSVLDGRLLIAXGLEDGS 737

Query: 275 LVIYK-ESEDGW-IVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           + IYK +S  G+ +VE +++L     +   ++W      + + L  A  D    ++
Sbjct: 738 IYIYKYDSTSGFDVVEVLNDLITPAEKLTRLRWSRSQRNNKLWLAAASSDTSTRIY 793

>Kwal_27.10385
          Length = 536

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 17/143 (11%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDD-----GYNDENDLE--------TE 100
           T H++ V  + +   +++LA    D  + +W ++D      G ++E   E          
Sbjct: 68  TQHEQAVNVIRFNSRNDVLATAGDDGQLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKR 127

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           L +      +EI  +AWS D   + T S D S+ I+E     EE  C++   +H+  V+ 
Sbjct: 128 LRSSSTAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEV----EEGTCVANAADHNHYVQG 183

Query: 161 VIWHQSLPLLASSSYDDTVRIWK 183
           V+W      + S S D +V +++
Sbjct: 184 VVWDPQNEFIFSQSADRSVHVYR 206

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 10/87 (11%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
           TA    +  +AW P  N +  GS D+++ I+  +          E   +A    H + ++
Sbjct: 133 TAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEVE----------EGTCVANAADHNHYVQ 182

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADE 140
            V W    E + + S D+SV ++  ++
Sbjct: 183 GVVWDPQNEFIFSQSADRSVHVYRIEK 209

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 82/185 (44%), Gaps = 34/185 (18%)

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           ++ AG  D+ + +W  + +  N EN ++T + L+ +  HE  +  + ++   ++LAT   
Sbjct: 34  LVTAGG-DNKIRVWQLNFEEQN-ENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGD 91

Query: 130 DKSVWIWEA-DEMGEEF----ECISVLQEH--------------SQDVKHVIWHQSLPLL 170
           D  + +W+  D + +EF    E  +  +E               S ++  + W      +
Sbjct: 92  DGQLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYI 151

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGH----EGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
            + S D+++RI++   ++  C A    H    +G VW         N  + S S D +V 
Sbjct: 152 VTGSMDNSLRIFE--VEEGTCVANAADHNHYVQGVVWDPQ------NEFIFSQSADRSVH 203

Query: 227 IWCLE 231
           ++ +E
Sbjct: 204 VYRIE 208

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 67/178 (37%), Gaps = 43/178 (24%)

Query: 160 HVIWHQSLPL-----------------LASSSYDDTVRIWK--------DCDDDWECCAV 194
            + WH+S P+                 L ++  D+ +R+W+        +  D  +  + 
Sbjct: 7   QIYWHESQPIYSLCFQSTGTKQHRIRRLVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSS 66

Query: 195 LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL-----------EDDNGEYEQEWIQ 243
           L  HE  V    F   N    L +  DDG + +W             E++  E+++ W  
Sbjct: 67  LTQHEQAVNVIRFNSRND--VLATAGDDGQLLLWKRNDSISKEFGVDEEEFAEFKESWYV 124

Query: 244 ESILPKAHTRA---VYSVNWSP-KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGV 297
              L  + T     +Y + WSP   YI +   D  L I+ E E+G  V    +  H V
Sbjct: 125 WKRLRSSSTAGSSEIYDLAWSPDDNYIVTGSMDNSLRIF-EVEEGTCVANAADHNHYV 181

>Kwal_56.23035
          Length = 424

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 81/191 (42%), Gaps = 28/191 (14%)

Query: 108 HENEIKCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166
           H   I  V W   D  L  T S D  V +W+ +     FE  S +     DV H +    
Sbjct: 141 HAFSITSVQWYGADNGLFFTGSNDHKVKVWDTNA----FEVASTI-----DVGHRVVQLD 191

Query: 167 LP--LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGT-----VWSSDFEKSN---SNVRL 216
           +   LLA +S D   R+    D      A+  G + T     + ++ F +S+       L
Sbjct: 192 VQGDLLAVASEDSHPRL---IDLASMSAAITLGVKRTDMRYGINTAKFARSDEGSPQQLL 248

Query: 217 CSGSDDGTVRIWCLEDDNGEYEQEWIQES-ILPKAHTRAVYSVNWSPKG--YIASTGSDG 273
            +G DDG VR+W L   N       +QE   L K H R    + W P G   I +TG+DG
Sbjct: 249 ATGDDDGNVRLWDLRMGNRALCD--LQEPDSLAKPHARCCNDLCWDPSGANRIVTTGNDG 306

Query: 274 RLVIYKESEDG 284
           +  +++ S DG
Sbjct: 307 KCKLWEISPDG 317

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 101/233 (43%), Gaps = 49/233 (21%)

Query: 28  MATGSTDRKIKLVDI-RSFQII-----EELDD-------TAHKKTVRSVAWRPHS-NILA 73
           +A+ S D KI + DI + + I+     EE+ D       T H + V  + + P + ++LA
Sbjct: 97  VASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLA 156

Query: 74  AGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSV 133
           + S D TV IW           ++ET        H + +  +++S+DG  LAT +RDK +
Sbjct: 157 SSSLDYTVRIW-----------NVETGEDIYKLKHPDMVTSMSFSYDGTHLATVARDKKL 205

Query: 134 WIWEADEMGEEFECISVLQEHS-QDVKHVIWHQSLPLLASSSY----DDTVRIWKDCDDD 188
            +W       E + +S    H+    + V+W  +   LA++ +    D  + I       
Sbjct: 206 RVWNV----REEKVVSEGAAHAGAKNQRVVWLGNSERLATTGFSKLSDRQIGI------- 254

Query: 189 WECCAVLNGHEGTVWSSD--------FEKSNSNVRLCSGSDDGTVRIWCLEDD 233
           W+   +  G  G  ++ D        F    + +   +G  DG +R +  ++D
Sbjct: 255 WDAFNLEKGDLGGFYTVDQSSGILMPFYDDGNKILYLAGKGDGNIRYYEFQND 307

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 24/148 (16%)

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD-----NGEYEQ-EWIQES 245
             +  GH   V  +DF+  + N R+ S SDDG + IW +  D     +G+ E+ + I+ +
Sbjct: 74  VPLFRGHTAQVLDTDFDPFDDN-RVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPT 132

Query: 246 ILPKAHTRAVYSVNWSP--KGYIASTGSDGRLVIYKESEDGWIVEC---IHELTHGVYET 300
                H+R V  + + P  K  +AS+  D  + I       W VE    I++L H     
Sbjct: 133 KFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRI-------WNVETGEDIYKLKH----P 181

Query: 301 NMVKWVEYGSKDVILLITAGDDGHVNVW 328
           +MV  + + S D   L T   D  + VW
Sbjct: 182 DMVTSMSF-SYDGTHLATVARDKKLRVW 208

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 20/189 (10%)

Query: 56  HKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLET--ELLAIIEGHENEI 112
           HK+    +A+ PH S  L +GS D+TV++W           D+E   +  +I+  H++ +
Sbjct: 185 HKENGYGLAFNPHISGELLSGSDDTTVALW-----------DIEAAKKPKSILTSHDDIV 233

Query: 113 KCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
             V W   +  +  T S DK++ + +        E +  L   S          S  LLA
Sbjct: 234 NDVKWHEFESNVFGTVSEDKTLQVHDKRV---RLEPVKKLPTASPFNTLSFSKHSRNLLA 290

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
           ++  D  + ++ D  D      V++GH+ +V + +F      +   SGSD   + IW L 
Sbjct: 291 AAGVDSQIYLY-DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLT 348

Query: 232 DDNGEYEQE 240
               E  Q+
Sbjct: 349 QIGAEQSQD 357

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 14/151 (9%)

Query: 32  STDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGY 91
           ++  +++L   R+ Q+I+    +  K  V S ++RP   +LAAG     VS++    D Y
Sbjct: 58  TSSTRVQLFSSRTRQVIKTF--SRFKDVVYSSSFRPDGKLLAAGDATGLVSVY----DSY 111

Query: 92  NDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVL 151
           N  N L +   +    H  +   +    D + L T + D+ V +W   ++   +E    L
Sbjct: 112 NPRNLLVSIKASTHPAHVTKFHPL----DKQTLVTATDDRVVRVW---DISHAYEPTLEL 164

Query: 152 QEHSQDVKHVIWHQSLP-LLASSSYDDTVRI 181
              S  V+ V +    P ++ S  YD  VR+
Sbjct: 165 LGASDYVRSVCFVPGAPHMVVSGCYDGVVRL 195

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 98/248 (39%), Gaps = 48/248 (19%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           + ++ + SV+W P   ++  G+    + +W K           + +L  I++ H + I  
Sbjct: 207 SEEEPIISVSWSPDGELVLTGTTSGELRLWNK-----------QGKLKNILDSHRSPIVA 255

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECIS-----VLQEHSQDV--------KHV 161
           + W+ D   L T      V +W +   G + +  S     +  E S  +        K V
Sbjct: 256 MKWNQDCTHLLTTDVSNVVILW-STLTGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFV 314

Query: 162 IWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
           I      LL  +  ++            +    L GH  T+ + +F KSN +  L S SD
Sbjct: 315 IPGPGGSLLVYTIGNN------------KPLGRLLGHTSTITTLEFNKSNKS--LLSASD 360

Query: 222 DGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKES 281
           D T+++W     N     ++         HT+ + S +W     I ST  DG + ++  S
Sbjct: 361 DNTIKVW--RGGNSSAANDFTD-------HTKTISSAHWINDDLIISTAYDGTVKVWSIS 411

Query: 282 EDGWIVEC 289
           ++  + E 
Sbjct: 412 KNSIVAEA 419

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 64/149 (42%), Gaps = 13/149 (8%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           L  + GH + I  + ++   + L + S D ++ +W     G      +   +H++ +   
Sbjct: 333 LGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWR----GGNSSAANDFTDHTKTISSA 388

Query: 162 IWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR--LCSG 219
            W     L+ S++YD TV++W    +     A L+          FE S S  R  L  G
Sbjct: 389 HWIND-DLIISTAYDGTVKVWSISKNSIVAEASLDSE------PIFEASLSPDRNWLTVG 441

Query: 220 SDDGTVRIWCLEDDNGEYEQEWIQESILP 248
           +  G+  ++ ++     Y+Q  +Q+  +P
Sbjct: 442 TLQGSAIVFDVKTFLESYDQNSVQQQSVP 470

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 113/265 (42%), Gaps = 39/265 (14%)

Query: 2   AGLKLLKSLALHDD--KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKT 59
           +G K+      HD+   C   D+  G + + GS D  +K+ D+   + I  L    H  +
Sbjct: 385 SGSKITSLPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLH--GHLAS 442

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKD----DDGYNDENDLETELLAIIEGHENEIKCV 115
           +  +    +S ++  G  D+ + +W  D    D+  N   D +   L   + H +EI  +
Sbjct: 443 ISCMQIDQYSTLITGGR-DAVLKLWDIDKAMADEASNSSEDNDA-CLYTFDSHVDEITAI 500

Query: 116 AWSHDGELLATCSRDKSVWIWEADE------MGEEFECISVLQEHSQDVKHVIWHQSLP- 168
           ++  DG+ L + S+D++V  W+ +       +   F    +  + +  +++ +     P 
Sbjct: 501 SF--DGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPP 558

Query: 169 ----------LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
                      LA+ + D  VR+W D     +   +L GH   + S  F+    +V L +
Sbjct: 559 AIGALQCFDAALATGTKDGIVRLW-DLRS-GKVVRMLEGHTDAITSLQFD----SVNLVT 612

Query: 219 GSDDGTVRIWCLE----DDNGEYEQ 239
           G+ D ++RIW L      D   YEQ
Sbjct: 613 GAMDRSIRIWDLRTGILSDVFAYEQ 637

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 70/178 (39%), Gaps = 41/178 (23%)

Query: 32  STDRKIKLVDI-------RSFQIIEELDDTAHKKTVRSVAW----------RPHSNILAA 74
           ST +KIK V +       +++  +++  D+  K T    A            P   + +A
Sbjct: 356 STSKKIKDVGVSHRNRRRKTYPTLQQFYDSGSKITSLPKAHDEDITCLDFDMPFGTMCSA 415

Query: 75  GSFDSTVSIWGKDDDGYNDENDL-ETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSV 133
           GS D +V +W           DL + + +A + GH   I C+       L+ T  RD  +
Sbjct: 416 GSLDHSVKVW-----------DLSKKKQIATLHGHLASISCMQIDQYSTLI-TGGRDAVL 463

Query: 134 WIWE-----ADEMGEEFE----CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
            +W+     ADE     E    C+     H  ++  + +      L S S D TVR W
Sbjct: 464 KLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGD--NLVSGSQDRTVRQW 519

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 15/93 (16%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +ATG+ D  ++L D+RS +++  L+   H   + S+ +   S  L  G+ D ++ IW   
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLE--GHTDAITSLQF--DSVNLVTGAMDRSIRIW--- 622

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
                   DL T +L+ +  +E  I  + +  D
Sbjct: 623 --------DLRTGILSDVFAYEQPITSLHFDLD 647

>Scas_721.115*
          Length = 318

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 6/133 (4%)

Query: 101 LLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFEC-ISVLQEHSQDV 158
           L   +EGH   +  +A S     LL + SRDK++  W+     ++F   +   + HS  V
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
           +     Q      S+S+D T+R+W       E      GH+  V S   ++  S   + S
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLWDVATG--ETYQRFVGHKSDVMSVAIDRKAS--MIIS 124

Query: 219 GSDDGTVRIWCLE 231
           GS D T+++W ++
Sbjct: 125 GSRDKTIKVWTIK 137

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 88/237 (37%), Gaps = 54/237 (22%)

Query: 40  VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET 99
           V +RSF+         H   V+            + S+D T+ +W           D+ T
Sbjct: 56  VPVRSFK--------GHSHIVQDCTLTQDGAYALSASWDKTLRLW-----------DVAT 96

Query: 100 -ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
            E      GH++++  VA      ++ + SRDK++ +W       + +C++ L  H+   
Sbjct: 97  GETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-----KGQCLATLLGHND-- 149

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
               W   + +  +   DD+V +    +D       LN  +     +DF   N NV   +
Sbjct: 150 ----WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQ---IEADFVGHNGNVNTVT 202

Query: 219 GSDDGT----------VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY 265
            S DGT          + +W L +    Y      E          V+++ +SP  Y
Sbjct: 203 ASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE----------VFALAFSPNRY 249

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 60/153 (39%), Gaps = 38/153 (24%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G    + S D+ ++L D+ + +  +      HK  V SVA    ++++ +GS D T+ +
Sbjct: 76  DGAYALSASWDKTLRLWDVATGETYQRF--VGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 84  WGKDDD------GYND-----------END-------------------LETELLAIIEG 107
           W           G+ND           +ND                    + ++ A   G
Sbjct: 134 WTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVG 193

Query: 108 HENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
           H   +  V  S DG L+A+  +D  + +W   E
Sbjct: 194 HNGNVNTVTASPDGTLIASAGKDGEIMLWNLAE 226

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 6/114 (5%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G ++A+   D +I L ++   + +  L   + +  V ++A+ P+   LAA +  S + I
Sbjct: 206 DGTLIASAGKDGEIMLWNLAEKKAMYTL---SAQDEVFALAFSPNRYWLAAAT-ASGIKI 261

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
           +  D     D  DL  E     +  E     +AWS DG+ L     D  + +W+
Sbjct: 262 FCLDPQSLVD--DLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQ 313

>Scas_693.22
          Length = 1145

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 104 IIEGHENEIKCVAWS-HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
           ++ GH   I  + ++  + ++LATCS D  V  W+       F   S  +  +  VK   
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVK--- 168

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           W+     + +S++ + + IW D          L GH+ +V S DF +  S+  + S S+D
Sbjct: 169 WNYKDSNILASAHSNDIYIW-DLRMGSTPLHKLVGHDSSVNSIDFNRFKSS-EIMSSSND 226

Query: 223 GTVRIW 228
           GTV+ W
Sbjct: 227 GTVKFW 232

>Kwal_0.212
          Length = 303

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/228 (18%), Positives = 91/228 (39%), Gaps = 37/228 (16%)

Query: 37  IKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW----GKDDDGYN 92
           ++L DIR+           H+  V S+A++  +  + + S D T+ +W          Y 
Sbjct: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYK 114

Query: 93  DENDLETELLAIIEGH----------------ENE------------IKCVAWSHDGELL 124
            +  +   ++   +G                 EN+            ++ ++ + DG +L
Sbjct: 115 HQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSML 174

Query: 125 ATCSRDKSVWIWEADEM--GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
              +   + ++W+          + ++  + H++ +  V+    +  LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVW 234

Query: 183 KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
              DD+++    L+ H+  VW   F  S  +  L +   D  VR+W L
Sbjct: 235 S-IDDNFQLETTLDNHQRWVWDCAF--SADSAYLVTACSDHYVRLWDL 279

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 67/162 (41%), Gaps = 14/162 (8%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEEL---DDTAHKKTVRSVAWRPHSNILAAGSFDST 80
           N G + +   D  +++ D+   Q + +L   DDT     ++S++     ++L AG+    
Sbjct: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTP----LQSLSVASDGSMLVAGNNKGN 182

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
             +W       +  +    + +     H   I  V  S D + LATCS D +  +W  D 
Sbjct: 183 CYVWQMP----HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSID- 237

Query: 141 MGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
             + F+  + L  H + V    +      L ++  D  VR+W
Sbjct: 238 --DNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 54/127 (42%), Gaps = 8/127 (6%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
            EGH   +  +A+  + + + + S D ++ +W+          +    +H   V  V+ H
Sbjct: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV-----RAPSVQRNYKHQAAVNEVVIH 125

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
            +   L S   D  VRIW   ++  +C   L   + T   S    S+ ++ L +G++ G 
Sbjct: 126 PNQGELISCDQDGNVRIWDLGEN--QCVHQLAPEDDTPLQSLSVASDGSM-LVAGNNKGN 182

Query: 225 VRIWCLE 231
             +W + 
Sbjct: 183 CYVWQMP 189

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 63/165 (38%), Gaps = 18/165 (10%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
           S ILA+  +D T+  W            L       I+  ++++  +  S D   LA   
Sbjct: 2   SVILASAGYDHTIRFWEA----------LTGVCSRTIQHSDSQVNRLEISSDKRFLAAAG 51

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD 188
               + +   D        ++  + H  +V  + + Q    + SSS D T+++W     D
Sbjct: 52  H---LNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVW-----D 103

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
               +V   ++     ++     +   L S   DG VRIW L ++
Sbjct: 104 VRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN 148

>Kwal_56.23895
          Length = 367

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 56/129 (43%), Gaps = 17/129 (13%)

Query: 27  IMATGSTDRKIKLVDIR--------SFQIIEELDDTAHKKTVRSVAWRPH-SNILAAGSF 77
           I+ATG  D  IK+ D+R        S Q +   +   H   +R V+W PH SN+L + S+
Sbjct: 236 IVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSY 295

Query: 78  DSTVSIW------GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE--LLATCSR 129
           D T  +W      G+   G  +  D       +   H   +    WS  G+   +A+ S 
Sbjct: 296 DMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHHTEFVFGADWSLWGKPGYIASTSW 355

Query: 130 DKSVWIWEA 138
           D  V +W A
Sbjct: 356 DGDVCVWYA 364

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 80/204 (39%), Gaps = 42/204 (20%)

Query: 54  TAHKKTVRSVAWRPH-SNILAAGSFDSTVSIW------GKDDDGYNDENDLETELLAIIE 106
           + +K  +    + PH  N++ + + +S V+++      G +   +   N +ET       
Sbjct: 172 SKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMET------- 224

