Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E21857g27525212471e-175
Sklu_1710.22792546092e-78
Kwal_55.215572712475588e-71
YOR036W (PEP12)2882475405e-68
ACR092C2742515273e-66
CAGL0I01012g2822525083e-63
Scas_699.403112524748e-58
AFL232W301210945e-04
Kwal_34.16287362200900.002
CAGL0G08932g367197900.002
KLLA0C13233g26277880.003
CAGL0G04807g24577870.003
Scas_607.2417205850.010
YOR106W (VAM3)28365840.011
Sklu_2407.1127677820.016
YOL018C (TLG2)39760830.018
KLLA0A10681g36470820.024
Scas_697.4428177800.037
Scas_670.26130550780.096
Sklu_2256.2377140760.13
Kwal_26.841426092740.19
AEL026C349194710.44
YMR183C (SSO2)295133680.94
Scas_512.4111295690.95
YPL232W (SSO1)290133652.5
Scas_502.2111657653.2
AFR210C329100626.2
Kwal_56.24259288249616.9
Scas_720.3231067617.3
YNR016C (ACC1)223382619.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21857g
         (271 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces...   484   e-175
Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement         239   2e-78
Kwal_55.21557                                                         219   8e-71
YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...   212   5e-68
ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...   207   3e-66
CAGL0I01012g complement(82834..83682) similar to sp|P32854 Sacch...   200   3e-63
Scas_699.40                                                           187   8e-58
AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH] complement(...    41   5e-04
Kwal_34.16287                                                          39   0.002
CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces c...    39   0.002
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    39   0.003
CAGL0G04807g complement(458085..458822) similar to sp|Q12241 Sac...    38   0.003
Scas_607.2                                                             37   0.010
YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog (t...    37   0.011
Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement      36   0.016
YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin ...    37   0.018
KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces c...    36   0.024
Scas_697.44                                                            35   0.037
Scas_670.26                                                            35   0.096
Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement         34   0.13 
Kwal_26.8414                                                           33   0.19 
AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH] (585366..58...    32   0.44 
YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin ...    31   0.94 
Scas_512.4                                                             31   0.95 
YPL232W (SSO1) [5217] chr16 (107275..108147) Syntaxin homolog (t...    30   2.5  
Scas_502.2                                                             30   3.2  
AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH] (811271..81...    28   6.2  
Kwal_56.24259                                                          28   6.9  
Scas_720.32                                                            28   7.3  
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...    28   9.7  

>KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces
           cerevisiae YOR036w PEP12 syntaxin (T-SNARE), vacuolar,
           hypothetical start
          Length = 275

 Score =  484 bits (1247), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/252 (95%), Positives = 240/252 (95%)

Query: 1   MSDSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVID 60
           MSDSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVID
Sbjct: 1   MSDSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVID 60

Query: 61  NINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKY 120
           NINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKY
Sbjct: 61  NINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKY 120

Query: 121 QQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY 180
           QQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY
Sbjct: 121 QQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY 180

Query: 181 QQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANE 240
           QQHLIRERDQEISNIEQGITELNGIFKD            DSIEANLYNVEDNTRNAANE
Sbjct: 181 QQHLIRERDQEISNIEQGITELNGIFKDLGGLVQQQGQLVDSIEANLYNVEDNTRNAANE 240

Query: 241 LSRAMRSGRSSS 252
           LSRAMRSGRSSS
Sbjct: 241 LSRAMRSGRSSS 252

>Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement
          Length = 279

 Score =  239 bits (609), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/254 (53%), Positives = 175/254 (68%), Gaps = 7/254 (2%)

Query: 3   DSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNI 62
           DS  E  ++ DSPEFE     IS  LFE+NG LST+  FV  L+     G  NTK ++NI
Sbjct: 6   DSFEENERFVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGSVNTKAVENI 65

Query: 63  NKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQ 122
           NKK V   +  + L  SINE +HKV+ +EE++LD+  LI+REKLTRD K+SVQ F+  Q 
Sbjct: 66  NKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVFQTVQS 125

Query: 123 HFLEVTKRINDMAKVALEDEEQNNSLMDTVLREE-EDEHAKRTQ---VVIEREPINNEEF 178
            F + TK IN+ AK AL  EEQ    +D VLREE ED+H ++ Q   VVIEREPINNEEF
Sbjct: 126 EFAKTTKLINNKAKSALVKEEQG---LDEVLREELEDQHQQQQQQKSVVIEREPINNEEF 182

Query: 179 AYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAA 238
           AYQQ+LIRERD+EISNIE+GI+ELNGIF+D            D+IE N+Y+V ++T++AA
Sbjct: 183 AYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRNSTQSAA 242