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIW------EADEMGEEFECISVLQEHSQDVKH 160
                + C    +   ++AT   D  + +W      +A     +   ++ +  H   ++ 
Sbjct: 225 -----LTCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRK 279

Query: 161 VIW--HQSLPLLASSSYDDTVRIWKDCDDDWE--------------CCAVLNGHEGTVWS 204
           V W  H S  +L S+SYD T R+W+D  DD                C  V   H   V+ 
Sbjct: 280 VSWSPHHS-NMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSVDPARGCRFVFPHHTEFVFG 338

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIW 228
           +D+        + S S DG V +W
Sbjct: 339 ADWSLWGKPGYIASTSWDGDVCVW 362

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 19/131 (14%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTA---------HKKTVRSVAWRPH-SNILAAGS 76
           ++ATG  D+ +K+ D+R  +       TA         H   VR V W PH SNIL + S
Sbjct: 237 VIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTS 296

Query: 77  FDSTVSIW-------GKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE--LLATC 127
           +D T   W       G    G  + +D +     +   H   +    WS  G+   +AT 
Sbjct: 297 YDMTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATT 356

Query: 128 SRDKSVWIWEA 138
             D  V  W A
Sbjct: 357 GWDGQVCAWYA 367

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 89/237 (37%), Gaps = 58/237 (24%)

Query: 52  DDTAHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHEN 110
           D   +K  +    + PH  N++ + S +S VS++       +++         I      
Sbjct: 171 DAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRF------IAHSGLE 224

Query: 111 EIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFEC-------ISVLQEHSQDVKHVIW 163
            + C    +   ++AT   DK V +W+   + +           I+ +Q HS  V+ V+W
Sbjct: 225 ALSCDFNKYRPHVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVW 284

Query: 164 --HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
             H S  +L S+SYD T R W D  D          H G   +SD ++  S V       
Sbjct: 285 SPHHS-NILLSTSYDMTCRAWHDLAD-----GPGGQHSGRTNNSDPQRGCSYVF------ 332

Query: 222 DGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWS---PKGYIASTGSDGRL 275
                                        H+  V+  +WS     GY+A+TG DG++
Sbjct: 333 ---------------------------SKHSEFVFGADWSLWGQPGYVATTGWDGQV 362

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/228 (17%), Positives = 95/228 (41%), Gaps = 37/228 (16%)

Query: 37  IKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIW-------GKDDD 89
           ++L DIR+           H+  V S++++  +  + + S D T+ +W        ++  
Sbjct: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYK 114

Query: 90  GYNDENDL-----ETELLA--------------------IIEGHENEIKCVAWSHDGELL 124
            +   N++     + EL++                    +    +  ++ ++ + DG +L
Sbjct: 115 HHAPVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSML 174

Query: 125 ATCSRDKSVWIWEADEM--GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
              +   + ++W+          + ++  + H++ +  V+    +  LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVW 234

Query: 183 KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
              +D+++    L+GH+  VW   F  S  +  L +   D  VR+W L
Sbjct: 235 S-IEDNFKLETTLDGHQRWVWDCAF--SADSAYLVTACSDHYVRLWDL 279

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/225 (19%), Positives = 91/225 (40%), Gaps = 19/225 (8%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
            EGH   +  +++  D + + + S D ++ +W+          +    +H   V  V+ H
Sbjct: 71  FEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDV-----RAPSVQRNYKHHAPVNEVVIH 125

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
            +   L S   D  +RIW   ++  +C   L   + T   S    S+ ++ L +G++ G 
Sbjct: 126 PNQGELISCDQDGNIRIWDLGEN--QCTHQLTPEDDTPLQSLSIASDGSM-LVAGNNKGN 182

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK-GYIASTGSDGRLVIYKESED 283
             +W + +       + + +    ++HT+ +  V  S    ++A+  +D    +      
Sbjct: 183 CYVWQMPNHTDAANLKPVTKF---RSHTKYITRVLLSSDVKHLATCSADHTARV------ 233

Query: 284 GWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
            W +E   +L   +       W    S D   L+TA  D +V +W
Sbjct: 234 -WSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLW 277

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 83/204 (40%), Gaps = 33/204 (16%)

Query: 36  KIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEN 95
           ++ + +   +Q+ E L    H   V  + W P    +A+ S D TV +  +         
Sbjct: 35  EVYIYETSGYQLRETLV-LEHAAGVSQICWSPDGKCIASCSDDFTVVVTHR--------- 84

Query: 96  DLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS 155
             +  LL  + GH   +  + +++ G LL T S D+S+ +W+          +  +  HS
Sbjct: 85  --QLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDV----LTGTVMKTMSAHS 138

Query: 156 QDVKHV-IWHQSLPLLASSSYDDTVRIWKDC----------DDDWECCAVLNGHEGTVWS 204
           + V  + +      +L+S S+D  +RI+             D DW+         G V  
Sbjct: 139 EPVVSIDLSDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQ------SETGVVPI 192

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIW 228
           +  + S +   L   S DG V+IW
Sbjct: 193 AKVKFSANTKYLLVKSYDGVVKIW 216

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 78/201 (38%), Gaps = 34/201 (16%)

Query: 2   AGLKLLKSLALH-----DDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAH 56
           +G +L ++L L         CWS D   G  +A+ S D  + +V  R   ++  L    H
Sbjct: 42  SGYQLRETLVLEHAAGVSQICWSPD---GKCIASCSDDFTV-VVTHRQLGLLHRL--VGH 95

Query: 57  KKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVA 116
              V S+ +    N+L   S D ++ +W          + L   ++  +  H   +  + 
Sbjct: 96  TAPVISLCYNNKGNLLFTSSMDESIKVW----------DVLTGTVMKTMSAHSEPVVSID 145

Query: 117 WS-HDGELLATCSRDKSVWIWEADEMGEEFECISVL--------QEHSQDVKHVIWHQSL 167
            S +DG +L++ S D  + I++         C+  L        +     +  V +  + 
Sbjct: 146 LSDNDGSILSSGSHDGLIRIFDT----ATGHCLKTLTYDKDWQSETGVVPIAKVKFSANT 201

Query: 168 PLLASSSYDDTVRIWKDCDDD 188
             L   SYD  V+IW     D
Sbjct: 202 KYLLVKSYDGVVKIWDSVSGD 222

>AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH]
           complement(397359..398474) [1116 bp, 371 aa]
          Length = 371

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 61/142 (42%), Gaps = 18/142 (12%)

Query: 190 ECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPK 249
           +  A+L  H+ TV + D        R+ + S D    +W    D G Y+   +   I   
Sbjct: 46  KLVAILADHDKTVTAVDISIHG---RIVTCSQDRNAIVWEPLSD-GSYKPTLVLLRI--- 98

Query: 250 AHTRAVYSVNWSPKGYIASTGSDGRLV---IYKESEDGWIVECIHELTHGVYETNMVKWV 306
              RA   V+W+P GY  + GS  R++    Y+   D W+ + I +        N + W 
Sbjct: 99  --NRAATCVSWAPNGYKFAVGSSARIISVCYYEHDNDWWVSKHIKKPIKST--INALSWH 154

Query: 307 EYGSKDVILLITAGDDGHVNVW 328
           E G    +LL   G DG++ V+
Sbjct: 155 ENG----VLLAAGGTDGYLRVF 172

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 82/203 (40%), Gaps = 42/203 (20%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV---- 60
           KL+  LA HD    +VD++  G + T S DR           + E L D ++K T+    
Sbjct: 46  KLVAILADHDKTVTAVDISIHGRIVTCSQDRNA--------IVWEPLSDGSYKPTLVLLR 97

Query: 61  -----RSVAWRPHSNILAAGSFDSTVSI--WGKDDDGYNDENDLETELLAIIEGHENEIK 113
                  V+W P+    A GS    +S+  +  D+D +  ++        I +  ++ I 
Sbjct: 98  INRAATCVSWAPNGYKFAVGSSARIISVCYYEHDNDWWVSKH--------IKKPIKSTIN 149

Query: 114 CVAWSHDGELLATCSRDKSVWIWE-------------ADEMGEEFECISVLQE--HSQDV 158
            ++W  +G LLA    D  + ++                  G++F   +V++E  H   +
Sbjct: 150 ALSWHENGVLLAAGGTDGYLRVFSGYIKGLDQKEQVAGSPWGDKFPFGAVIREWYHGAWI 209

Query: 159 KHVIWHQSLPLLASSSYDDTVRI 181
             V W      LA  ++D  + +
Sbjct: 210 HDVQWRSQQERLAYVTHDGLLAV 232

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 96/230 (41%), Gaps = 22/230 (9%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           + I++GH N+I    WS D +L+ + S+D  + +W++    +     S +   SQ V   
Sbjct: 78  VGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKR----SAIPLDSQWVLTC 133

Query: 162 IWHQSLPLLASSSYDDTVRIW---KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
               S  L AS+  ++   I+   +         ++  GH G +   +F    S  R+ +
Sbjct: 134 ALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFV---SESRVVT 190

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIY 278
            S D T  +W  +    +  +E+     L      ++   N S     AS GSDG   I+
Sbjct: 191 SSGDMTCALW--DIPKAKRVREYSDH--LGDVLAISIPVTNLSKNNMFASCGSDGYTFIW 246

Query: 279 KESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               D      + + + G  ++N +K+   G+   +      DDG ++++
Sbjct: 247 ----DVRSPSAVQQFSIGSCDSNCLKFFPDGNSVAV----GNDDGTISLF 288

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
           L+ E++  +EGH N +  V  S DG  + T S D+++ +W
Sbjct: 370 LKGEVVYSLEGHGNRLAGVKCSPDGMAICTGSWDQTLKLW 409

>Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement
          Length = 478

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 73/172 (42%), Gaps = 10/172 (5%)

Query: 106 EGHENEIKCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
           + H   I  + W SHD  +  T S D+ V IW+ +E    FE +   Q   + V  +   
Sbjct: 199 DSHSFAITSIKWYSHDNGMFFTGSSDREVKIWDTNE----FEVVQNFQLGYR-VNQLDTK 253

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
             L ++AS      V   K               +  + ++ F    +++ + SG DDG 
Sbjct: 254 GDLVIVASEDTYPRVIDLKSMSSVISLGVKNKKMKFGINTAKFAPMGTDL-VASGDDDGN 312

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK--GYIASTGSDGR 274
           VRIW L   N     +  ++  L K H +    + W+P+    + +TG+DG+
Sbjct: 313 VRIWDLRKSNSML-YDLTEQDTLSKPHAKCCNDLCWNPRLEDELVTTGNDGK 363

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 91/224 (40%), Gaps = 35/224 (15%)

Query: 11  ALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSN 70
           AL +  CW  D+  G +    +       VD +S ++ E             + + P +N
Sbjct: 41  ALENVNCW--DIKTGELSKILTDGLPPGAVDAKSTKLAES----------TYLQYHPETN 88

Query: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAI-IEGHENEIKCVAWSHDGELLATCSR 129
           +LA G  D  + IW           DL ++ + I   GH++ I  + +   G  L + S+
Sbjct: 89  LLAVGYADGVIKIW-----------DLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK 137

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189
           D  + IW  D +GE    +  L+ H   +   IW ++   L S+S D  ++IW D     
Sbjct: 138 DSDIIIW--DLVGE--VGLYKLRSHKDSITG-IWCENEDWLISTSKDGLIKIW-DLKTQ- 190

Query: 190 ECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
           +C      H    W         N  + + S +  ++IW L+ D
Sbjct: 191 QCVETHMAHTSECWGLAIH----NDLVITTSTESQIKIWNLDLD 230

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 4/87 (4%)

Query: 160 HVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSG 219
           ++ +H    LLA    D  ++IW             NGH+  +    F+ + +  RL SG
Sbjct: 80  YLQYHPETNLLAVGYADGVIKIWDLISK--TVLINFNGHKSAITVLRFDPTGT--RLISG 135

Query: 220 SDDGTVRIWCLEDDNGEYEQEWIQESI 246
           S D  + IW L  + G Y+    ++SI
Sbjct: 136 SKDSDIIIWDLVGEVGLYKLRSHKDSI 162

>Scas_693.36
          Length = 375

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 87/231 (37%), Gaps = 53/231 (22%)

Query: 57  KKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           K  +    + PH  N+L   S DS  +I+   D      N L    + ++    N+ +  
Sbjct: 184 KDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYR-- 241

Query: 116 AWSHDGELLATCSRDKSVWIWEADEM--GEEFECIS-VLQEHSQDVKHVIW--HQSLPLL 170
                  +LAT   D S+ IW+   +   +   CI+ ++  H   V+ V+W  H S  +L
Sbjct: 242 -----PNVLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHS-DIL 295

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
            S+SYD + +IW D   D     +     G   S DF  +     +              
Sbjct: 296 LSTSYDMSCKIWNDLSYD----PIQQRKTGKTNSLDFTGNGCRFIM-------------- 337

Query: 231 EDDNGEYEQEWIQESILPKAHTRAVYSVNWS---PKGYIASTGSDGRLVIY 278
                               HT  V+  +WS     GY+ASTG DG + I+
Sbjct: 338 ------------------NQHTEFVFGADWSMWGQPGYVASTGWDGNVFIW 370

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 27  IMATGSTDRKIKLVDIR--------SFQIIEELDDTAHKKTVRSVAWRP-HSNILAAGSF 77
           I+ATG  D+ IK+ D+R          Q I   +   H+  VR V W P HSN+L + S+
Sbjct: 242 IIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSY 301

Query: 78  DSTVSIWGK-DDDGY 91
           D T  +W    DDG+
Sbjct: 302 DMTCRVWTDLSDDGH 316

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 93/236 (39%), Gaps = 57/236 (24%)

Query: 55  AHKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            +K+ +    + PH  N++   S +S +S++    D     N L         G E  + 
Sbjct: 178 GNKECIYQATFSPHDPNLVLCSSGNSFISLY----DLRVPNNGLPQHQFLGHGGFE-ALT 232

Query: 114 CVAWSHDGELLATCSRDKSVWIWEAD------EMGEEFECISVLQEHSQDVKHVIW--HQ 165
           C    +   ++AT   DK + +W+          G +   I+ +Q H   V+ V W  H 
Sbjct: 233 CDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHH 292

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
           S  +L S+SYD T R+W D  DD        GH  T  ++  + ++              
Sbjct: 293 S-NMLLSTSYDMTCRVWTDLSDD--------GHGLTGKTNSIDPAHG------------C 331

Query: 226 RIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWS---PKGYIASTGSDGRLVIY 278
           R   +E                   H+  V+  +WS     G++ASTG DG++ I+
Sbjct: 332 RFIFME-------------------HSEFVFGADWSLWGTPGFVASTGWDGQVCIW 368

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 95/217 (43%), Gaps = 36/217 (16%)

Query: 66  RPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLA 125
           R  + +L + S+D T  IW        D N L+ +L      HE  +       D +++ 
Sbjct: 109 RFQNGLLLSSSWDKTAKIW--------DNNKLKYDL----RNHEASVWDSTMVSD-DIIL 155

Query: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185
           T S DKS+ +W   ++ ++   I     H   ++H + + S  + AS S D T+++    
Sbjct: 156 TASADKSIGVWMEGKLIKKLSNI-----HDDVIRH-LEYISNDIFASCSNDGTIKL---L 206

Query: 186 DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQES 245
           + + E   V  GHE  V+       + N  L S  +D TVRIW +   NG  +Q      
Sbjct: 207 NLEGEIKNVFEGHESFVYCV----KHMNNTLFSCGEDSTVRIWSI---NGSTKQ------ 253

Query: 246 ILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESE 282
            + +    +V++++  P G      SD  + I+ E +
Sbjct: 254 -VIRIPAVSVWNLDLLPNGDFVICCSDNTIRIFTEDQ 289

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 82/185 (44%), Gaps = 33/185 (17%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           KL   L  H+   W   + +  I+ T S D+ I +      ++I++L +  H   +R + 
Sbjct: 131 KLKYDLRNHEASVWDSTMVSDDIILTASADKSIGV--WMEGKLIKKLSNI-HDDVIRHLE 187

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
           +  + +I A+ S D T+ +            +LE E+  + EGHE+ + CV   H    L
Sbjct: 188 YISN-DIFASCSNDGTIKLL-----------NLEGEIKNVFEGHESFVYCV--KHMNNTL 233

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSY-----DDTV 179
            +C  D +V IW  +   ++   I  +          +W+  L LL +  +     D+T+
Sbjct: 234 FSCGEDSTVRIWSINGSTKQVIRIPAVS---------VWN--LDLLPNGDFVICCSDNTI 282

Query: 180 RIWKD 184
           RI+ +
Sbjct: 283 RIFTE 287

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 67/172 (38%), Gaps = 51/172 (29%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGE----------EFECIS 149
           +L A + GH  ++K +   +D ++ A+ SRD S+ +W     G+          +F    
Sbjct: 3   QLSATLRGHSQDVKDITAVNDNKI-ASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAV 61

Query: 150 VLQEHSQDVKH--------------VIWHQSLP-------------------LLASSSYD 176
              + SQ V +              VI   + P                   LL SSS+D
Sbjct: 62  CYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTGNVCGLRFQNGLLLSSSWD 121

Query: 177 DTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            T +IW    D+ +    L  HE +VW S      S+  + + S D ++ +W
Sbjct: 122 KTAKIW----DNNKLKYDLRNHEASVWDSTMV---SDDIILTASADKSIGVW 166

>Kwal_33.15591
          Length = 714

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 120/292 (41%), Gaps = 41/292 (14%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           KL  +L+ H+    SV V N   +AT S D  ++L       + ++       + V S+ 
Sbjct: 7   KLSATLSGHEQDVKSVAVLNNDTVATCSRDGSVRLWKKGHNNLWQDAVVYQSDEFVNSLC 66

Query: 65  WRPHSNILAAGS----FDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120
           +   S +L  G      +S   + G  D G + E         ++ GHEN + CV  S  
Sbjct: 67  YDNTSGLLFCGGQNCLINSVSPLLG--DVGQDSE--------FVLIGHENNV-CVLNSSQ 115

Query: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180
           G +L + S D +  +W    +  E      L+ H+  V  V     +    ++S D T++
Sbjct: 116 GYVL-SGSWDTTAKVWFQGALKHE------LKGHTASVWDVKMLPEVGFYMTASADGTIK 168

Query: 181 IWKDCDDDWECCAVLNG-HEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
           +W    +  +      G H   +   D + S      CS  +DGTV+I    D  G+  +
Sbjct: 169 LW----EGEKVLKTFTGLHTDVIRHIDIDASGEKFASCS--NDGTVKI---NDMEGKTLK 219

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIH 291
             +        H   VYSV ++P G + S G D  + I+K   DG + + I 
Sbjct: 220 TLV-------GHESFVYSVKFAPNGDVISCGEDRTVRIWK--ADGTVKQVIR 262

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 113/305 (37%), Gaps = 84/305 (27%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLE----TELLAIIEGHE 109
           + H   VR+V +   + +++ G+ D T+ +W   +D     ++LE       LAI+EGH+
Sbjct: 139 SGHTGAVRAVKFISSTRLVSGGN-DRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQ 197

Query: 110 NEIKCVAWSHDGELLATCSRDKSVWIWEA-----------DEMGEEFEC----------- 147
             +  V+    G+ + + S D S+  W             D +G++              
Sbjct: 198 APV--VSVDVQGDRILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTMK 255

Query: 148 ---------ISVLQEHSQDVKHVIWHQSLPLLA-SSSYDDTVRIW----KDCDDDWE--- 190
                    +S+L+ H   V+ VI+  +   +A S S D T++ W      C D      
Sbjct: 256 DGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSY 315

Query: 191 --------------CCAV----------------------LNGHEGTVWSSDFEKSNSNV 214
                          C                        L GH+  V + D    N  +
Sbjct: 316 SLLSMVELPKLRLLACGSSARHITLHDPRADSSAKITQQQLLGHKNFVVALDTCPENEYM 375

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGR 274
            LCS S DGTV++W +   +  Y      +S+  K     V++V W+    I S G D +
Sbjct: 376 -LCSASHDGTVKVWDIRSSSSIYTITREDQSV-EKGINDKVFAVKWAKGVGIISGGQDKK 433

Query: 275 LVIYK 279
           +   K
Sbjct: 434 IQFNK 438

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 13/95 (13%)

Query: 170 LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWC 229
           + S SYD  VR W   +   +     +GH G V +  F    S+ RL SG +D T+R+W 
Sbjct: 116 IVSGSYDGVVRTW---NLSGKIEKQYSGHTGAVRAVKF---ISSTRLVSGGNDRTLRLWK 169

Query: 230 LEDDNGEY--EQEWIQESILPKAHTRAVYSVNWSP 262
            ++D+ ++  E E  +E     AHT A+   + +P
Sbjct: 170 TKNDDVKHVDELEGTEE-----AHTLAILEGHQAP 199

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 13/107 (12%)

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGR 274
           R+ SGS DG VR W L   +G+ E+++         HT AV +V +     + S G+D  
Sbjct: 115 RIVSGSYDGVVRTWNL---SGKIEKQY-------SGHTGAVRAVKFISSTRLVSGGNDRT 164

Query: 275 LVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGD 321
           L ++K   D   V+ + EL  G  E + +  +E     V+ +   GD
Sbjct: 165 LRLWKTKNDD--VKHVDEL-EGTEEAHTLAILEGHQAPVVSVDVQGD 208

>Scas_658.1
          Length = 442

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 77/178 (43%), Gaps = 21/178 (11%)

Query: 55  AHKKTVRSVAWRPHS-NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            H     S+ + P+S N+L +G  D+ V +W    D Y+  N     LL   +GH   I 
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVW----DFYHKRN-----LLRDYKGHSKAIN 197

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS---LPLL 170
            + ++ DG    + S D ++ IW+ ++   + +     +    DVK   ++ S   +   
Sbjct: 198 SLDFNDDGTNFISSSFDHTIKIWDTEQ--GKVKTKLHFKSTPNDVKFRPFNSSEFIVGFA 255

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            S  Y    RI    ++D     V + H  ++ +  F    S  +  S S+D TVRIW
Sbjct: 256 NSKIYHYDTRI---SENDGR-VQVYDHHMSSILALKFFPDGS--KFISSSEDKTVRIW 307

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 108/280 (38%), Gaps = 32/280 (11%)

Query: 6   LLKSLALHDDKCWSVDVNNGGI-MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           LL+    H     S+D N+ G    + S D  IK+ D    ++  +L     K T   V 
Sbjct: 185 LLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKL---HFKSTPNDVK 241

Query: 65  WRP-HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGEL 123
           +RP +S+    G  +S +  +    D    END   +   + + H + I  + +  DG  
Sbjct: 242 FRPFNSSEFIVGFANSKIYHY----DTRISENDGRVQ---VYDHHMSSILALKFFPDGSK 294

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK 183
             + S DK+V IW+ +++    + IS   ++S  +  +  H       + S D+T+  + 
Sbjct: 295 FISSSEDKTVRIWD-NQVNVPIKQISDTTQYS--MPSIDIHPDKKNFCAQSMDNTIYTYS 351

Query: 184 -DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWI 242
                      +  G     +      S     +CSG     V IW           +W 
Sbjct: 352 MKPKYRRNPNKMFKGQTSAGYGIGLTFSADGRYVCSGDSKSKVHIW-----------DWT 400

Query: 243 QESILPK---AHTRAVYSVNWSPK--GYIASTGSDGRLVI 277
              +L        + +  V W+P+    +A +G+ G++ I
Sbjct: 401 TTRLLNTISIPGNKPITQVAWNPQETSKVACSGNTGKIYI 440

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 102/255 (40%), Gaps = 30/255 (11%)

Query: 23  NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVS 82
           N+G ++ +G  D  +K+ D    + +   D   H K + S+ +        + SFD T+ 
Sbjct: 160 NSGNLLLSGGNDNIVKVWDFYHKRNLLR-DYKGHSKAINSLDFNDDGTNFISSSFDHTIK 218

Query: 83  IWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEAD-EM 141
           IW        ++  ++T+L    +   N++K   + +  E +   +  K   I+  D  +
Sbjct: 219 IWD------TEQGKVKTKLH--FKSTPNDVKFRPF-NSSEFIVGFANSK---IYHYDTRI 266

Query: 142 GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGT 201
            E    + V   H   +  + +        SSS D TVRIW D   +     + +  + +
Sbjct: 267 SENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIW-DNQVNVPIKQISDTTQYS 325

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWS 261
           + S D      N   C+ S D T+  + ++    +Y +     + + K  T A Y +   
Sbjct: 326 MPSIDIHPDKKN--FCAQSMDNTIYTYSMKP---KYRR---NPNKMFKGQTSAGYGIGL- 376

Query: 262 PKGYIASTGSDGRLV 276
                 +  +DGR V
Sbjct: 377 ------TFSADGRYV 385

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 6/126 (4%)

Query: 104 IIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI 162
           ++ GH   I  + +     E+LAT S D     W+     + +   S  +  +  VK   
Sbjct: 109 VLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVK--- 165

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           W+     + ++S+ + V +W D        +VL GH G+V S DF   N    + SG +D
Sbjct: 166 WNHKNSNVLATSHSNIVYVW-DVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSG-ND 223

Query: 223 GTVRIW 228
           GTV+ W
Sbjct: 224 GTVKFW 229

>Scas_670.21
          Length = 595

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 105/233 (45%), Gaps = 30/233 (12%)

Query: 5   KLLKSLALHDDK--CWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRS 62
           K +++L+ H D+  C S    NG I+ +GS D  I   D+R      E  +T H + V  
Sbjct: 364 KCVRTLSGHVDRVACLSW---NGHILTSGSRDHNILHRDVRMPDPFFERLNT-HSQEVCG 419

Query: 63  VAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWS-HDG 121
           + W    N LA+G  D+ V ++    DG +        ++  IE H+  +K +AWS H  
Sbjct: 420 LQWNTEENKLASGGNDNVVCVY----DGTS-----RNPMIKFIE-HKAAVKALAWSPHKR 469

Query: 122 ELLAT--CSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-PLLASSSYDDT 178
            +LAT   + D+ + IW  +   +    +S +   SQ V ++IW ++   ++ S  Y   
Sbjct: 470 GILATGGGTVDRRLKIWNVNTSMK----LSDVDTGSQ-VCNMIWSKNTDEIVTSHGYSKY 524

Query: 179 -VRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
            + +W          A+L GH   V         + V   SG+ D T+R W L
Sbjct: 525 HLTLWD--YPTMNPVAILKGHSFRVLHLTLSADGTTV--VSGAGDETLRYWKL 573

>Scas_680.11
          Length = 347

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 69/203 (33%)

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           ++ GHE  +  V ++ +G+LL +CS+D    +W            SV             
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVW-----------YSV------------- 40

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
                                   + E    LNGH GT+WS D +K        +GS D 
Sbjct: 41  ------------------------NGERLGTLNGHAGTIWSIDVDKFTE--YCVTGSADY 74

Query: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIAST-----GSDGRLVI 277
           ++++W +E   GE    W  +S +P      V +V++SP G Y+A+         G + I
Sbjct: 75  SIKMWKVE--TGENVYSW--DSPVP------VKNVSFSPCGNYVAAVLDNVMKYPGSINI 124

Query: 278 Y---KESEDGWIVECIHELTHGV 297
           Y   +  E   I+E + E  H +
Sbjct: 125 YQLKRNPETNEIIEFVEEPIHKI 147

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 108/234 (46%), Gaps = 26/234 (11%)

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166
           GHE  I  V  S++G  +A+CS D+S+ +W+  E G++   +SV   H+  + ++++  +
Sbjct: 177 GHEGSIFYVNLSNNGRYVASCSDDRSIRLWDL-ETGKQ---LSVGWSHTARIWNLMFFDN 232

Query: 167 LPLLASSSYDDTVRIWK--DCDDDWECCAVLNGHE----GTVWSSDFEKSNSNVRLCSGS 220
              L S S D T R+W   +  ++    ++ N +E     ++W  D  K +  + + SG+
Sbjct: 233 DSKLISVSEDCTCRVWNIIESRENVAELSISNVYEVHLIKSIWGVDV-KDDEMIAVTSGN 291

Query: 221 DDGTVRIWCLE-DDNGEYEQEWIQESILPKA-----HTRAVYSVNWSPKGYIASTGSDGR 274
           D     I  L+   +G+ E  +  + I  +         ++    W   G IA T S G+
Sbjct: 292 DGRLKLIDLLQLKRHGDEETSFSLDDIAKQCGDIFEKNESIKGFQWFSFGVIAIT-SLGK 350

Query: 275 LVIYKESEDGWIVECIHE------LTHGVYETNMVKWVEYGSKDVILLITAGDD 322
           ++ Y +    W +   +E      +T+G+   N+   V   +K  ILLI    D
Sbjct: 351 ILKYSDVTKQWKLLLTNEKFNSYPITNGIQTQNIA--VFSNNKSDILLIKFSKD 402

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 103/261 (39%), Gaps = 37/261 (14%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSN-ILAAGSFDSTVSIWGK 86
            A+ S D+ +K+ D  +  II  L   + K T   + + P +   L  G  DS +     
Sbjct: 233 FASSSYDKTVKIWDTETGDIINRL---SFKATPNCMTFHPQNKEQLLVGFSDSKIR---- 285

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
               ++   D +  ++ I + H   I  + +  DG    + S DKS+ IWE +++     
Sbjct: 286 ---HFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWE-NQIN---- 337

Query: 147 CISVLQEHSQDVKHVIWHQSLP---LLASSSYDDTVRIWK-DCDDDWECCAVLNGHEGTV 202
            I + Q    D     W Q  P     A+ S D+++ ++               GH+   
Sbjct: 338 -IPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAG 396

Query: 203 WSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT---RAVYSVN 259
           ++S F+ +     + +G   G + IW           +W    IL +  T     +  V 
Sbjct: 397 YNSMFDIAPDGRYVAAGDTSGRLFIW-----------DWKTTKILRQLETTKGETLKQVA 445

Query: 260 WSPK--GYIASTGSDGRLVIY 278
           WSP+    I  +G  G++ ++
Sbjct: 446 WSPQETSKIICSGKSGKIFLF 466

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 117/310 (37%), Gaps = 74/310 (23%)

Query: 66  RPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLA 125
           R   ++  +G  D  + IW    D Y+     E  LL    GH   I   ++SHD    A
Sbjct: 184 RKTGHLFLSGGNDGVLKIW----DMYH-----ERLLLRDYCGHRKAISATSFSHDNVQFA 234

Query: 126 TCSRDKSVWIWEADEMGEEFECISV------LQEHSQDVKHVIWHQSLPLLASSSYDDTV 179
           + S DK+V IW+  E G+    +S       +  H Q+ + ++   S         D  +
Sbjct: 235 SSSYDKTVKIWDT-ETGDIINRLSFKATPNCMTFHPQNKEQLLVGFS---------DSKI 284

Query: 180 RIWK-DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE------- 231
           R +    D       + + H   + +  +    S  +  S SDD ++RIW  +       
Sbjct: 285 RHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGS--KFISSSDDKSIRIWENQINIPIKQ 342

Query: 232 -DDNGEYEQEWIQ-------------------ESILP--KAHTRAVYS----------VN 259
             D  +Y   WIQ                    S+ P  K H R  +            +
Sbjct: 343 ISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFD 402

Query: 260 WSPKG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLIT 318
            +P G Y+A+  + GRL I+    D    + + +L     ET  +K V +  ++   +I 
Sbjct: 403 IAPDGRYVAAGDTSGRLFIW----DWKTTKILRQLETTKGET--LKQVAWSPQETSKIIC 456

Query: 319 AGDDGHVNVW 328
           +G  G + ++
Sbjct: 457 SGKSGKIFLF 466

>CAGL0K07095g 698028..699143 highly similar to sp|P38328
           Saccharomyces cerevisiae YBR234c AR41, hypothetical
           start
          Length = 371

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 18/151 (11%)

Query: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240
           I++      +  A L  H+  V + D        R+ + S D    +W    D G Y+  
Sbjct: 39  IYRVGGPTPQLVATLANHDKLVTAVDISPHG---RIVTCSQDRNAYVWEPLSD-GSYKPT 94

Query: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRL--VIYKESEDGWIVECIHELTHGVY 298
            +   I      RA  SV+W+P GY  + GS  R+  V Y E E+ W V     +   + 
Sbjct: 95  LVLLRI-----NRAATSVSWAPSGYKFAVGSSARIIAVCYYEHENNWWVS--KHIKKPIK 147

Query: 299 ET-NMVKWVEYGSKDVILLITAGDDGHVNVW 328
            T N + W   G    +LL   G DG++ V+
Sbjct: 148 STINCLSWHTNG----VLLAAGGTDGYMRVF 174

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 98/243 (40%), Gaps = 51/243 (20%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV---- 60
           +L+ +LA HD    +VD++  G + T S DR           + E L D ++K T+    
Sbjct: 48  QLVATLANHDKLVTAVDISPHGRIVTCSQDRNA--------YVWEPLSDGSYKPTLVLLR 99

Query: 61  -----RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEND--LETELLAIIEGHENEIK 113
                 SV+W P     A GS    +++       Y  EN+  +   +   I   ++ I 
Sbjct: 100 INRAATSVSWAPSGYKFAVGSSARIIAVC-----YYEHENNWWVSKHIKKPI---KSTIN 151

Query: 114 CVAWSHDGELLATCSRDKSVWIWE-------------ADEMGEEFECISVLQEHSQD--V 158
           C++W  +G LLA    D  + ++                  G++F   S+++E  Q   +
Sbjct: 152 CLSWHTNGVLLAAGGTDGYMRVFSGFIKGLDSKESVAGSPWGDKFPFGSLVKEWYQGSYI 211

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNG--HEGTVWSSDFEKSNSNVRL 216
             V W  S   +A  ++D  + I  D  + +E     +G   +  VW +D      N  L
Sbjct: 212 HDVKWRSSQEQIAFVTHDAKLNI-VDSQNGYEFTDSPDGLPFKALVWIND------NEIL 264

Query: 217 CSG 219
           C G
Sbjct: 265 CGG 267

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 57/142 (40%), Gaps = 26/142 (18%)

Query: 99  TELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
            +L+A +  H+  +  V  S  G ++ TCS+D++ ++WE    G  ++   VL   ++  
Sbjct: 47  PQLVATLANHDKLVTAVDISPHGRIV-TCSQDRNAYVWEPLSDG-SYKPTLVLLRINRAA 104

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKS-------- 210
             V W  S    A  S   + RI   C  +         HE   W S   K         
Sbjct: 105 TSVSWAPSGYKFAVGS---SARIIAVCYYE---------HENNWWVSKHIKKPIKSTINC 152

Query: 211 ----NSNVRLCSGSDDGTVRIW 228
                + V L +G  DG +R++
Sbjct: 153 LSWHTNGVLLAAGGTDGYMRVF 174

>Kwal_56.22345
          Length = 396

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 80/171 (46%), Gaps = 27/171 (15%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHS-NILAAGSFDSTVSIWG 85
           I  + S D  + + D RS + +++L     K+   ++A+  HS N+ AA   D+ V ++ 
Sbjct: 219 IYGSVSEDSFLMIHDKRSEKPLQKL---LQKEPFNTIAFSKHSSNLFAAAGTDAMVYLF- 274

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSH--DGELLATCSRDKSVWIWEADEMGE 143
                   ++   TE L  + GH+  +  + ++H  DG +L +   D+ V +W+  ++G 
Sbjct: 275 --------DSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILCSGGSDRRVLLWDLFQIGT 325

Query: 144 E----------FECISVLQEHSQDVKHVIWHQSLP-LLASSSYDDTVRIWK 183
           E           E + +   H   +    +  ++P L+AS   ++ V+IWK
Sbjct: 326 EQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASVEEENIVQIWK 376

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 95/225 (42%), Gaps = 22/225 (9%)

Query: 56  HKKTVRSVAWRPH-SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           H+  V    + P  SN++A  S   TV ++ +  D   DEN L  +     E        
Sbjct: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKD---DENALRGKYAYHKENGYGLNFS 168

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           VA    GEL+ +CS D S+ IW+  + G+     SV   HS  V    WH+S P +  S 
Sbjct: 169 VA--SPGELI-SCSDDGSIAIWDI-KSGKTVPT-SVNSLHSDIVNECKWHESDPNIYGSV 223

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDN 234
            +D+  +  D   +     +L        +  F K +SN+   +G+ D  V ++     +
Sbjct: 224 SEDSFLMIHDKRSEKPLQKLLQKEPFNTIA--FSKHSSNLFAAAGT-DAMVYLF-----D 275

Query: 235 GEYEQEWIQESILPKAHTRAVYSVNWS--PKGYIASTGSDGRLVI 277
                E +        H  AV S+ ++    G + S GSD R+++
Sbjct: 276 SRKPTEALHSM---SGHQEAVTSLEFAHHKDGILCSGGSDRRVLL 317

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 83/195 (42%), Gaps = 17/195 (8%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
           + GHE  +  V ++ +G+LL +CS+D S  +W +   GE    +  L  H+  +  +   
Sbjct: 6   LTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLN-GER---LGTLDGHTGTIWSIDVD 61

Query: 165 QSLPLLASSSYDDTVRIW----KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGS 220
                  + S D ++++W      C   W+    +   E +   + F     NV      
Sbjct: 62  CFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVM----K 117

Query: 221 DDGTVRIWCLEDDNGEYEQEWIQESILPKAHTR----AVYSVNWSPKG-YIASTGSDGRL 275
           + G++ I+ +E D+  +E   + E  + K  T     A     WS KG YI +   DG++
Sbjct: 118 NPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKI 177

Query: 276 VIYKESEDGWIVECI 290
             Y  S +   V+ I
Sbjct: 178 SKYDVSNNYEYVDSI 192

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/228 (18%), Positives = 87/228 (38%), Gaps = 37/228 (16%)

Query: 37  IKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGY--NDE 94
           +++ DIR+           H+  V S+A++  +  + + S D T+ +W         N +
Sbjct: 55  VRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYK 114

Query: 95  NDLETELLAIIEGHENEIKC------------------------------VAWSHDGELL 124
           +D     + I       I C                              ++ + DG +L
Sbjct: 115 HDAPVNEVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSML 174

Query: 125 ATCSRDKSVWIWEADEMGE--EFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
              +   + ++W+     +    + ++  + HS+ +  V+    +  LA+ S D T R+W
Sbjct: 175 VAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVW 234

Query: 183 KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
              +D+++    L+ H   VW   F  S  +  L +   D  VR+W L
Sbjct: 235 S-VEDNFQLETTLDAHSRWVWDCAF--SADSAYLVTACSDHYVRLWDL 279

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 55/128 (42%), Gaps = 8/128 (6%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
            EGH   +  +A+  D + + + S D ++ +W+      +        +H   V  V+ H
Sbjct: 71  FEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN-----YKHDAPVNEVVIH 125

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
            +   L S   D  ++IW   ++  +C   L   + T   S    S+ ++ L +G++ G 
Sbjct: 126 PNQGELISCDQDGNIKIWDLGEN--QCTNQLALEDNTALQSLSIASDGSM-LVAGNNKGN 182