Query: 239 NELSRAMRSGRSSS 252
            EL++AM+S R SS
Sbjct: 243 RELNKAMKSQRRSS 256

>Kwal_55.21557
          Length = 271

 Score =  219 bits (558), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 166/247 (67%), Gaps = 7/247 (2%)

Query: 6   NEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNINKK 65
           NE   + D+P+FE+  D I  +LFE+NG LST+  F+  L+ N S G + +K+I N++KK
Sbjct: 9   NEAPHFSDNPQFEEWVDKIMNNLFEMNGHLSTLQQFIKTLQKNQSQGNTRSKMIANLDKK 68

Query: 66  TVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFL 125
           +V  I+  T+L+  IN  +HK+NE+EE+ LD+  LI+R+KLTRD K+SVQEF++ Q+ F 
Sbjct: 69  SVYHINAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRDVKYSVQEFQEAQKEFT 128

Query: 126 EVTKRINDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAYQQHLI 185
             +K +N  AK AL ++E+     D V+  +  E     Q+ IERE INNEEFAYQQ LI
Sbjct: 129 STSKVMNAQAKQALAEDEETRE--DNVINSKSQE-----QITIEREAINNEEFAYQQRLI 181

Query: 186 RERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANELSRAM 245
           +ERD+EI++IE GI ELN IF D            D+IE+N+Y V +NT++ A EL++AM
Sbjct: 182 QERDEEIAHIESGIEELNDIFHDLGTIVQQQGYLVDNIESNIYTVANNTQSGARELTKAM 241

Query: 246 RSGRSSS 252
           RS RSSS
Sbjct: 242 RSQRSSS 248

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score =  212 bits (540), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 165/247 (66%), Gaps = 4/247 (1%)

Query: 10  QYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNINKKTVEL 69
           ++ DSPEF+   + ++ +LFE+NG +ST+  F   L++ +  G  + KV++ INK++V  
Sbjct: 19  RFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAK 78

Query: 70  IDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFLEVTK 129
           I++   L+  +N ++ K++ +EE++LDK  +I REKL RD  +S QEF+  Q+ F +V K
Sbjct: 79  IEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMK 138

Query: 130 RINDMAKVALEDEEQNN--SLMDTVLREEEDEHAK--RTQVVIEREPINNEEFAYQQHLI 185
           ++N+ AK +LE  E  N  +L+D   R+   +  +   +Q+VIER+PINNEEFAYQQ+LI
Sbjct: 139 QVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQNLI 198

Query: 186 RERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANELSRAM 245
            +RDQEISNIE+GITELN +FKD            D+IEAN+Y   DNT+ A++EL +AM
Sbjct: 199 EQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELRKAM 258

Query: 246 RSGRSSS 252
           R  + +S
Sbjct: 259 RYQKRTS 265

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score =  207 bits (527), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 165/251 (65%), Gaps = 3/251 (1%)

Query: 1   MSDSPNEILQYRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVID 60
            S+   E+ +Y D+P+FE+    I  +LFE+NG L T  HF+  LE+N  +GK+NT V++
Sbjct: 4   FSEDTQEVARYSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGKANTMVVE 63

Query: 61  NINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKY 120
           NI+ +++E+I K + LV ++N  +H +N + ++ LD+  L TREKL RD + SVQEF++ 
Sbjct: 64  NISNRSMEVIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRC 123

Query: 121 QQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY 180
           Q  F  + K+IN+ AK++L ++++  +        EE+   ++  +VIEREPINNEEFAY
Sbjct: 124 QSEFAGIRKQINEQAKISLSEQQEEAAGAAA---LEEEAAQQQHHIVIEREPINNEEFAY 180

Query: 181 QQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANE 240
           QQ LIR+RD+EI+NIE+GI ELN +F+D            D IE N+Y    +T +A+NE
Sbjct: 181 QQELIRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNE 240

Query: 241 LSRAMRSGRSS 251
           LSRA+R  R S
Sbjct: 241 LSRALRYQRRS 251

>CAGL0I01012g complement(82834..83682) similar to sp|P32854
           Saccharomyces cerevisiae YOR036w PEP12 syntaxin, start
           by similarity
          Length = 282

 Score =  200 bits (508), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 164/252 (65%), Gaps = 14/252 (5%)

Query: 11  YRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNV--SHGKSNTKVIDNINKKTVE 68
           +RD P FE+  D IS +LFE+NG +ST+  F  +L   +  S    N  V+ NINKK + 
Sbjct: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72

Query: 69  LIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFLEVT 128
            I+   +L+ ++NE++ +++ +E+S LDKP +I R+KL RD++FS+QE +  QQ F ++ 
Sbjct: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132