Query: 225 VRIWCLED 232
             +W + +
Sbjct: 183 CYVWKMPN 190

>Scas_718.6*
          Length = 546

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 107 GHENEIKCVAWSHDGELLATCS-RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           GH+  I C+ ++ +  LL T S  D S+ IW     G++  C +    HSQ +  + W  
Sbjct: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWH----GQKENCCNCFYGHSQSIISLSWIN 422

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTV 225
              L+ S+S D +VRIW   ++     A+++G+         +K+    +   GS +G +
Sbjct: 423 D-DLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKN----KFAIGSMNGQI 477

Query: 226 RIW 228
            ++
Sbjct: 478 NVY 480

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/280 (19%), Positives = 111/280 (39%), Gaps = 43/280 (15%)

Query: 21  DVNNGGIMATGSTDRKIKLVD--------IRSFQIIEE--LDDTAHKKT--VRSVAWRPH 68
           ++ N  ++A G  D   K+++        I S ++     L     +KT  + +++W P 
Sbjct: 190 NLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPD 249

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
             ++     +  + +W KD             L  +   H + I  + W+ D +   +  
Sbjct: 250 GELIITSVENGELRLWNKDG-----------RLQNVFNFHRSPIVSIKWNEDSKHFISLD 298

Query: 129 RDKSVWIWEADE--MGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCD 186
            D    +W A    + + FE    L+ +++ +   I       L     + ++ ++    
Sbjct: 299 LDNITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVY--SI 356

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNG---EYEQEWIQ 243
           DD +    L GH+GT+   +F   NS + L S   D ++RIW  + +N     Y      
Sbjct: 357 DDNKPIGKLLGHQGTISCIEF-NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFY------ 409

Query: 244 ESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESED 283
                  H++++ S++W     + S   DG + I+   E+
Sbjct: 410 ------GHSQSIISLSWINDDLVISASMDGSVRIWSVVEN 443

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 101/270 (37%), Gaps = 67/270 (24%)

Query: 55  AHKKTVRSVAWRPHS-NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIK 113
            HK    S+ + P + ++L +G  D+ + +W    D Y+     E ELL   EGH   IK
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLW----DFYH-----ERELLRTYEGHSMTIK 183

Query: 114 CVAWSHDGELLATCSRDKSVWIWEADE--------MGEEFECISV--------------- 150
            + ++ +G   A+ S DK V IW  ++              CI+                
Sbjct: 184 DLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNS 243

Query: 151 --------LQEHSQDVKHVIWHQSLPL----------LASSSYDDTVRIWKDCDDDWECC 192
                   L E+  +V+    HQ   L          L SSS D TVRIW++        
Sbjct: 244 EIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWEN-----RIN 298

Query: 193 AVLNGHEGTVWSSD--FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA 250
             +    GT   S    + +      C+ S D T+  + +      +  +        K 
Sbjct: 299 IPIKQISGTAQHSMPWIDINPQGQSFCTQSMDNTIYTYSMLPKYKRHPNKTF------KG 352

Query: 251 HTRAVYSVN--WSPKG-YIASTGSDGRLVI 277
           H    Y ++  +SP G YIAS  S G+  I
Sbjct: 353 HNTTGYGIHFAFSPDGQYIASGDSKGQTFI 382

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 110/296 (37%), Gaps = 59/296 (19%)

Query: 25  GGIMATGSTDRKIKLVDIRSFQIIEELDDT--AHKKTVRSVAWRPHSNILAAGSFDSTVS 82
           G ++ +G  D  IKL D   F    EL  T   H  T++ + +  + +  A+ SFD  V 
Sbjct: 148 GHLLLSGGNDNIIKLWD---FYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWVK 204

Query: 83  IWGKDDD------GYN-----------DENDLETEL---------LAIIEGH-------- 108
           IW  +         +N           D+N L   L         L + E H        
Sbjct: 205 IWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDH 264

Query: 109 -ENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL 167
            +  I  + +  DG+ L + S DK+V IWE + +    + IS   +HS     + W    
Sbjct: 265 HQGSILALKYFPDGKKLISSSEDKTVRIWE-NRINIPIKQISGTAQHS-----MPWIDIN 318

Query: 168 PL---LASSSYDDTVRIWKDCDD-DWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
           P      + S D+T+  +               GH  T +   F  S     + SG   G
Sbjct: 319 PQGQSFCTQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSPDGQYIASGDSKG 378

Query: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK--GYIASTGSDGRLVI 277
              IW       +++   + +   P ++   V  + W+P+    +   G+ G++ I
Sbjct: 379 QTFIW-------DWKTTKLLKKFKPFSNNLPVTCIEWNPQETSKLCCAGNTGKIAI 427

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 86/196 (43%), Gaps = 28/196 (14%)

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           ++ GHE  +  V ++ +G+LL TCS+D S  +W ++      E +  L  H       IW
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNG----ERLGTLDGHMGS----IW 56

Query: 164 -----HQSLPLLASSSYDDTVRIWK----DCDDDWECCAVLNGHEGTVWSSDFEKSNSNV 214
                H SL  +  S+ D T+++W      C   W C   +   E +           NV
Sbjct: 57  SIDSDHTSLYCVTGSA-DYTIKVWTLMNGQCVQTWNCPVPVKRVEFSPCGKYILAILDNV 115

Query: 215 RLCSGSDDGTVRIWCLEDDNGEYE-QEWIQE---SILPKAHTRAVYSVNWSPKG-YIAST 269
                   G++ I+ ++ +    E  E+++E   SI+      A     WS +G YI + 
Sbjct: 116 M----KKPGSIEIYEVKRNPETNEITEFVEEPIHSIVTHEGLDAASVAGWSGEGKYIIAG 171

Query: 270 GSDGRLVIYKESEDGW 285
             DG++  Y +++DG+
Sbjct: 172 HKDGKISKY-DTQDGY 186

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 60/150 (40%), Gaps = 32/150 (21%)

Query: 10  LALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTA------HKKTVRSV 63
           L+   +   SVDV++ G++ATG +D  + +  +R+ + I   +         +  TVR V
Sbjct: 86  LSSEPNFATSVDVSSNGLIATGFSDGSVVVAQLRTLRPIYNFEGFGIQGIEENSSTVRDV 145

Query: 64  AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELL-----AIIEGHENEIKCVAWS 118
            + P   +LA  +          D   Y      ETE         +  H  +    +++
Sbjct: 146 KFSPLGGLLAVAN----------DSGSYGCVTLYETEYGERVGNLTVPTHSAQTSVGSFA 195

Query: 119 HD-----------GELLATCSRDKSVWIWE 137
           HD           GE LA+C  D  V +W+
Sbjct: 196 HDGWVFSLSFNSTGEFLASCGYDSKVRVWD 225

>YBR234C (ARC40) [413] chr2 complement(685395..686549) Component of
           the ARP2/3 actin-organizing complex, involved in actin
           assembly and function [1155 bp, 384 aa]
          Length = 384

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 58/139 (41%), Gaps = 18/139 (12%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           A L  H+ T+ + D        R+ + S D    +W    D G Y+   +   I      
Sbjct: 57  ATLKDHDKTITAVDISIHG---RIVTCSQDRNAYVWEPLSD-GTYKPTLVLLRI-----N 107

Query: 253 RAVYSVNWSPKGYIASTGSDGRL--VIYKESEDGWIVECIHELTHGVYET-NMVKWVEYG 309
           RA  SV W+P GY  + GS  R+  V Y E E+ W V     +   +  T N + W   G
Sbjct: 108 RAATSVTWAPNGYKFAVGSSARIIAVCYYEHENNWWVS--KHIKKPIKSTINCLSWHANG 165

Query: 310 SKDVILLITAGDDGHVNVW 328
               +LL   G DG + V+
Sbjct: 166 ----VLLAAGGTDGFMRVF 180

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 79/202 (39%), Gaps = 42/202 (20%)

Query: 6   LLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV----- 60
           L  +L  HD    +VD++  G + T S DR           + E L D  +K T+     
Sbjct: 55  LFATLKDHDKTITAVDISIHGRIVTCSQDRNA--------YVWEPLSDGTYKPTLVLLRI 106

Query: 61  ----RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEND--LETELLAIIEGHENEIKC 114
                SV W P+    A GS    +++       Y  EN+  +   +   I+   + I C
Sbjct: 107 NRAATSVTWAPNGYKFAVGSSARIIAVCY-----YEHENNWWVSKHIKKPIK---STINC 158

Query: 115 VAWSHDGELLATCSRDKSVWIWE-------------ADEMGEEFECISVLQEHSQD--VK 159
           ++W  +G LLA    D  + ++                  G++F    +++E  Q   + 
Sbjct: 159 LSWHANGVLLAAGGTDGFMRVFSGFIKGLDSKESVAGSPWGQKFPFGCLIREWYQGSYIH 218

Query: 160 HVIWHQSLPLLASSSYDDTVRI 181
            V W   +  +A  ++D T+ +
Sbjct: 219 DVEWRSQMERIAYVAHDGTLNV 240

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 91  YNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISV 150
           Y   N+    L A ++ H+  I  V  S  G ++ TCS+D++ ++WE    G  ++   V
Sbjct: 45  YRVSNNTPPVLFATLKDHDKTITAVDISIHGRIV-TCSQDRNAYVWEPLSDG-TYKPTLV 102

Query: 151 LQEHSQDVKHVIW 163
           L   ++    V W
Sbjct: 103 LLRINRAATSVTW 115

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 111/281 (39%), Gaps = 32/281 (11%)

Query: 5   KLLKSLALHDDKCWSVDV-NNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSV 63
           K L+    H     ++D  ++     +GS D+++K+ D  + ++ + L+  +   T  S 
Sbjct: 183 KCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYS---TPNSA 239

Query: 64  AWRPHS-NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE 122
            +RP S N    G   S +  +    D    E D    L+ + + H + I  + +  DG 
Sbjct: 240 EFRPTSGNEFVVGLSSSKIKHY----DTRVSEKD---GLVQVYDHHLSSILAIKYFPDGS 292

Query: 123 LLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
              + S DK++ IW  +++    + IS   +HS  + ++  H      ++ S D  +  +
Sbjct: 293 KFISSSEDKTLRIWN-NQVNIPIKQISDTTQHS--MPYIGIHPEHNYFSTQSMDSVIYSY 349

Query: 183 K-DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW 241
                          GH    +      S     LCSG   G + +W           +W
Sbjct: 350 SMKPKYKMHPNKKFKGHNSAGYGIGLTFSPDGRFLCSGDARGQLFLW-----------DW 398

Query: 242 IQESIL--PKAHTRA-VYSVNWSPK--GYIASTGSDGRLVI 277
                L   K  T++ +  V+W PK    +  +G DGR+ +
Sbjct: 399 NTNRKLCDLKLPTKSPITQVSWHPKETSKVICSGPDGRIFV 439

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 38/87 (43%), Gaps = 4/87 (4%)

Query: 97  LETELLAIIEGHENEIKCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS 155
           L  +++   +GH N    +      G L+ +   D +V +W+      + +C+     HS
Sbjct: 136 LPKKVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWD---FYHDRKCLRDFVGHS 192

Query: 156 QDVKHVIWHQSLPLLASSSYDDTVRIW 182
           + +K + +        S SYD  V+IW
Sbjct: 193 KPIKTLDFTSDSSQFLSGSYDQQVKIW 219

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 17/143 (11%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK----------DDDGYNDEND---LETE 100
           T H++ V    + P  ++LA    D  + +W K          DDD + D  +   +  +
Sbjct: 68  TQHEQAVNVARFNPSGDVLATAGDDGLLLLWKKNDTIVKEFGIDDDEFADFKESWCVVEK 127

Query: 101 LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKH 160
           L  +     +EI  +AWS   + + T   D  V I++  E      C++ + EH+  V+ 
Sbjct: 128 LRTVSTIGTSEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEK----TCVAHVVEHNHYVQG 183

Query: 161 VIWHQSLPLLASSSYDDTVRIWK 183
           V+W      + S S D +V I+K
Sbjct: 184 VVWDPQNEYIISQSADRSVHIYK 206

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 80/202 (39%), Gaps = 35/202 (17%)

Query: 58  KTVRSVAWRPH-------SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHEN 110
           + + S++++P          ++ AG  D+   +W  + D          + L+ +  HE 
Sbjct: 14  QPIYSISFQPSLPGSSGAPRLVTAGG-DNKARVWQLNFDSERPGKVDSIDFLSSLTQHEQ 72

Query: 111 EIKCVAWSHDGELLATCSRDKSVWIWEAD-----EMG---EEFE------CI-----SVL 151
            +    ++  G++LAT   D  + +W+ +     E G   +EF       C+     +V 
Sbjct: 73  AVNVARFNPSGDVLATAGDDGLLLLWKKNDTIVKEFGIDDDEFADFKESWCVVEKLRTVS 132

Query: 152 QEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGH--EGTVWSSDFEK 209
              + ++  + W      + +   D+ VRI+   +       V + H  +G VW      
Sbjct: 133 TIGTSEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEKTCVAHVVEHNHYVQGVVWDPQ--- 189

Query: 210 SNSNVRLCSGSDDGTVRIWCLE 231
              N  + S S D +V I+ +E
Sbjct: 190 ---NEYIISQSADRSVHIYKIE 208

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/276 (20%), Positives = 95/276 (34%), Gaps = 79/276 (28%)

Query: 63  VAWRP-HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELL----------AIIEGHENE 111
           + W P  SNILA G  DST  +   +    +D+  L  + +          A      N+
Sbjct: 165 LQWNPVSSNILAIGEHDSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQ 224

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
           + C++W+HDG+ +AT   +  + +W      +E +  +V   H   +  + W+ S     
Sbjct: 225 LTCLSWAHDGDSIATGVENGELRLW-----NKEGKLQNVFNFHKSPIIAIHWNSSNTHFI 279

Query: 172 SSSYDDTV------------------------------------RIWKDCD--------- 186
           S+  D+                                       +W D D         
Sbjct: 280 STDADNITILWDVNSGVVLQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGG 339

Query: 187 -------DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
                   D      L GH GT+  S  E ++    L S +DD T+R+W   + N  +  
Sbjct: 340 NLLVYTMSDSRPIGKLVGHRGTI--SQLEFNSETKLLASAADDNTIRVWHGGNGNSIH-- 395

Query: 240 EWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRL 275
                      HT+ + S+ W     + S   DG +
Sbjct: 396 -------CFYGHTQTIVSLKWVNNDMLISASMDGSV 424

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF 207
           I  L  H   +  + ++    LLAS++ D+T+R+W   + +   C    GH  T+ S   
Sbjct: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHC--FYGHTQTIVSL-- 407

Query: 208 EKSNSNVRLCSGSDDGTVRIW 228
            K  +N  L S S DG+V++W
Sbjct: 408 -KWVNNDMLISASMDGSVKLW 427

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 107 GHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQS 166
           GH   I  + ++ + +LLA+ + D ++ +W     G    C      H+Q +  + W  +
Sbjct: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGN-GNSIHC---FYGHTQTIVSLKWVNN 412

Query: 167 LPLLASSSYDDTVRIWKDC 185
             +L S+S D +V++W DC
Sbjct: 413 -DMLISASMDGSVKLW-DC 429

 Score = 31.6 bits (70), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 55/126 (43%), Gaps = 20/126 (15%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
            H+ T+  + +   + +LA+ + D+T+ +W     G N  +      +    GH   I  
Sbjct: 357 GHRGTISQLEFNSETKLLASAADDNTIRVW----HGGNGNS------IHCFYGHTQTIVS 406

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSS 174
           + W ++ ++L + S D SV +W         +C   LQE + ++        +P+ A + 
Sbjct: 407 LKWVNN-DMLISASMDGSVKLW---------DCGKKLQEITGNLIAETIVDGVPIFAGAI 456

Query: 175 YDDTVR 180
            DD  R
Sbjct: 457 SDDRER 462

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA 250
           C  + +GHEG + +   + +   + L +GSDDG+VRIW +      Y  + + +   P+ 
Sbjct: 428 CSTIYSGHEGKIRTLSIDPTG--IWLATGSDDGSVRIWEILTGREVYRVQLVNKEDNPED 485

Query: 251 HTRAVYSVNWSPKGYIA 267
           +   ++SV W+P G + 
Sbjct: 486 N---IHSVEWNPDGSVG 499

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 103 AIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
            I  GHE +I+ ++    G  LAT S D SV IWE
Sbjct: 430 TIYSGHEGKIRTLSIDPTGIWLATGSDDGSVRIWE 464

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 96/236 (40%), Gaps = 33/236 (13%)

Query: 102 LAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV 161
           +  ++GH N++    WS D   + + S+D  + +W+A   G +   I +   HSQ V   
Sbjct: 120 VTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA-ATGLKSNAIPL---HSQWVLSC 175

Query: 162 IWHQSLPLLASSSYDDTVRIWKDCDDD---WECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
               +  L+AS+  D+   I++    D       ++  GH   +   +F   NS   + +
Sbjct: 176 AICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDNS---ILT 232

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK------GYIASTGSD 272
            S D T  +W +       + + I E      H   V S++ +P          AS GSD
Sbjct: 233 ASGDMTCALWDIT------KSKRINEF---ADHLGDVLSLSAAPTETEGNGNVFASGGSD 283

Query: 273 GRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           G L I+    D  +   +        + + VK+   G+     + T  DDG  N++
Sbjct: 284 GYLYIW----DKRVPTSVQSFFVSDSDVSKVKFFRNGNT----IATGSDDGCTNLY 331

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
           ++ E++  ++GH + I  VA S DG  + T S D ++ +W    M
Sbjct: 423 VKGEIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVWSPAYM 467

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 77/187 (41%), Gaps = 27/187 (14%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H + V S A  P+ N++A+   D+  +I+       + ++ ++  +++I +GH   I  +
Sbjct: 168 HSQWVLSCAICPNGNLVASAGLDNNCTIYR-----VSRKDRIQQNIVSIFKGHTCYISEI 222

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLP------- 168
            +  D  +L T S D +  +W+  +          + E +  +  V+   + P       
Sbjct: 223 EFLDDNSIL-TASGDMTCALWDITKSKR-------INEFADHLGDVLSLSAAPTETEGNG 274

Query: 169 -LLASSSYDDTVRIW-KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVR 226
            + AS   D  + IW K      +   V +     V    F   N+   + +GSDDG   
Sbjct: 275 NVFASGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKV--KFFRNGNT---IATGSDDGCTN 329

Query: 227 IWCLEDD 233
           ++ L  D
Sbjct: 330 LYDLRSD 336

>Scas_692.25
          Length = 488

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 115/291 (39%), Gaps = 71/291 (24%)

Query: 25  GGIMATGSTDRKIKLV----DIRSFQIIEELDDTAHKKTVRSVA-WRPHSNI-LAAGSFD 78
             I+AT S D  IKL         F +   L +  H+  V  V  +R  +NI LA+ S D
Sbjct: 201 SAIIATSSKDLSIKLFRWSAKENKFLLFRVLMN--HEHIVSEVKLFRKLNNIYLASCSRD 258

Query: 79  STVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWI--W 136
           +++ IW  +D            +L     H   ++C+  S  G+ + + S+D S+ +  W
Sbjct: 259 TSIRIWTAEDGM----------ILNSFHPHNEWVRCLDVS--GDFVLSGSQDASLRLTHW 306

Query: 137 EADE-----MGEEF--ECISVLQEHSQDVK--HVIWHQSLPL-------------LASSS 174
            +       +G EF  E +  +   S + K    I +   PL              AS+S
Sbjct: 307 PSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASAS 366

Query: 175 YDDTVRIWK---------------DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSG 219
            D  ++IW+                 + +++C   L GH    W  D     + +  CS 
Sbjct: 367 RDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHAS--WVKDLRIRGNYLFSCS- 423

Query: 220 SDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTG 270
            DD T+R W LE  NGE  ++W         H+  V  ++  P G    TG
Sbjct: 424 -DDKTIRCWNLE--NGECVKQWTD------LHSGFVTCLDMDPDGGTNDTG 465

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 25/129 (19%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDT-AHKKTVRSV----------AWRPHSNILAAG 75
           I+  G+ + K+   DI ++ +   LD T AH K + S+               S I+A  
Sbjct: 150 IIFIGTDNGKLYAYDIFNYSL--PLDSTQAHIKGITSIDAIMEFKNNNKTEEPSAIIATS 207

Query: 76  SFDSTVSI--WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH--DGELLATCSRDK 131
           S D ++ +  W   ++ +         L  ++  HE+ +  V      +   LA+CSRD 
Sbjct: 208 SKDLSIKLFRWSAKENKF--------LLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDT 259

Query: 132 SVWIWEADE 140
           S+ IW A++
Sbjct: 260 SIRIWTAED 268

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 57/125 (45%), Gaps = 14/125 (11%)

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
           + ++A G+   T+++W   D  ++        +   ++GH  E+ CV +    +++ + S
Sbjct: 24  TKVVAYGA-GKTIALWKSMDTSHHG-------VFKTLKGHTAEVTCVRFVKGTDMMVSAS 75

Query: 129 RDKSVWIWEADEMGE----EFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKD 184
            D  V +W   ++ E    E ECI V++ H   +   ++     LL     D ++ +W  
Sbjct: 76  EDFEVRVWNFPKLREGHMDEVECIQVIKHHKHTI--TVFAVLKNLLVVGCADGSISVWSF 133

Query: 185 CDDDW 189
            +D +
Sbjct: 134 IEDQY 138

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 12/125 (9%)

Query: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCD---- 186
           K++ +W++ +          L+ H+ +V  V + +   ++ S+S D  VR+W        
Sbjct: 33  KTIALWKSMDTSHH-GVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREG 91

Query: 187 --DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEW-IQ 243
             D+ EC  V+  H+ T+      K+     L  G  DG++ +W   +D    ++E+ +Q
Sbjct: 92  HMDEVECIQVIKHHKHTITVFAVLKN----LLVVGCADGSISVWSFIEDQYVLQEEFSVQ 147

Query: 244 ESILP 248
           + + P
Sbjct: 148 KGVFP 152

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 90/254 (35%), Gaps = 68/254 (26%)

Query: 55  AHKKTVRSVAWR---PHSNILAAGSFDSTVSIWG-----KDDDGYNDENDL--------- 97
            H+  ++S+ +R   P   +LA+GS D  + +W      K D    DE  L         
Sbjct: 199 GHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYK 258

Query: 98  ---------ETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECI 148
                         A+I GH++ I  + W      L T + D +V +WE D +   + C 
Sbjct: 259 FDISADVHVAINFEALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICS 318

Query: 149 SVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD-F 207
           S L E S                                  +  +   G  G  WS   F
Sbjct: 319 SRLGELSS---------------------------------KGASTATGSSGGFWSCIWF 345

Query: 208 EKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YI 266
                +V L +G   G+ RIW   D        W QE  +  A T++V  V WS  G Y+
Sbjct: 346 THDGKDVILTNGK-TGSWRIWTSTDG-----LLWDQELGITGA-TKSVTDVAWSIDGNYL 398

Query: 267 ASTGSDGRLVIYKE 280
            ST  D    ++ E
Sbjct: 399 LSTSLDQTTRLFAE 412

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 57/140 (40%), Gaps = 16/140 (11%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQE-HSQDV 158
           +L  ++  H   I  + +S D   L + SRD+   +WE +     F   S  ++ HS+  
Sbjct: 598 QLPQVLPFHNLTITKLRFSKDNRYLLSVSRDRLWSLWERNFDNNSFVLRSFKEKPHSR-- 655

Query: 159 KHVIWHQS-LPL-----LASSSYDDTVRIWKDCDDDWECCAVLN-----GHEGTVWSSDF 207
             +IW    +PL       ++S D T++ W+   +D      L          T  S   
Sbjct: 656 --IIWDADWVPLAKGLAFITASRDKTLKFWRLSKEDEATSVELENSIRFSEPVTSISVHK 713

Query: 208 EKSNSNVRLCSGSDDGTVRI 227
           +  N  V L  G + G +RI
Sbjct: 714 DLYNEKVLLAVGFESGAIRI 733

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 62/146 (42%), Gaps = 13/146 (8%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKS-----VWIWEADEMGEEFECISVLQEHSQDVK 159
           + GH  EI C+  S D +L+AT  +  +     + +++A+      +   VL  H+  + 
Sbjct: 555 LYGHGYEISCIDVSPDRKLIATACKSNNAQHAVIRLFDAENWN---QLPQVLPFHNLTIT 611

Query: 160 HVIWHQSLPLLASSSYDDTVRIW-KDCDDDWECCAVL--NGHEGTVWSSDFEKSNSNVRL 216
            + + +    L S S D    +W ++ D++           H   +W +D+      +  
Sbjct: 612 KLRFSKDNRYLLSVSRDRLWSLWERNFDNNSFVLRSFKEKPHSRIIWDADWVPLAKGLAF 671

Query: 217 CSGSDDGTVRIWCL--EDDNGEYEQE 240
            + S D T++ W L  ED+    E E
Sbjct: 672 ITASRDKTLKFWRLSKEDEATSVELE 697

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 84/199 (42%), Gaps = 20/199 (10%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           E H+ E+  +++  DG  LA+ + D +V IW+  +  +    I   + H   VK + WH 
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDP---IWTKRNHKAAVKAISWHP 386

Query: 166 SLP-LLAS--SSYDDTVRIWKDCDDDW-----ECCAVLNGHEGTVWSSDFEKSNSNVRLC 217
            +  LLA+   S D  +  W     +          V + H G  +S      ++ +   
Sbjct: 387 EITNLLATGGGSLDKHIHFWNTTTGNRLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVAT 446

Query: 218 SGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLV 276
            G+ +  + I+  E    +++   IQ+     AH   + S   SP G  IAS G D  L 
Sbjct: 447 GGTPNNCITIYNYET---KFKVAEIQQ-----AHDSRIVSSQLSPDGTTIASVGGDENLK 498

Query: 277 IYKESEDGWIVECIHELTH 295
            Y+  E+    + + + TH
Sbjct: 499 FYRVFEERRKRKYLDDRTH 517

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 82/196 (41%), Gaps = 34/196 (17%)

Query: 70  NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSR 129
           N+LA  + D+++ +W    DG + + +L  EL A           + WS D   ++    
Sbjct: 222 NVLAI-ALDNSIYLW----DGESGDVNLLVELKATCT-------SLTWSDDSCHISIGKN 269

Query: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYD---DTVRIWKDCD 186
           D +V IW+A+ M       S L      +    W  +L +  S S +   + VRI     
Sbjct: 270 DGNVEIWDAETMTHVRTMRSGL---GVRIGSQSWLDTLCVTGSKSGEIQINDVRIKNHVV 326

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESI 246
             WE       H+G V    F +    ++L SG++D TV IW    +N      W +   
Sbjct: 327 QTWE------RHQGEVCGLSFRE--DGIQLASGANDNTVMIWDTRQNNDPI---WTK--- 372

Query: 247 LPKAHTRAVYSVNWSP 262
             + H  AV +++W P
Sbjct: 373 --RNHKAAVKAISWHP 386

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 98/223 (43%), Gaps = 16/223 (7%)

Query: 26  GIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSN---ILAAGSFDSTVS 82
            I+AT + + KI + D RS   +E L  T    T        ++N    L +GS DS ++
Sbjct: 147 NIIATINGEGKIFIYD-RSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205

Query: 83  IWGKDDDGYNDENDLETELLAIIEGHENEIKCVAW-SHDGELLATCSRDKSVWIWEADEM 141
           +W    D  N E +++  +    + H + I  V W S +  +  + S D ++ +++    
Sbjct: 206 LW----DISNFEKNIKPTI-TFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDK--- 257

Query: 142 GEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGT 201
               + I  +              S  L A++  D+ V ++ D  D       + GHE  
Sbjct: 258 -RSSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLY-DIRDVSNPLYAMTGHEDA 315

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244
           V + +F+ +N  +   SGSD  T+ +W L++   E  Q+ I++
Sbjct: 316 VTAIEFDPNNDGILYSSGSDRRTI-VWDLQEIGAEQTQDEIED 357

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 15/93 (16%)

Query: 7   LKSLALHDDKCWSV--DVNNGGIMATGSTDRKI---KLVDIRSFQIIEELDD-------- 53
           L ++  H+D   ++  D NN GI+ +  +DR+     L +I + Q  +E++D        
Sbjct: 306 LYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMI 365

Query: 54  -TAHKKTVRSVAWRPHSN-ILAAGSFDSTVSIW 84
              HK ++  +A  P+ N ++A+   D+ V IW
Sbjct: 366 HAGHKTSINDIAVNPNINWLVASAEEDNIVQIW 398

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 99/263 (37%), Gaps = 82/263 (31%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMG----------EEF---- 145
           +L A + GH  +++ V  S     +A+ SRD +V IW  D  G          E+F    
Sbjct: 3   QLSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSL 61

Query: 146 -----ECI--------------SVLQEHSQDVKHVIWHQS--------LPLLASSSYDDT 178
                +C+               +L    + V  ++ H+            L SSS+D T
Sbjct: 62  TYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKT 121

Query: 179 VRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW---------- 228
            ++W +    WE    L GH  +VW +      S   + + S D TV++W          
Sbjct: 122 AKVWTNGIVKWE----LKGHSASVWDAKLLNDGS---VLTASADTTVKLWKNGTLAKTFD 174

Query: 229 ----------CLEDD---------NGEYEQEWIQESILPK--AHTRAVYSVNWSPKGYIA 267
                     C+ DD         +G  +   ++  IL +   H   VY+V   P G I 
Sbjct: 175 KLHSDVVRNICILDDGKHFVSCSNDGTLKLSNLEGGILHEFIGHESFVYAVKQLPSGDIV 234

Query: 268 STGSDGRLVIYKESEDGWIVECI 290
           S G D  + I+  + DG I + I
Sbjct: 235 SCGEDRTVRIW--NMDGTIKQVI 255

 Score = 35.0 bits (79), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 145 FECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK-DCDDDWE 190
           ++  + L+ H+QDV+ V+   S   +AS+S D TVRIW  D D +WE
Sbjct: 2   YQLSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWE 47

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 108/273 (39%), Gaps = 45/273 (16%)

Query: 13  HDDKCWSVDVNNGGIMATGSTDRKIKL----VDIRSFQIIEELDDTAHKKTVRSVAWRPH 68
           H    W   + N G + T S D  +KL       ++F       D  H   VR++     
Sbjct: 137 HSASVWDAKLLNDGSVLTASADTTVKLWKNGTLAKTF-------DKLHSDVVRNICILDD 189

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCS 128
                + S D T+ +           ++LE  +L    GHE+ +  V     G+++ +C 
Sbjct: 190 GKHFVSCSNDGTLKL-----------SNLEGGILHEFIGHESFVYAVKQLPSGDIV-SCG 237

Query: 129 RDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL--LASSSYDDTVRIWKDCD 186
            D++V IW  D   ++   +  +   + DV        LP   +   S D  +RI+ + +
Sbjct: 238 EDRTVRIWNMDGTIKQVITLPAISIWTVDV--------LPNGDIVVGSSDKIIRIFTENE 289

Query: 187 DDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWI---Q 243
                  + +  E T      E+S  N +   G D+  ++   +    GE E + +    
Sbjct: 290 Q-----RLASQEEITSLQKQVEESAVNAQ-TMGFDESKLKPSSVLQKPGEKEGQIVVVKN 343

Query: 244 ESILPKAHTRAVYSVNWSPKG-YIASTGSDGRL 275
           E+ + +AH     S  WS  G  ++S GSD ++
Sbjct: 344 ENGVIEAHQFTGGS--WSKVGDVVSSAGSDNKV 374

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
           ++  A L GH   V S     S S  ++ S S DGTVRIW L+ D
Sbjct: 2   YQLSAQLRGHTQDVRSV---VSLSTTQVASASRDGTVRIWNLDAD 43

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 111/270 (41%), Gaps = 68/270 (25%)

Query: 100 ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADE---------MGEEF----- 145
           +L A ++GHE ++K V   +D ++ A+CSRD +V +W  ++           E+F     
Sbjct: 3   KLSADLKGHEQDVKSVVAINDSQV-ASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLC 61

Query: 146 -----------------ECISVLQEHSQD-VKHVIWHQ----SLP----LLASSSYDDTV 179
                              IS L    +D V  +I H+    SL      + SSS+D T 
Sbjct: 62  YDKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTA 121

Query: 180 RIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
           ++W +    ++    L GH  +VW + F          + S D T+++W        +  
Sbjct: 122 KVWHNGSAIYD----LVGHSASVWDAKFLPEKD--FFLTASADCTIKLW--------HGN 167

Query: 240 EWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVIYKESEDGWIVECIHELTHGVY 298
           + I+       H   +  ++ SP G   AS  +DG + I     DG I++        VY
Sbjct: 168 KLIKT--FSGIHKDVIRHLDISPDGETFASCSNDGTVKI--NDMDGNILKTFTGHESFVY 223

Query: 299 ETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
               VK++  G      L++ G+D  V VW
Sbjct: 224 S---VKFLPNGD-----LVSCGEDRSVRVW 245

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 73/184 (39%), Gaps = 29/184 (15%)

Query: 52  DDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEG-HEN 110
           D   H  +V    + P  +     S D T+ +W  +            +L+    G H++
Sbjct: 132 DLVGHSASVWDAKFLPEKDFFLTASADCTIKLWHGN------------KLIKTFSGIHKD 179

Query: 111 EIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL- 169
            I+ +  S DGE  A+CS D +V I + D         ++L+  +     V   + LP  
Sbjct: 180 VIRHLDISPDGETFASCSNDGTVKINDMDG--------NILKTFTGHESFVYSVKFLPNG 231

Query: 170 -LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            L S   D +VR+W           VL     ++W  D      N  +  GS D  VRI+
Sbjct: 232 DLVSCGEDRSVRVWSKTG---AVKQVLRLPAVSIWDLDILP---NGDILVGSSDNMVRIF 285

Query: 229 CLED 232
            +E+
Sbjct: 286 TVEE 289

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 10/130 (7%)

Query: 106 EGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVL--QEHSQDVKHVIW 163
           EGH +EI  VA S DG+ + T  RDK + +W      E    + V+  ++   +V  + +
Sbjct: 252 EGHYDEILTVAASPDGKYVVTGGRDKKLIVWST----ESLAPVKVIPTKDRRGEVLGLAF 307

Query: 164 HQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDG 223
            ++   L ++  D  +R +    + +    VL GH+  V  +D    N    +  GS D 
Sbjct: 308 RRNTDQLYAACADYKIRTF--AINQFSQLEVLYGHQDIV--ADISALNMERCVTVGSRDR 363

Query: 224 TVRIWCLEDD 233
           T  +W + D+
Sbjct: 364 TCMLWKIADE 373

>KLLA0E23617g 2095246..2096499 similar to sp|P13712 Saccharomyces
           cerevisiae YBR195c MSI1 chromatin assembly complex,
           subunit p50, start by similarity
          Length = 417

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 17/171 (9%)

Query: 22  VNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSN-ILAAGSFDST 80
           VN+  I+A+      I L+DIR    ++ L  T H   + ++ +   ++ IL  G     
Sbjct: 246 VNHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQ 305

Query: 81  VSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD-GELLATCSRDKS-VWIWEA 138
           + IW        D  D +  +     G ++ I  + W+    ++LAT  +    V IW+A
Sbjct: 306 LKIW--------DIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDA 357

Query: 139 -----DEMGEEFECISVLQEHSQDVKHVIWHQSLP-LLASSSYDDTVRIWK 183
                D   E    + V   H   V  + W Q  P  + S S D+++ IWK
Sbjct: 358 SGEQEDSNAENNMLLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWK 408

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 73/175 (41%), Gaps = 13/175 (7%)

Query: 68  HSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEG--HENEIKCVAWSHDGE-LL 124
           + +I+   S + +V I+ +   G       + E+     G   ++E   +AW++  E  L
Sbjct: 142 NPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQLEGTL 201

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHS-------QDVKHVIWHQSLPLLASSSYDD 177
           ATC  +  V +W+  +  +  + + + +  S        DV  ++ H S+  LAS    +
Sbjct: 202 ATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSI--LASCGESN 259

Query: 178 TVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232
            + +     D          H   + + +F   N  + LC+G   G ++IW + D
Sbjct: 260 VIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMI-LCTGDSQGQLKIWDIRD 313

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 18/132 (13%)

Query: 55  AHKKTVRSVAWRPHSN---ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENE 111
           AH K V S+A     N   +++  S D    IW   D+          +LL  +  HE+ 
Sbjct: 161 AHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNA-------AFQLLRTLSSHEHI 213

Query: 112 IK--CVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPL 169
           +   C   S    LLATCSRD +V +W+     +   CI   Q H+Q V+ +  H     
Sbjct: 214 VSQSCFLRSGSDLLLATCSRDLTVKVWDT----KSGWCIKSFQPHNQWVRTLELHGD--Y 267

Query: 170 LASSSYDDTVRI 181
           + + S D T+R+
Sbjct: 268 VITGSNDATIRL 279

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 169 LLASSSYDDTVRIWKDCDDD-WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
           L++++S D   +IW   D+  ++    L+ HE  V  S F +S S++ L + S D TV++
Sbjct: 180 LISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKV 239

Query: 228 W 228
           W
Sbjct: 240 W 240

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 18/159 (11%)

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
            A GS D T+ IW          N    +L   ++ H+  ++ +A S+    + + S DK
Sbjct: 131 FATGSNDKTIKIW----------NLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDK 180

Query: 132 SVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWEC 191
           +V  W+     E+   I     H   V  V  H ++ ++ ++  D  V++W D       
Sbjct: 181 TVKCWDL----EKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVW-DIRTRLPV 235

Query: 192 CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
              L GH+G +  +       + ++ S S D ++R+W L
Sbjct: 236 MT-LPGHKGPI--TKVRCLPVDPQVISSSVDASIRLWDL 271

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 91/232 (39%), Gaps = 25/232 (10%)

Query: 16  KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAG 75
           +C ++D  +    ATGS D+ IK+ ++ S ++   L   AH  TVR +A       + + 
Sbjct: 119 RCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLK--AHDMTVRDLAISNRHPYMFSV 176

Query: 76  SFDSTVSIWGKDDDGYNDENDLETEL-LAIIEGHENEIKCVAWSHDGELLATCSRDKSVW 134
           S D TV  W           DLE    +    GH + +  V      +++ T  RD  V 
Sbjct: 177 SEDKTVKCW-----------DLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVK 225

Query: 135 IWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAV 194
           +W+          +  L  H   +  V      P + SSS D ++R+W       +   V
Sbjct: 226 VWDI----RTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAG--KSMKV 279

Query: 195 LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESI 246
           L  H+ TV   D     S     S   +  +R W L    GE    ++ + +
Sbjct: 280 LTHHQRTV--RDISVHPSEFSFASACTND-IRSWLLP--KGELLTNFVSQDL 326

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 55/131 (41%), Gaps = 13/131 (9%)

Query: 101 LLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVK 159
           L  +I GH   ++C+A    D E  AT S DK++ IW         +    L+ H   V+
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNL----ASGKLKVTLKAHDMTVR 162

Query: 160 HVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLN--GHEGTVWSSDFEKSNSNVRLC 217
            +      P + S S D TV+ W    D  +  A+ N  GH   V + D   +   V   
Sbjct: 163 DLAISNRHPYMFSVSEDKTVKCW----DLEKNTAIRNYHGHLSGVHTVDIHPTVDVV--V 216