Query: 129 KRINDMAKVALEDEEQNNSLMDTVLREEEDEHA--------KRTQVVIEREPINNEEFAY 180
           K IN  A+  L +EEQN +    +L+E+E+ H         ++   VIEREPINNEEFAY
Sbjct: 133 KSINAEARGKL-NEEQNWT---ALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAY 188

Query: 181 QQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANE 240
           QQ LI+ERD+EI+NIE+GITELNGIFKD            D+IEAN+Y+  +NT  A+ E
Sbjct: 189 QQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQE 248

Query: 241 LSRAMRSGRSSS 252
           L++A R  + SS
Sbjct: 249 LNKANRMQKRSS 260

>Scas_699.40
          Length = 311

 Score =  187 bits (474), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 159/252 (63%), Gaps = 10/252 (3%)

Query: 11  YRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGKSNTKVIDNINKKTVELI 70
           ++DSPEF+   ++I   LFE+NG + T+  F ++L+ ++  G+  TKV++N+ K+    I
Sbjct: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQIRTKVVENVIKRASTNI 96

Query: 71  DKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFLEVTKR 130
                L+   N+ + +++ L+ + LDK  +I REKL RD ++S+ EF++ Q+ + ++ K 
Sbjct: 97  HNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLVKS 156

Query: 131 INDMAKVAL----------EDEEQNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAY 180
           IND  K AL          +D+    +L     R+E+ +  ++  V I REPINNEEFAY
Sbjct: 157 INDKNKSALLQDQSVKNYTDDDSNKAALSQEQDRQEQLQQQQQQHVEIIREPINNEEFAY 216

Query: 181 QQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANE 240
           QQ+LI+ERD+EI+NIEQGITELN IFKD            D+IEANLY+V DNT+ A+ E
Sbjct: 217 QQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYSVHDNTQMASKE 276

Query: 241 LSRAMRSGRSSS 252
           L+RA RS + S+
Sbjct: 277 LNRARRSQKVST 288

>AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH]
           complement(5332..6237) [906 bp, 301 aa]
          Length = 301

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 87/210 (41%), Gaps = 20/210 (9%)

Query: 59  IDNINKKTVELIDKST---KLVSSI-NENIHKVNELEESALDKPHLITREKLTRDAKFSV 114
           + N+ KK V+L+  +     L +SI +E+I +  +L +     P L  R+K   D  +  
Sbjct: 67  VQNLRKK-VQLLGTARDDHTLRNSIESEDIPRCEQLRDRLQSNPRLTGRDKYVSDLHWLT 125

Query: 115 QEF----KKYQQHFLEVTKR----------INDMAKVALEDEEQNNSLMDTVLR-EEEDE 159
            E     + YQ+  L    R                    +E   NS +   +R +E   
Sbjct: 126 VELLQLKRNYQKRKLGSPLRSKSGAADGGAAAPPGHAPPHEEPGRNSYVSIQVRSDERTP 185

Query: 160 HAKRTQVVIEREPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXX 219
              + Q++ ++E +  EE  +   +   R QEISNI   + ++N IFK            
Sbjct: 186 LLAQQQILRQQEHVPQEELDFHSLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQ 245

Query: 220 XDSIEANLYNVEDNTRNAANELSRAMRSGR 249
            D+I++N+  +  N + A   L +A R  R
Sbjct: 246 VDTIDSNINGLTSNLQGANQHLRKAERYQR 275

>Kwal_34.16287
          Length = 362

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 90/200 (45%), Gaps = 24/200 (12%)

Query: 59  IDNINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLIT----REKLTRDAKFSV 114
           I++++   ++L  KS  +V S+ E+I      +   L +  ++     ++K     + S 
Sbjct: 100 IEDLSYSIIQLFQKSFAIVKSL-ESIKSEQVCDGQTLTRGDIMVLDNLQKKYANKIQLSS 158

Query: 115 QEFKKYQQHFLEVTKR--INDMAKVALEDEEQNNSLMDTVLREEEDEHAKRTQ------- 165
            +F+  Q ++L+   +     + + A        S  DT++  +EDE    TQ       
Sbjct: 159 NKFRLLQNNYLKFLNKDDFKPLPRAA--------SDADTLIALQEDEKNSNTQQEIDSYS 210

Query: 166 -VVIEREPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIE 224
            + ++R+     +    Q+L ++R+QEI+ + +G+ E++ IF++            D I+
Sbjct: 211 RLTLQRQTQRQAQGRSSQYL-QQREQEITQLARGVLEVSSIFREMQDLVVDQGTIIDRID 269