Query: 218 SGSDDGTVRIW 228
           +   D  V++W
Sbjct: 217 TAGRDSVVKVW 227

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 17/140 (12%)

Query: 189 WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILP 248
           W    V++GH G V     +K + N    +GS+D T++IW L   +G+ +       +  
Sbjct: 105 WHLTRVIHGHHGWVRCIAMDKVD-NEWFATGSNDKTIKIWNLA--SGKLK-------VTL 154

Query: 249 KAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEY 308
           KAH   V  +  S +     + S+ + V   + E    +   H    GV+  ++     +
Sbjct: 155 KAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDI-----H 209

Query: 309 GSKDVILLITAGDDGHVNVW 328
            + DV+  +TAG D  V VW
Sbjct: 210 PTVDVV--VTAGRDSVVKVW 227

>Sklu_2133.4 YBR234C, Contig c2133 6409-7530
          Length = 373

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 70/169 (41%), Gaps = 19/169 (11%)

Query: 163 WHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
           + Q   LLA + YD    +++      +  A L  H+ TV + D        R+ + S D
Sbjct: 20  YSQDRTLLAIT-YDTDCLVYRISGGKPQLVATLPDHDKTVTAVDISIHG---RIVTCSQD 75

Query: 223 GTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRL--VIYKE 280
               +W    D G Y+   +   I      RA   V W+  GY  + GS  R+  V Y E
Sbjct: 76  RNAIVWEPLSD-GTYKPTLVLLRI-----NRAATCVKWAGNGYKFAVGSSARIIAVCYYE 129

Query: 281 SEDGWIVECIHELTHGVYET-NMVKWVEYGSKDVILLITAGDDGHVNVW 328
            E+ W V     +   +  T N + W + G    +LL   G DG+V V+
Sbjct: 130 RENDWWVS--KHVKKPIRSTINCIDWHQNG----VLLAAGGTDGYVRVF 172

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 42/203 (20%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV---- 60
           +L+ +L  HD    +VD++  G + T S DR           + E L D  +K T+    
Sbjct: 46  QLVATLPDHDKTVTAVDISIHGRIVTCSQDRNA--------IVWEPLSDGTYKPTLVLLR 97

Query: 61  -----RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDEND--LETELLAIIEGHENEIK 113
                  V W  +    A GS    +++       Y  END  +   +   I    + I 
Sbjct: 98  INRAATCVKWAGNGYKFAVGSSARIIAVC-----YYERENDWWVSKHVKKPI---RSTIN 149

Query: 114 CVAWSHDGELLATCSRDKSVWIWE-------------ADEMGEEFECISVLQEHSQD--V 158
           C+ W  +G LLA    D  V ++                  GE+F   S+L+E+ Q   +
Sbjct: 150 CIDWHQNGVLLAAGGTDGYVRVFSGFIKGLDTKEQVAGSPWGEKFPFGSLLREYYQGSWI 209

Query: 159 KHVIWHQSLPLLASSSYDDTVRI 181
             V W  S+  LA  ++D ++ I
Sbjct: 210 HDVKWRSSIEKLAYVAHDASLTI 232

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 98  ETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
           + +L+A +  H+  +  V  S  G ++ TCS+D++  +WE    G  ++   VL   ++ 
Sbjct: 44  KPQLVATLPDHDKTVTAVDISIHGRIV-TCSQDRNAIVWEPLSDG-TYKPTLVLLRINRA 101

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDC-----DDDWECCAVLNGHEGTVWSSDFEKSNS 212
              V W  +    A  S   + RI   C     +D W    V      T+   D+ +  +
Sbjct: 102 ATCVKWAGNGYKFAVGS---SARIIAVCYYERENDWWVSKHVKKPIRSTINCIDWHQ--N 156

Query: 213 NVRLCSGSDDGTVRIW 228
            V L +G  DG VR++
Sbjct: 157 GVLLAAGGTDGYVRVF 172

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 92/211 (43%), Gaps = 21/211 (9%)

Query: 30  TGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDD 89
           T ST  ++++   R+ Q+I+    +  K  V S ++R    +L AG     VS++    D
Sbjct: 58  TSST--RVQIFSSRTRQVIKTF--SRFKDVVYSASFRSDGKLLCAGDATGLVSVY----D 109

Query: 90  GYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECIS 149
            YN      T LL+I             + D ++LAT S D+   +W   ++   +E   
Sbjct: 110 SYNPR----TILLSINASTHPTHVTKFHTQDNKILATASDDRVTRLW---DISNAYEPQL 162

Query: 150 VLQEHSQDVKHVIWHQSLP-LLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFE 208
            L   +  V+ + +  + P L+A+ SYD  +R++            LN H+  V  +   
Sbjct: 163 ELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLN-HDQPV-ENVIA 220

Query: 209 KSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQ 239
            S + +  C G++    ++W L  +   YE+
Sbjct: 221 VSPTQIVSCGGNN---FKVWDLTSNKKLYER 248

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 100/238 (42%), Gaps = 20/238 (8%)

Query: 94  ENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQE 153
           +N +  +   +++GH N+I    WS D + + + S+D  + IW++    ++    + +  
Sbjct: 77  KNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQ----NAIPL 132

Query: 154 HSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD---WECCAVLNGHEGTVWSSDFEKS 210
            SQ V       S  L+AS+  ++   I++   ++       ++  GH  T + SD E +
Sbjct: 133 DSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGH--TCYISDIEFT 190

Query: 211 NSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTG 270
           + N  + + S D T  +W +       E       +L  A      S N S     AS G
Sbjct: 191 D-NAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSS--NTFASCG 247

Query: 271 SDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
           SDG   I+    D      +        + N +++     KD + ++   D+G +N++
Sbjct: 248 SDGYTYIW----DSRSPSAVQSFYVNDSDINALRFF----KDGMSIVAGSDNGAINMY 297

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 84/204 (41%), Gaps = 40/204 (19%)

Query: 53  DTAHKKTVRSVAWR-PHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENE 111
           D+AH+  V  + +  P   + +AG  D T+ +W          N  + + +A I GH   
Sbjct: 407 DSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVW----------NLSKNKHVASITGHLAT 456

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWEA------DEMGEEFECISVLQEHSQDVKHVIWHQ 165
           + C+       L+ T  RD  + +W+       D +  +  CI     H  ++  + +  
Sbjct: 457 VSCMQMDQYNTLI-TGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEA 515

Query: 166 SLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGT-------VWSSDFEKSNS------ 212
           +   L S S D T+R W D  ++ +C   L+ +  T       +  S F  +N+      
Sbjct: 516 N--NLVSGSQDRTIRQW-DL-NNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIG 571

Query: 213 -----NVRLCSGSDDGTVRIWCLE 231
                +  L +G+ DG VR+W L 
Sbjct: 572 AIQCYDAALATGTKDGIVRLWDLR 595

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 23/124 (18%)

Query: 28  MATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKD 87
           +ATG+ D  ++L D+RS +++  L+   H   V S+ +   S  L  GS D+++ IW   
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLE--GHSDAVTSLQF--DSLNLVTGSLDNSIRIW--- 632

Query: 88  DDGYNDENDLETELLAIIEGHENEIKCVAW--------SHDGELLATCSRDKSVWIWEAD 139
                   DL T  LA    +E+ + C+ +        + +G +     ++K  W    D
Sbjct: 633 --------DLRTGTLADTFSYEHPVTCLQFDLNKIVVANQEGTVKVYNRQEKKHWFCGGD 684

Query: 140 EMGE 143
           E  E
Sbjct: 685 EHSE 688

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 98/249 (39%), Gaps = 31/249 (12%)

Query: 2   AGLKLLKSLALHDDKCWSVDVN--NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKT 59
            G  +L   + H+D    +D N   G + + G  D  IK+ ++   + +  +  T H  T
Sbjct: 399 PGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASI--TGHLAT 456

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           V S       N L  G  D+ + +W       ND    +   +   + H +EI   A S 
Sbjct: 457 V-SCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEI--TALSF 513

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL-------PL--- 169
           +   L + S+D+++  W+ +  G+  + + +      ++   +            P+   
Sbjct: 514 EANNLVSGSQDRTIRQWDLNN-GKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGA 572

Query: 170 -------LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDD 222
                  LA+ + D  VR+W D          L GH   V S  F+  N    L +GS D
Sbjct: 573 IQCYDAALATGTKDGIVRLW-DLRS-GRVVRTLEGHSDAVTSLQFDSLN----LVTGSLD 626

Query: 223 GTVRIWCLE 231
            ++RIW L 
Sbjct: 627 NSIRIWDLR 635

>Scas_592.4*
          Length = 318

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 54/237 (22%)

Query: 40  VDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET 99
           V +RSF+         H   V+            + S+D T+ +W           D+ T
Sbjct: 56  VPVRSFK--------GHSHIVQDCTLTQDGAYALSASWDKTLRLW-----------DVAT 96

Query: 100 -ELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV 158
            E      GH++++  VA      ++ + SRDK++ +W       + +C++ L  H+   
Sbjct: 97  GETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-----KGQCLATLLGHND-- 149

Query: 159 KHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
               W   + +  +   DD V +    +D       LN  +     +DF   N NV   +
Sbjct: 150 ----WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQ---IEADFVGHNGNVNAVT 202

Query: 219 GSDDGT----------VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGY 265
            S DGT          + +W L +    Y      E          V+S+ +SP  Y
Sbjct: 203 ASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDE----------VFSLAFSPNRY 249

 Score = 34.7 bits (78), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 38/153 (24%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G    + S D+ ++L D+ + +  +      HK  V SVA    ++++ +GS D T+ +
Sbjct: 76  DGAYALSASWDKTLRLWDVATGETYQRF--VGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 84  WG-------------------------KDDDGY------NDE-----NDLETELLAIIEG 107
           W                          ++DD        ND+     N  + ++ A   G
Sbjct: 134 WTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVG 193

Query: 108 HENEIKCVAWSHDGELLATCSRDKSVWIWEADE 140
           H   +  V  S DG L+A+  +D  + +W   E
Sbjct: 194 HNGNVNAVTASPDGTLIASAGKDGEIMLWNLAE 226

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 6/114 (5%)

Query: 24  NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSI 83
           +G ++A+   D +I L ++   + +  L   + +  V S+A+ P+   LAA +  S + I
Sbjct: 206 DGTLIASAGKDGEIMLWNLAEKKAMYTL---SAQDEVFSLAFSPNRYWLAAAT-ASGIKI 261

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137
           +  D     D  DL  E     +  E     +AWS DG+ L     D  + +W+
Sbjct: 262 FCLDPQSLID--DLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQ 313

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 89/244 (36%), Gaps = 58/244 (23%)

Query: 67  PHSNILAAGSFDSTVSIWGKDDDGYNDENDLETE-LLAIIEGHENEIKCVAWSHDGELLA 125
           P   +  AG  D TV IW           DL  +  +  + GH   I C+  + D   L 
Sbjct: 409 PFGTLCTAGYLDHTVKIW-----------DLSKQNKIGELAGHLATINCMQINRDYGTLV 457

Query: 126 TCSRDKSVWIWE---ADEMGEEFE------------CISVLQEHSQDVKHVIWHQSLPLL 170
           T  RD ++ +W    A ++ +E +            C+   + H+ +V  +    S   L
Sbjct: 458 TGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPS--FL 515

Query: 171 ASSSYDDTVRIWK----DCDD--DWECCAVLNGHEGTVWSSDFEKSNSNVR--------- 215
            S S D T+R W      C    D     VL        S     +  N R         
Sbjct: 516 VSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSF 575

Query: 216 ---LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272
              L +G+ DG VR+W L   +G+  +         K HT A+ S+ +     +  TGS 
Sbjct: 576 DAALATGTKDGVVRLWDLR--SGKVIRTL-------KGHTDAITSLKFDSACLV--TGSY 624

Query: 273 GRLV 276
            R V
Sbjct: 625 DRTV 628

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 110/234 (47%), Gaps = 36/234 (15%)

Query: 13  HDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELD-------------DTAHKKT 59
           H D+  ++ ++    + +GS DR I+  D+RS + ++ +D             D +    
Sbjct: 501 HTDEVTALSLD-PSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTL 559

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWS 118
           +     RP  +I A  SFD+ ++   K  DG     DL + +++  ++GH + I  + + 
Sbjct: 560 LTQRNERP--SIGALQSFDAALATGTK--DGVVRLWDLRSGKVIRTLKGHTDAITSLKF- 614

Query: 119 HDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHV-IWHQSLPLLASSSYDD 177
            D   L T S D++V IW+          ++    +S  V  + ++ ++  ++ +   + 
Sbjct: 615 -DSACLVTGSYDRTVRIWDL-----RTGLLNKFHAYSAPVLSLDLFQENAAVVVAD--EP 666

Query: 178 TVRIW-KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCL 230
           +V+I+  + D+ W C  V  G+E +V +  ++++     +  G ++G V IW +
Sbjct: 667 SVQIYDSEKDESWSC--VEQGNETSVSTVKYKEN----YMVEGRENGDVNIWAV 714

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 12/110 (10%)

Query: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK 183
           LAT ++D  V +W+        + I  L+ H+  +  + +  +   L + SYD TVRIW 
Sbjct: 579 LATGTKDGVVRLWDL----RSGKVIRTLKGHTDAITSLKFDSAC--LVTGSYDRTVRIW- 631

Query: 184 DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
             D         + +   V S D  + N+ V +   +D+ +V+I+  E D
Sbjct: 632 --DLRTGLLNKFHAYSAPVLSLDLFQENAAVVV---ADEPSVQIYDSEKD 676

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 75/182 (41%), Gaps = 25/182 (13%)

Query: 108 HENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSL 167
           H  E+  +++  DG  LA+ S D SV IW+      +F    V + H+  VK + W   +
Sbjct: 374 HSGEVCGLSYRKDGLQLASGSNDNSVMIWDTRTSMPQF----VKRNHTAAVKAISWCPDV 429

Query: 168 P-LLAS--SSYDDTVRIWKDCDDDWECCAVLNGHE------GTVWSSDFEKSNSNVRLCS 218
           P LLA+     D  +  W +        ++  G +      G  ++ D    N  +    
Sbjct: 430 PNLLATGGGQTDKYIHFW-NTTTGARVSSINTGSQVSSLQWGQSYNGDIM--NREIVATG 486

Query: 219 GSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG-YIASTGSDGRLVI 277
           G+ +  + ++        YE  +    I+ +AH   + S   SP G  +A+ G D  L  
Sbjct: 487 GNPENAISVY-------NYETRFKVAEIV-QAHDSRICSSQLSPDGTTLATVGGDENLKF 538

Query: 278 YK 279
           YK
Sbjct: 539 YK 540

>Kwal_27.12586
          Length = 509

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 64/176 (36%), Gaps = 29/176 (16%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           V  + W P  +    G     + +W  D            +L    + H++ I  + W+ 
Sbjct: 209 VTCLEWSPKGDSFLTGVESGEIRLWTHD-----------AKLQNAFDFHKSSIVTIKWNS 257

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTV 179
           D     T   D    +W A + G   +  S  +  + D        SL + AS    D  
Sbjct: 258 DATHFLTYDVDNVAIVWNA-QTGTALQQFSFRENGTVD--------SLGVDASWIGPDKF 308

Query: 180 RIWKDCDDDWEC-------CAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            I       + C          LNGH  T+ + DF   N+   L SGSDD T+R+W
Sbjct: 309 VIPGPQGSIYICGMGESRPLGKLNGHSATITAFDFNSENN--MLLSGSDDKTLRVW 362

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/134 (18%), Positives = 58/134 (43%), Gaps = 9/134 (6%)

Query: 98  ETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQD 157
           E+  L  + GH   I    ++ +  +L + S DK++ +W +  +       +    ++  
Sbjct: 324 ESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSS----NCFMGNTLG 379

Query: 158 VKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLC 217
           +    W     ++A +S D +VR+W    +  +  ++++G      S   +K    ++  
Sbjct: 380 ITSAFWIDDDKVIA-TSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDK----LKFA 434

Query: 218 SGSDDGTVRIWCLE 231
            G  DG V ++ +E
Sbjct: 435 IGKMDGEVTVYNIE 448

>Kwal_26.8628
          Length = 422

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 78/180 (43%), Gaps = 21/180 (11%)

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
           + GH N+I   AWS D   + + S+D  + +W+A  +G +   I +    SQ V     +
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDA-SLGFKKNAIPL---DSQWVLTCAIN 137

Query: 165 QSLPLLASSSYDDTVRIWKDCDDD---WECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSD 221
            S  L+AS+   ++  I++   ++    +  ++  GH   V   +F ++NS   + + S 
Sbjct: 138 SSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENNS---IITASG 194

Query: 222 DGTVRIWCLEDDN--GEYEQEW--IQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVI 277
           D T  +W +       E+      +    LP  H +    +        AS GSDG + I
Sbjct: 195 DMTCALWDIPKAKRIAEFSDHLGDVLALALPPPHAQTSSPI-------FASGGSDGYVYI 247

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 75/179 (41%), Gaps = 19/179 (10%)

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119
           V + A     N++A+    ++ +I+       + EN ++ +++++ +GH   +  V +  
Sbjct: 131 VLTCAINSSGNLVASAGLTNSCTIYR-----ISQENRVQQQIVSMFKGHTCYVSQVEFFE 185

Query: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW-----HQSLPLLASSS 174
           +  ++ T S D +  +W+  +       I+   +H  DV  +         S P+ AS  
Sbjct: 186 NNSII-TASGDMTCALWDIPKAKR----IAEFSDHLGDVLALALPPPHAQTSSPIFASGG 240

Query: 175 YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
            D  V IW    D     A  +        S  +  N+   + +G+DDG  R++ +  D
Sbjct: 241 SDGYVYIW----DTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDGVARMFDMRSD 295

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
           L  E++  +EGH + I  V  S DG  + T S D ++ +W  + M
Sbjct: 378 LRAEIVGKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLWSPNYM 422

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 35/78 (44%), Gaps = 21/78 (26%)

Query: 27  IMATGSTDRKIKLVDIRSFQ-------------------IIEELDDTAHKKTVRSVAWRP 67
           ++ATG  D  I++ DIR                       I E+ + AH   +R V W P
Sbjct: 235 VVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPN-AHGLAIRKVTWSP 293

Query: 68  -HSNILAAGSFDSTVSIW 84
            HSNIL + S+D T  IW
Sbjct: 294 HHSNILMSASYDMTCRIW 311

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 80/196 (40%), Gaps = 31/196 (15%)

Query: 16  KCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTA---HKKTVRSVAWRPH-SNI 71
           K WS       +  T       K+VD  +  I+++   T    ++  V    + PH  N+
Sbjct: 130 KIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNL 189

Query: 72  LAAGSFDSTVSIWG-KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130
           + + S +S  S++  +   G N  N L      +  G E  + C    +   ++AT   D
Sbjct: 190 VLSCSGNSYASLFDIRLPSGKNQNNFL------VHSGLE-ALTCDFNKYRPYVVATGGVD 242

Query: 131 KSVWIWEADEMGEE---------------FECIS-VLQEHSQDVKHVIW--HQSLPLLAS 172
            ++ IW+   + +                  CI+ +   H   ++ V W  H S  +L S
Sbjct: 243 NAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHS-NILMS 301

Query: 173 SSYDDTVRIWKDCDDD 188
           +SYD T RIW+D  +D
Sbjct: 302 ASYDMTCRIWRDLSND 317

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 11/94 (11%)

Query: 194 VLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA--- 250
           + N H   +    +   +SN+ L S S D T RIW    ++G  E      +   K    
Sbjct: 278 IPNAHGLAIRKVTWSPHHSNI-LMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIF 336

Query: 251 ----HTRAVYSVNWS---PKGYIASTGSDGRLVI 277
               H+  V+  +WS     GY+AST  DG L +
Sbjct: 337 NFTQHSEFVFGADWSLWGKPGYVASTAWDGNLFV 370

>YGR223C (HSV2) [2172] chr7 complement(940870..942216) Protein of
           unknown function, has a region of low similarity to a
           region of S. cerevisiae Aut10p, which functions in
           autophagy, pexophagy, and cytoplasm-to-vacuole
           targeting, and possibly in amino acid signaling pathways
           [1347 bp, 448 aa]
          Length = 448

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 91  YNDENDLETELL--AIIEGHENEIKCVAWSHDGELLATCS 128
           YN +N  E+ LL  +II+ H+N IK V  +  G ++ATCS
Sbjct: 204 YNSQNPKESALLPTSIIKAHKNPIKLVRLNRQGTMVATCS 243

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 115/259 (44%), Gaps = 41/259 (15%)

Query: 55  AHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI-- 112
            H+  V S++++    ++ +GS+D T  +W +    YN            ++ H   +  
Sbjct: 97  GHQGNVCSLSFQ--DGVVISGSWDKTAKVWKEGSLVYN------------LQAHNASVWD 142

Query: 113 -KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLA 171
            K V++S +  L  T S DK++ +W+ D++ + F  I     H+  V+H+        ++
Sbjct: 143 AKVVSFSENKFL--TASADKTIKLWQNDKVIKTFSGI-----HNDVVRHLAVVDDGHFIS 195

Query: 172 SSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231
            S+ D  +++      D        GHE  V+     K   N  + S  +D TVRIW  E
Sbjct: 196 CSN-DGLIKLVDMHTGD--VLRTYEGHESFVYCI---KLLPNGDIVSCGEDRTVRIWSKE 249

Query: 232 DDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVE-CI 290
             NG  +Q     +I       +++SV+    G I    SD  + I+ + +  W  E  I
Sbjct: 250 --NGSLKQVITLPAI-------SIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWASEDEI 300

Query: 291 HELTHGVYETNM-VKWVEY 308
           +EL+  V ++ +  K +E+
Sbjct: 301 NELSTQVEKSTISSKTIEF 319

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 27/141 (19%)

Query: 6   LLKSLALHDDKCWSVDV--NNGGIMATGSTDRKIKL----VDIRSFQIIEELDDTAHKKT 59
           L+ +L  H+   W   V   +     T S D+ IKL      I++F  I       H   
Sbjct: 129 LVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGI-------HNDV 181

Query: 60  VRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWS 118
           VR +A      ++  G F S        +DG     D+ T ++L   EGHE+ + C+   
Sbjct: 182 VRHLA------VVDDGHFISC------SNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLL 229

Query: 119 HDGELLATCSRDKSVWIWEAD 139
            +G+++ +C  D++V IW  +
Sbjct: 230 PNGDIV-SCGEDRTVRIWSKE 249

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 67/158 (42%), Gaps = 20/158 (12%)

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
           +A+ S D TV +W KDD            L  ++   +  +  V +  + ELL    +D 
Sbjct: 27  VASVSRDGTVRLWSKDDQW----------LGTVVYTGQGFLNSVCYDSEKELLLFGGKDT 76

Query: 132 SV-WIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190
            +  +      GE  + +  L  H  +V  + +     ++ S S+D T ++WK+    + 
Sbjct: 77  MINGVPLFATSGE--DPLYTLIGHQGNVCSLSFQDG--VVISGSWDKTAKVWKEGSLVYN 132

Query: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
               L  H  +VW +     + N +  + S D T+++W
Sbjct: 133 ----LQAHNASVWDAKVVSFSEN-KFLTASADKTIKLW 165

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 80/181 (44%), Gaps = 25/181 (13%)

Query: 54  TAHKKTVRSVAWRPHS-NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112
             H +   ++ + P + +++ +G  D T+ IW    D Y+D      E L   +GH   I
Sbjct: 159 PGHPEGTTALKFLPKTGHLILSGGNDHTIKIW----DFYHD-----YECLRDFQGHNKPI 209

Query: 113 KCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDV--KHVIWHQSLPLL 170
           K + ++ D +   + S D+SV IW+  E G + +    L     DV  +    H+ +  L
Sbjct: 210 KALRFTEDCQSFLSSSFDRSVKIWDT-ETG-KVKTRLHLNSTPADVESRPTNPHEFIVGL 267

Query: 171 ASSS---YDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRI 227
           ++S    YDD V       ++       + H  ++ +  +    S  +  S S+D TVRI
Sbjct: 268 SNSKILHYDDRV------SENQGLVQTYDHHLSSILALKYFPDGS--KFISSSEDKTVRI 319

Query: 228 W 228
           W
Sbjct: 320 W 320

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 97  LETELLAIIEGHENEIKCVAW-SHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHS 155
           L  +++    GH      + +    G L+ +   D ++ IW+      ++EC+   Q H+
Sbjct: 150 LPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWD---FYHDYECLRDFQGHN 206

Query: 156 QDVKHVIWHQSLPLLASSSYDDTVRIW 182
           + +K + + +      SSS+D +V+IW
Sbjct: 207 KPIKALRFTEDCQSFLSSSFDRSVKIW 233

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 83/225 (36%), Gaps = 22/225 (9%)

Query: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVA 64
           K +K+L   +D C S          + S DR +K+ D  + ++   L   +    V S  
Sbjct: 207 KPIKALRFTED-CQS--------FLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRP 257

Query: 65  WRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELL 124
             PH  I+      S   I   DD    ++      L+   + H + I  + +  DG   
Sbjct: 258 TNPHEFIVGL----SNSKILHYDDRVSENQG-----LVQTYDHHLSSILALKYFPDGSKF 308

Query: 125 ATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK- 183
            + S DK+V IWE +++    + IS   +HS    +V  H S     + S D+ +  +  
Sbjct: 309 ISSSEDKTVRIWE-NQINVPIKQISDTAQHSMPFLNV--HPSQNYFCAQSMDNRIYSFSL 365

Query: 184 DCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
                     +  GH    +      S     +CSG     +  W
Sbjct: 366 KPKYKRHPKKIFKGHSSAGYGISLAFSGDGRYICSGDSKSRLFTW 410

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (56%), Gaps = 6/86 (6%)

Query: 201 TVWSSDFEKSNSNVRLCSGSDDGTVRIWCL-EDDNGEYEQEWIQESI----LPKAHTRAV 255
            V+S  F+K+++N +L +   D  VRIW L  D+NG+       ES+        H +A+
Sbjct: 15  PVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAI 74

Query: 256 YSVNWSPKG-YIASTGSDGRLVIYKE 280
             + ++ KG  +AS G DG+++++K+
Sbjct: 75  NVIRFNSKGDVLASAGDDGQVLLWKQ 100

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 98/233 (42%), Gaps = 46/233 (19%)

Query: 58  KTVRSVAWRPHS---NILAAGSFDSTVSIW--GKDDDGYNDE-NDLET-ELLAIIEGHEN 110
           + V S+ ++ +S    +  AG  D+ V IW   +D++G N     +E+ + L  +  HE 
Sbjct: 14  QPVYSLTFQKNSANDKLFTAGG-DNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQ 72

Query: 111 EIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLL 170
            I  + ++  G++LA+   D  V +W+ ++   + E  SV++    D +           
Sbjct: 73  AINVIRFNSKGDVLASAGDDGQVLLWKQEDPNTQQE--SVVRPFGMDAE----------- 119

Query: 171 ASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSS---DFEKSNSNVRLCSGSDDGTVRI 227
            +S  D+         + W     L G  G   ++   D   S  N  +     D ++R+
Sbjct: 120 -TSEADEN-------KEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNIVVACMDNSIRL 171

Query: 228 W--------CLEDDNGEYEQ----EWIQESILPKAHTRA--VYSVNWSPKGYI 266
           +        C + D+G Y Q    + + + IL ++  R+  VY V  S  G +
Sbjct: 172 FDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVV 224

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 15  DKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAA 74
           D  WS D  N   +     D  I+L D+ +  ++    D  H   V+ VAW P +  + +
Sbjct: 150 DLAWSPDNRN---IVVACMDNSIRLFDVGAGMLVCGQSDHGH--YVQGVAWDPLNQFILS 204

Query: 75  GSFDSTVSIWG 85
            S D ++ ++G
Sbjct: 205 QSADRSLHVYG 215

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 64/142 (45%), Gaps = 10/142 (7%)

Query: 90  GYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECIS 149
           G N  ++L  + +  ++GH N+I  V WS D   + + S+D  + IW+    G +   I 
Sbjct: 67  GVNSLHELNLQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDP-FTGLKKSAIP 125

Query: 150 VLQEHSQDVKHVIWHQSLPLLASSSYDD---TVRIWKDCDDDWECCAVLNGHEGTVWSSD 206
           +L   SQ V       S  L+AS+  D+     R+ +D        ++  GH   + +++
Sbjct: 126 LL---SQWVLSSAISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATE 182

Query: 207 FEKSNSNVRLCSGSDDGTVRIW 228
           F    +   + + S D T  +W
Sbjct: 183 FLDERT---ILTASGDMTCAMW 201

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (57%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIW 136
           ++ E++  ++GH N I  V  S DG  + + S D ++ +W
Sbjct: 392 IKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVW 431

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           +++GHE  +  V ++ +G+L+ +C++D    +W A       E +   + H   +  +  
Sbjct: 5   MLKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAING----ERLGTFEGHMGTIWSIDV 60

Query: 164 HQSLPLLASSSYDDTVRIWKDCD 186
            Q      + S D +V++WK CD
Sbjct: 61  DQFTEYAVTGSADFSVKLWKVCD 83

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 14/115 (12%)

Query: 150 VLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEK 209
           +L+ H + +  V +++   L+ S + D    +W   +   E      GH GT+WS D ++
Sbjct: 5   MLKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAING--ERLGTFEGHMGTIWSIDVDQ 62

Query: 210 SNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG 264
                   +GS D +V++W + D +  Y   W  ++         V  V +SP G
Sbjct: 63  FTEYA--VTGSADFSVKLWKVCDGSNVY--TWKTKT--------PVRRVEFSPAG 105

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 17/129 (13%)

Query: 27  IMATGSTDRKIKLVDIRSF--------QIIEELDDTAHKKTVRSVAWRP-HSNILAAGSF 77
           I+ATG  D+ +K+ D+R          Q +   +   H+  +R V+W P HSN++ + S+
Sbjct: 237 IVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSY 296

Query: 78  DSTVSIWGKDDD------GYNDENDLETELLAIIEGHENEIKCVAWSHDGE--LLATCSR 129
           D T  +W    D      G  +  D       I   H   +    WS  G+   +A+ + 
Sbjct: 297 DMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQPGYVASTAW 356

Query: 130 DKSVWIWEA 138
           D +V IW  
Sbjct: 357 DGNVCIWHT 365

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 119/316 (37%), Gaps = 63/316 (19%)

Query: 15  DKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQ----IIEELDDTAHKKTVRSVAWR-PHS 69
           D  W+    N  + A G  D  ++L DI   Q    I +E     H+K V S  W   + 
Sbjct: 65  DVAWNEGHANQVLAAQG--DGSLRLFDINLPQYPISIFQE-----HQKEVFSCNWNLVNK 117

Query: 70  NILAAGSFDSTVSIWGK-DDDGYNDENDLETELLAIIEGHENEIK--------------- 113
               + S+D TV IW     +       +  E   ++E     I                
Sbjct: 118 QTFVSSSWDGTVKIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKD 177

Query: 114 CVAWS----HDGELLATCSRDKSVWIWEADEMG----EEFECISVLQEHSQDVKHVIWHQ 165
           C+  +    HD  L+  C+ +  V +++  +      + F     L+  + D      H 
Sbjct: 178 CIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPH- 236

Query: 166 SLPLLASSSYDDTVRIW-----KDCDDDWECCAVLN---GHEGTVWSSDFEKSNSNVRLC 217
              ++A+   D  V+IW     +   +  +    +N   GHE  +    +   +SN+ L 
Sbjct: 237 ---IVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVL- 292

Query: 218 SGSDDGTVRIWC-LEDDNGEYEQEWIQESILPKA--------HTRAVYSVNWS---PKGY 265
           S S D T R+W  L D NG    +    SI P          HT  V+  +WS     GY
Sbjct: 293 STSYDMTCRVWDDLSDSNGRPTGK--TNSIDPTKGCRFIFPHHTEFVFGADWSLWGQPGY 350

Query: 266 IASTGSDGRLVIYKES 281
           +AST  DG + I+  S
Sbjct: 351 VASTAWDGNVCIWHTS 366

>AAL119W [68] [Homologous to ScYFR021W (AUT10) - SH]
           complement(137922..139535) [1614 bp, 537 aa]
          Length = 537

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 9/91 (9%)

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           +IE H+ EI  +A S DG LLAT S   ++    + E      C  V Q         I+
Sbjct: 254 VIEAHKGEIAALALSKDGTLLATASEKGTIIRVFSVE-----TCTKVYQFRRGTYPTRIY 308

Query: 164 HQSLP----LLASSSYDDTVRIWKDCDDDWE 190
             +       LA+SS + TV I+K    + E
Sbjct: 309 SLNFSDDNEFLAASSSNKTVHIFKLGKPNAE 339

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 66/152 (43%), Gaps = 12/152 (7%)

Query: 84  WGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGE 143
           + K    +N E   E E     EGH +EI  VA S DG+ + T  RD+ + +W      E
Sbjct: 215 YTKGGRRFNPETTNEYE--NTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWST----E 268

Query: 144 EFECISVL--QEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGT 201
               + V+  ++   +V  + + ++   L +S  D  VR +    + +    VL GH+  
Sbjct: 269 SLSPVKVIPTKDRRGEVLSLAFRKNSDQLFASCADYKVRTY--AINQFSQLEVLYGHQDL 326

Query: 202 VWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDD 233
           V   D    +    +  GS D T  +W + D+
Sbjct: 327 VV--DISALSMERCVTVGSRDRTAMLWKIADE 356

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 103/246 (41%), Gaps = 46/246 (18%)

Query: 13  HDDKCWSVDVN-NGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNI 71
           H D+  +V  + +G  + TG  DRK+ +    S   ++ +     +  V S+A+R +S+ 
Sbjct: 237 HYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSDQ 296

Query: 72  LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDK 131
           L A   D  V  +       N  + LE     ++ GH++ +  ++       +   SRD+
Sbjct: 297 LFASCADYKVRTY-----AINQFSQLE-----VLYGHQDLVVDISALSMERCVTVGSRDR 346

Query: 132 SVWIWE-ADEM------GEEFECISV--LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIW 182
           +  +W+ ADE       GE+ E +    L+++S+++++         +  +  +D  + +
Sbjct: 347 TAMLWKIADETRLTFRGGEDPERLLKRWLKQNSKELEN-------GEIEPAKEEDAPKFY 399

Query: 183 KDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWI 242
            +   D   C V + H                   +GSD+G + +W L      + Q  +
Sbjct: 400 GEGSIDC-VCMVDDSH-----------------FITGSDNGNISLWSLSKKKPIFTQR-V 440

Query: 243 QESILP 248
              I+P
Sbjct: 441 AHGIIP 446

>Kwal_55.21450
          Length = 503

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 65/318 (20%), Positives = 122/318 (38%), Gaps = 60/318 (18%)

Query: 5   KLLKSLALHDDKCWSVDV--NNGGIMATGSTDRKIKLVDI-RSFQIIEELDDTAHKKTVR 61
           KL+ +   H +   S+ +   +G +  +   D ++K+ D+ R  +++   D   H K VR
Sbjct: 201 KLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLR--DYRGHSKAVR 258

Query: 62  SVAWRPHSNILAAGSFDSTVSIW----GKDDDGY------------------------ND 93
            +++    +   + SFD  + IW    GK    Y                        N 
Sbjct: 259 GISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNS 318

Query: 94  E---NDLETE----LLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
           E    DL T     L+ + + H + I  + +  DG    + S DKS+ IWE +++    +
Sbjct: 319 EIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWE-NQINIPIK 377

Query: 147 CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWK-DCDDDWECCAVLNGHEGTVWSS 205
            IS   ++S  + ++  H      A+ S D+ +  +              +GH+   +  
Sbjct: 378 QISDTSQYS--MPYIGIHPEQNYFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGI 435

Query: 206 DFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPK---AHTRAVYSVNWSP 262
            F  S     + SG   G V IW           +W    +L        + + +V WSP
Sbjct: 436 GFGFSPDGQYIASGDTRGRVYIW-----------DWKTTHLLKHFDVPDKKTIVTVAWSP 484

Query: 263 K--GYIASTGSDGRLVIY 278
           +    +  +G+ G + +Y
Sbjct: 485 QETSKMLCSGNGGEIFLY 502

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 16/127 (12%)

Query: 19  SVDVNNGGIMATGSTDRKIKLVDIRSFQ--IIEELDDT--AHKKTVRSVAWRPHSN--IL 72
           +VD    G +     +    L   RSF+  + ++L  T   HK    S+   P S    L
Sbjct: 168 AVDYQGRGFLYPPIEENVDFLKPERSFRCYLPKKLIHTYPGHKNGTNSILLLPKSGHLCL 227

Query: 73  AAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKS 132
           +AG+ D+ V IW    D Y D      ELL    GH   ++ ++++ +G    + S D+ 
Sbjct: 228 SAGN-DNQVKIW----DLYRDR-----ELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQ 277

Query: 133 VWIWEAD 139
           + IW+ +
Sbjct: 278 IKIWDTE 284

>Kwal_14.1675
          Length = 373

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 58/139 (41%), Gaps = 18/139 (12%)

Query: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHT 252
           A L  H+ TV + D        R+ + S D    +W    D G Y+   +   I      
Sbjct: 51  ASLADHDKTVTAVDISIHG---RIVTCSQDRNAIVWEPLSD-GSYKPTLVLLRI-----N 101

Query: 253 RAVYSVNWSPKGYIASTGSDGRLV---IYKESEDGWIVECIHELTHGVYETNMVKWVEYG 309
           RA   V W+P GY  + GS  R++    Y++  D W+ + I +        N + W + G
Sbjct: 102 RAATCVKWAPSGYKFAVGSSARIIAVCYYEQDNDWWVSKHIKKPIKST--INCLSWHDNG 159

Query: 310 SKDVILLITAGDDGHVNVW 328
               I+L   G DG+V  +
Sbjct: 160 ----IILACGGTDGYVRAF 174

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 60/139 (43%), Gaps = 27/139 (19%)

Query: 6   LLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV----- 60
           L+ SLA HD    +VD++  G + T S DR           + E L D ++K T+     
Sbjct: 49  LIASLADHDKTVTAVDISIHGRIVTCSQDRNA--------IVWEPLSDGSYKPTLVLLRI 100

Query: 61  ----RSVAWRPHSNILAAGSFDSTVSI--WGKDDDGYNDENDLETELLAIIEGHENEIKC 114
                 V W P     A GS    +++  + +D+D +  ++        I +  ++ I C
Sbjct: 101 NRAATCVKWAPSGYKFAVGSSARIIAVCYYEQDNDWWVSKH--------IKKPIKSTINC 152

Query: 115 VAWSHDGELLATCSRDKSV 133
           ++W  +G +LA    D  V
Sbjct: 153 LSWHDNGIILACGGTDGYV 171

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 64/144 (44%), Gaps = 8/144 (5%)

Query: 91  YNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISV 150
           Y  E   E E   + EGH +EI  VA S DG+ + +  RD+ + +W  + +      I  
Sbjct: 216 YIPEGKFEYE--NVTEGHYDEILTVAASPDGKYVVSGGRDRKLIVWSTESLAP--VKIIP 271

Query: 151 LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKS 210
            ++   +V  + + ++   L ++  D  +R +    + +    +L GH+  V   D    
Sbjct: 272 TKDRRGEVLGLAFKKNSDQLFAACADYKIRTY--AINQFSQLEILYGHQDLVI--DISAL 327

Query: 211 NSNVRLCSGSDDGTVRIWCLEDDN 234
           N    +  GS D T  +W + D++
Sbjct: 328 NMERCVTVGSRDRTAMLWKIADES 351

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 150 VLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEK 209
           +L  H + +  V +++   L+ +S  D+   +W   +   E    L GH G++WS D ++
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNG--ERLGTLEGHNGSIWSIDVDQ 62

Query: 210 SNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG 264
                   +GS D +V++W + D  G     W   +         V  V +SP G
Sbjct: 63  HTEYA--VTGSADFSVKVWRVRD--GSIAHSWDTRT--------PVRRVEFSPTG 105

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           ++ GHE  +  V ++ +G+L+ T  +D    +W A       E +  L+ H+  +  +  
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVWYA----MNGERLGTLEGHNGSIWSIDV 60

Query: 164 HQSLPLLASSSYDDTVRIWK 183
            Q      + S D +V++W+
Sbjct: 61  DQHTEYAVTGSADFSVKVWR 80

>Kwal_34.15818
          Length = 349

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 53/115 (46%), Gaps = 14/115 (12%)

Query: 150 VLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEK 209
           +L+ H + +  V +++   L+ + + D+   +W   +   E      GH+GT+WS D ++
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSING--ERLGTFEGHQGTIWSIDVDQ 62

Query: 210 SNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKG 264
                   +GS D ++++W ++D    +   W  ++         V  V +SP G
Sbjct: 63  FTQYA--VTGSADFSIKLWKVQDGTNVF--TWKTKT--------PVRRVQFSPSG 105

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 104 IIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW 163
           +++GHE  +  V ++ +G+L+ TC++D    +W +       E +   + H   +  +  
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSING----ERLGTFEGHQGTIWSIDV 60

Query: 164 HQSLPLLASSSYDDTVRIWKDCD 186
            Q      + S D ++++WK  D
Sbjct: 61  DQFTQYAVTGSADFSIKLWKVQD 83

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 24/134 (17%)

Query: 27  IMATGSTDRKIKLVDIR---------SFQ---IIEELDDTAHKKTVRSVAWRP-HSNILA 73
           I+AT   D  I + DIR          FQ   ++ E+ + AH   V+ V W P HS+IL 
Sbjct: 236 IIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVN-AHDLAVKKVCWSPHHSDILL 294

Query: 74  AGSFDSTVSIWGKD-------DDGYNDENDLETELLAIIEGHENEIKCVAWSHDG--ELL 124
           + S+D +  IW KD         G  + + L   LL+  + H   +    WS  G    +
Sbjct: 295 STSYDMSCKIW-KDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFVFGADWSLWGIPGYV 353

Query: 125 ATCSRDKSVWIWEA 138
           AT   D +V+IW  
Sbjct: 354 ATAGWDSNVFIWNG 367

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 64/141 (45%), Gaps = 19/141 (13%)

Query: 56  HKKTVRSVAWRPHS-NILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKC 114
           ++  +    + PH  N++   + +S V+++    +  N++ +       I    +  + C
Sbjct: 174 NRNCIYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNF------IAHRGKGALSC 227

Query: 115 VAWSHDGELLATCSRDKSVWIWEADEMG-----EEFECISVLQE----HSQDVKHVIW-- 163
               +   ++AT   D S+ IW+   +      + F+  +++ E    H   VK V W  
Sbjct: 228 DFNKYRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSP 287

Query: 164 HQSLPLLASSSYDDTVRIWKD 184
           H S  +L S+SYD + +IWKD
Sbjct: 288 HHS-DILLSTSYDMSCKIWKD 307

>Scas_605.18
          Length = 424

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 98/242 (40%), Gaps = 27/242 (11%)

Query: 94  ENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQE 153
           +N +  +    ++GH N+I    WS D + + + S+D  + IW+    G +   I +   
Sbjct: 76  KNKINLQSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTAS-GLKRNAIPL--- 131

Query: 154 HSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDD---WECCAVLNGHEGTVWSSDFEKS 210
            SQ V       S  L AS+  ++   I++   ++       ++  GH  T + SD E  
Sbjct: 132 DSQWVLSCALSPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDIEFL 189

Query: 211 NSNVRLCSGSDDGTVRIWCLEDDN--GEYEQEW--IQESILPKAHTRAVYSVNWSPKGYI 266
           + N  + + S D T  +W +       EY      +    LP          N       
Sbjct: 190 D-NSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGAN-----IF 243

Query: 267 ASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVN 326
           AS GSDG   I+    D      + +      + N +++ + G+     ++T GDDG +N
Sbjct: 244 ASCGSDGYTYIW----DTRTSAAVQKFFASDTDVNAIQFFKDGNS----IVTGGDDGVIN 295

Query: 327 VW 328
           ++
Sbjct: 296 MF 297

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 97  LETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEM 141
           L+ E++  +EGH N +  V  S DG  + T S D ++ IW  + M
Sbjct: 380 LKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPNYM 424

>CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces
           cerevisiae YCL039w, hypothetical start
          Length = 812

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 8   KSLALHDDKCWSVDVNNGG-----IMATGSTDRKIKLVDIRS-FQIIEELDDTAHKKTVR 61
           K+L  H D+ W +  +  G     + A  +TDRKI + D+++ FQ+ + L  + + + + 
Sbjct: 348 KTLTQHSDEVWYLQFSPDGRYLASVSADATTDRKIYIYDVQNDFQVYKIL--SGNSQCIL 405

Query: 62  SVAWRPHSNILAAGSFDSTVSIWGKDDDG 90
            +++ P S +L +  F++ V+I+    +G
Sbjct: 406 YLSFSPDSKLLVSCPFNAIVNIYSIHAEG 434

>Scas_684.7
          Length = 511

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 19/174 (10%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPH-SNILAAGSFDSTVSIWG 85
           + A+   D  I++ D RS +    +   A    V  ++W      +LA+G  + T  +W 
Sbjct: 336 VFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVW- 394

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIW----EAD- 139
            D   ++ EN    + +A  + H+  I  ++++  D  ++A  S D +V +W    EAD 
Sbjct: 395 -DLRQFSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADD 453

Query: 140 -EMGEEFECISVLQEHS---------QDVKHVIWHQSLPLLASSSYDDTVRIWK 183
            E+ ++      LQ+           ++VK V WH+ +P    S+  D + IWK
Sbjct: 454 EEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNIWK 507

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 57/138 (41%), Gaps = 20/138 (14%)

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAV--------- 255
           S F  S   V   + S++G V I+ L   +  +     +   +PKA  R +         
Sbjct: 218 SPFASSKEEVLAATMSENGEVYIFDLGPQSKAFSTPGYK---VPKAAKRPIHTVKNHGNV 274

Query: 256 --YSVNWSP---KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGS 310
             Y+++WSP    G + +    G++   +     WI +   +    V     ++ +++  
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITD---KQPFTVANNQSIEDIQWSR 331

Query: 311 KDVILLITAGDDGHVNVW 328
            +  +  +AG DG++ +W
Sbjct: 332 TESTVFASAGCDGYIRIW 349

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 137 EADEMGEEFECISV---------LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDD 187
           EA E GE  E I V           +H+  V  V  H SLPL+AS   D+ + +W     
Sbjct: 37  EAMEGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQ 96

Query: 188 DWECCAVLNGHEGTVWSSDF 207
             +    L+GH  +V ++ F
Sbjct: 97  PPKFAGTLSGHTESVIAAHF 116

 Score = 35.4 bits (80), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 52/118 (44%), Gaps = 12/118 (10%)

Query: 56  HKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCV 115
           H  +V  VA  P   ++A+G  D+ + +W          +    +    + GH   +   
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLW--------TSHSQPPKFAGTLSGHTESVIAA 114

Query: 116 AWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASS 173
            ++ DG+ L +      + +  + + G +++ +S LQE    V+ +IW +  P ++ +
Sbjct: 115 HFTPDGKFLVSADMTGKLLVHASVKGGAQWKLVSELQE----VEEIIWLKVHPKVSGA 168

>Scas_692.29
          Length = 456

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 195 LNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRA 254
           L GH+  V S D    N  + LCSGS DGTV++W +      Y     ++  + K     
Sbjct: 367 LIGHKNFVVSLDTCPENEYI-LCSGSHDGTVKVWDVRSTAPMYTITR-EDKNVEKGVNDK 424

Query: 255 VYSVNWSPKGYIASTGSDGRLVIYK 279
           V++V W+ K  I S G D ++ I K
Sbjct: 425 VFAVRWAEKIGIISGGQDKKIQINK 449

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 121/285 (42%), Gaps = 36/285 (12%)

Query: 54  TAHKKTVRSVAWRPHSNILAAGSFDSTVSIWG-KDDDG---YNDENDLETEL-----LAI 104
           + H   +R+V +   + +++AG+ D T+ +W  K++D    + DE D E  +     LAI
Sbjct: 141 SGHSGPIRAVKFISDTRLVSAGN-DRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAI 199

Query: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164
           +EGH+  +  +  S+   +L++ S D S+ +W    + +E   +  ++E   +  + I  
Sbjct: 200 LEGHKAPVVSLDVSNTSRILSS-SYDNSIGLWST--IYKEMTVVDPMEE-INNADNKIST 255

Query: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGT 224
            +      +  D T+R            ++L  H   V  + F+ ++  V   S S D T
Sbjct: 256 AARKRRKLTLKDGTIR-------RRAPLSLLESHTAPVEQASFDINDDTVGY-SVSQDHT 307

Query: 225 VRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDG 284
           ++ W L               I  K  + ++ S+   P   + + GS  R +   +   G
Sbjct: 308 IKTWDL----------VTARCIDTKTTSYSLLSLTQLPTLNLLACGSSARHITLHDPRMG 357

Query: 285 WIVECI-HELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328
              +   H+L   +   N V  ++   ++  +L +   DG V VW
Sbjct: 358 ASSKVTQHQL---IGHKNFVVSLDTCPENEYILCSGSHDGTVKVW 399

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 58/136 (42%), Gaps = 28/136 (20%)

Query: 112 IKCVAWSHDGELLATCSRDKSVWIWE-ADEMGEEFECISVLQEHSQDVKHVIWHQSLPLL 170
           I  +  S D + + T S D  +  W  + ++ +++        HS  ++ V +  S   L
Sbjct: 106 ISSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSG------HSGPIRAVKF-ISDTRL 158

Query: 171 ASSSYDDTVRIWKDCDD-----------------DWECCAVLNGHEGTVWSSDFEKSNSN 213
            S+  D T+R+WK  ++                 D +  A+L GH+  V S D   ++  
Sbjct: 159 VSAGNDRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTS-- 216

Query: 214 VRLCSGSDDGTVRIWC 229
            R+ S S D ++ +W 
Sbjct: 217 -RILSSSYDNSIGLWS 231

>Kwal_56.24478
          Length = 1296

 Score = 38.1 bits (87), Expect = 0.009,   Method: Composition-based stats.
 Identities = 52/232 (22%), Positives = 92/232 (39%), Gaps = 29/232 (12%)

Query: 11  ALHDDKCWSVDVNNGGIMATGSTDRKI-KLVDIRSFQIIEELDDTAHKKTVRSVAWRP-H 68
           A  +D  WS D +    + TG+ D  + +      ++ I +L    H   V++V +    
Sbjct: 63  AKFNDLDWSYDNS----VLTGALDNGVVEFFSPSEYKSIAKL--AQHSTPVKTVRFNAKQ 116

Query: 69  SNILAAGSFDSTVSIWGKDDDGYNDENDLETELLA-IIEGHE----NEIKCVAWSHD-GE 122
            N+L +G     + IW        D N +ET   A  + G      +EI  +AW+ + G 
Sbjct: 117 HNVLCSGGSKGEIYIW--------DANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGH 168

Query: 123 LLATCSRDKSVWIWEADEMGE--EFECISVLQEHSQDVKHVIWHQS----LPLLASSSYD 176
           + A+        IW+     E       S +      +  V WH +    +   + S  D
Sbjct: 169 VFASAGSSGFASIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSDSD 228

Query: 177 DTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228
            ++ +W   + +     +  GH   V S D+ K +  + L SG D+  V +W
Sbjct: 229 PSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCV-LW 279

 Score = 30.0 bits (66), Expect = 3.1,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 21/139 (15%)

Query: 151 LQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSS----- 205
           L E+ +       H+  PLLA+ +   T+      D   E  ++L+ HE T   S     
Sbjct: 4   LAEYPRTATFAWSHERSPLLATGTASGTIDADFSSDSTLEIWSLLSPHEATPQGSVSADA 63

Query: 206 ---DFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKA-HTRAVYSVNWS 261
              D + S  N  L    D+G V  +       EY      +SI   A H+  V +V ++
Sbjct: 64  KFNDLDWSYDNSVLTGALDNGVVEFF----SPSEY------KSIAKLAQHSTPVKTVRFN 113

Query: 262 PKGY--IASTGSDGRLVIY 278
            K +  + S GS G + I+
Sbjct: 114 AKQHNVLCSGGSKGEIYIW 132

>KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces
           cerevisiae YMR131c RSA2, start by similarity
          Length = 523

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 19/174 (10%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPH-SNILAAGSFDSTVSIWG 85
           + A+   D  I++ D RS +    +   A    V  ++W      +LA+G  D T  +W 
Sbjct: 348 VFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVW- 406

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIW----EAD- 139
            D   +  +N      +A  + H+  I  ++++  D  ++A  S D +V +W    EAD 
Sbjct: 407 -DLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADD 465

Query: 140 -EMGEEFECISVLQEHS---------QDVKHVIWHQSLPLLASSSYDDTVRIWK 183
            E+ ++      LQ+           ++VK V WH+ +P    S+  D + +WK
Sbjct: 466 EEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNVWK 519

>CAGL0K03861g complement(359448..360989) highly similar to sp|Q04225
           Saccharomyces cerevisiae YMR131c Ribosome assembly
           protein, start by similarity
          Length = 513

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 78/174 (44%), Gaps = 19/174 (10%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPH-SNILAAGSFDSTVSIWG 85
           + AT   D  I++ D RS +    +   A    V  ++W      +LA+G  + +  +W 
Sbjct: 338 VFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVW- 396

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGE-LLATCSRDKSVWIW----EAD- 139
            D   +  +N    + +A    H+  I  +A++   E ++A  S D +V +W    EAD 
Sbjct: 397 -DLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADD 455

Query: 140 -EMGEEFECISVLQEHS---------QDVKHVIWHQSLPLLASSSYDDTVRIWK 183
            E+ ++ E    L+E           +++K V WH+ +P    S+  D + IWK
Sbjct: 456 EEIKQQTEETKELKEIPPQLLFVHWQKEIKDVKWHKQIPGCLVSTGTDGLNIWK 509

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 83/188 (44%), Gaps = 25/188 (13%)

Query: 107 GHENEIKCVAWSH-DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQ 165
           G+   I+ + WS  +  + AT   D  + +W  D   ++ +    ++  + DV  + W++
Sbjct: 321 GNNKSIEDIQWSKTESTVFATAGCDGYIRVW--DTRSKKHKPAISVKASNTDVNVISWNE 378

Query: 166 SLPLLASSSYD-------DTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCS 218
            +  L +S  D       D  +   D   + +  A  N H+G + S  F     ++ +  
Sbjct: 379 KIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESI-VAV 437

Query: 219 GSDDGTVRIWCL--EDDNGEYEQEWIQESILPKAHTRAVYSVNWSPK-----------GY 265
           GS+D TV +W L  E D+ E +Q+  +   L +   + ++ V+W  +           G 
Sbjct: 438 GSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLF-VHWQKEIKDVKWHKQIPGC 496

Query: 266 IASTGSDG 273
           + STG+DG
Sbjct: 497 LVSTGTDG 504

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 56/138 (40%), Gaps = 20/138 (14%)

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAV--------- 255
           S F   +  V   + S++G V I+ +      +     Q   +PK   R V         
Sbjct: 220 SPFASQSQEVLTATMSENGEVYIFDIGAQAKCFNSPGYQ---IPKQSKRPVHTIRNHGNV 276

Query: 256 --YSVNWSP---KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGS 310
             Y ++WSP    G + S    G++ + +     W+ +   +  + V     ++ +++  
Sbjct: 277 EGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTD---KQAYSVGNNKSIEDIQWSK 333

Query: 311 KDVILLITAGDDGHVNVW 328
            +  +  TAG DG++ VW
Sbjct: 334 TESTVFATAGCDGYIRVW 351

>Kwal_47.17827
          Length = 523

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 76/174 (43%), Gaps = 19/174 (10%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPH-SNILAAGSFDSTVSIWG 85
           + AT   D  I++ D RS +    +   A    V  ++W      +LA+G  + T  +W 
Sbjct: 348 VFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVW- 406

Query: 86  KDDDGYNDENDLETELLAIIEGHENEIKCVAWSH-DGELLATCSRDKSVWIW----EAD- 139
            D   ++  N      +A    H+  I  +A++  D  ++A  S D +V +W    EAD 
Sbjct: 407 -DLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADD 465

Query: 140 -EMGEEFECISVLQEHS---------QDVKHVIWHQSLPLLASSSYDDTVRIWK 183
            E+ ++      LQ+           ++VK V WH+ +P    S+  D + IWK
Sbjct: 466 EEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNIWK 519

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/138 (18%), Positives = 54/138 (39%), Gaps = 20/138 (14%)

Query: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAV--------- 255
           S F   +      S S++G V I+ L      +E    Q   +PK   + +         
Sbjct: 230 SPFASESPEKLTASMSENGEVYIFDLGPQVKGFETPGYQ---IPKTAKKPIHTVKAHGNV 286

Query: 256 --YSVNWSP---KGYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVKWVEYGS 310
             Y+++WSP    G + +    GR+ + +     WI +   +          ++ +++  
Sbjct: 287 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITD---KTAFSAGNNQSIEDIQFSR 343

Query: 311 KDVILLITAGDDGHVNVW 328
            +  +  T G DG++ +W
Sbjct: 344 TEATVFATCGCDGYIRIW 361

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 78/197 (39%), Gaps = 40/197 (20%)

Query: 27  IMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGK 86
           ++AT      +K  D+ + Q++ EL       T  S+   P + ++  G  + TV++W  
Sbjct: 193 LLATAGQTGWLKYHDVSTGQMVSELRTKLGPTT--SMTHNPWNAVMHLGHSNGTVTLWSP 250

Query: 87  DDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFE 146
                     +   L+ ++ G    I  VA    G  +AT S+DKS+ IW          
Sbjct: 251 S---------MPEPLVKLLSG-RGPINSVAVDRSGYYMATVSQDKSLKIW---------- 290

Query: 147 CISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD 206
                     D+++     S+  L +   + T+        D    AV  G   T+W  D
Sbjct: 291 ----------DIRNFKELHSVENLPTPGTNVTI-------SDTGVLAVSRGPHVTLW-KD 332

Query: 207 FEKSNSNVRLCSGSDDG 223
             KS+ + R C GS +G
Sbjct: 333 ALKSSKSARPCFGSING 349

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,735,473
Number of extensions: 597135
Number of successful extensions: 5048
Number of sequences better than 10.0: 443
Number of HSP's gapped: 3372
Number of HSP's successfully gapped: 1163
Length of query: 328
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 226
Effective length of database: 13,065,073
Effective search space: 2952706498
Effective search space used: 2952706498
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)