Query: 225 ANLYNVEDNTRNAANELSRA 244
            NL N     + A  EL RA
Sbjct: 270 YNLENTVLELKGAQRELDRA 289

>CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 367

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 97/197 (49%), Gaps = 12/197 (6%)

Query: 57  KVIDNINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQ- 115
           K+I++I+ K ++L  K   ++  + + I+    ++   L++  L+  + + +     +Q 
Sbjct: 104 KLIEDISFKVIQLFQKCYNIMKKL-KGIYDDQTVDGRRLNRGELMILDNVQKSYADKIQI 162

Query: 116 ---EFKKYQQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEE--DEHAKRTQVVIE- 169
              +F+  Q ++L+   + +D+  ++  +  +++S  +T L EE+       R Q  IE 
Sbjct: 163 ESNKFRALQNNYLKFLNK-DDLKPIS-NNTLKSSSANETALLEEDTIGGIGAREQQEIEE 220

Query: 170 --REPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANL 227
             R+ +   +     + +  RD+EI+ + QG+ E++ IF++            D I+ NL
Sbjct: 221 YSRQTLQRRQATSSDNYLHVRDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRIDYNL 280

Query: 228 YNVEDNTRNAANELSRA 244
            N     ++A NEL++A
Sbjct: 281 ENTVIELKSAQNELNKA 297

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 169 EREPI-NNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANL 227
           ++EP+ N +E  +   +  ER Q+IS I   + E+N IFK             D+I  N+
Sbjct: 155 QQEPLLNQDELDFHTIIQHERSQDISKIHSAVQEVNAIFKQLGSLVQEQGEQVDTIGENV 214

Query: 228 YNVEDNTRNAANELSRA 244
             + +N + A  EL +A
Sbjct: 215 TGLSNNLQKANKELHKA 231

>CAGL0G04807g complement(458085..458822) similar to sp|Q12241
           Saccharomyces cerevisiae YOR106w VAM3 syntaxin,
           hypothetical start
          Length = 245

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%)

Query: 168 IEREPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANL 227
           +E+  IN++E  +   +  +R ++IS I   + E+N IFK             D+++ N+
Sbjct: 139 MEQGLINDDELDFHTIVQEDRSRQISRIHSSVQEVNAIFKQLGTLVREQGTQVDTVDENI 198

Query: 228 YNVEDNTRNAANELSRA 244
            N ++N   A  +L+RA
Sbjct: 199 ANFDNNMHRANEQLNRA 215

>Scas_607.2
          Length = 417

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 90/205 (43%), Gaps = 27/205 (13%)

Query: 58  VIDNINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQ-- 115
           VI++++ K ++   K   +   + E I     +E   L+K  LI  + + +     +Q  
Sbjct: 109 VIEDLSYKVIQNFQKCYNITKKL-EKIFNTQMMEGKQLNKGELIILDNILKRYAQKIQGE 167

Query: 116 --EFKKYQQHFLEVTKRINDMAKVA--------------LEDEEQNNSLMDTVLREEEDE 159
              F+  Q  +L+   + +D+  ++              +ED EQ+N       +++ D 
Sbjct: 168 SNRFRVLQNSYLKFLNK-DDLKPISAKPESDTSQMLLFEMEDNEQSN----VEAQQDIDA 222

Query: 160 HAKRTQVVIEREPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXX 219
           ++++T    +     NE     Q  +++RD+EI+ + +G+ E++ IF++           
Sbjct: 223 YSRKTLQRQQELTTTNES---SQQFLQQRDEEITQLAKGVLEVSTIFREMQGLIIDQGTV 279

Query: 220 XDSIEANLYNVEDNTRNAANELSRA 244
            D I+ NL N     + A  EL +A
Sbjct: 280 VDRIDYNLQNTTIQLKEANKELGQA 304

>YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog
           (t-SNARE), required for vacuolar assembly [852 bp, 283
           aa]
          Length = 283

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%)

Query: 180 YQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAAN 239
           +Q  + +ER Q+I  I   + E+N IF               +I+ N+ ++ DN +NA  
Sbjct: 188 FQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANK 247

Query: 240 ELSRA 244
           +L+RA
Sbjct: 248 QLTRA 252

>Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement
          Length = 276

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%)

Query: 173 INNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVED 232
           ++ +E  +   + +ER QEIS I   + E+N IF              D+I+ N+  + +
Sbjct: 174 LSQDELDFHSIIQQERSQEISRIHSAVQEVNAIFHQLGTLVQEQGEQVDTIDNNISGLGN 233

Query: 233 NTRNAANELSRAMRSGR 249
           N + A ++L+ A R  R
Sbjct: 234 NLQKANDQLANAERYQR 250

>YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [1194 bp, 397 aa]
          Length = 397

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%)

Query: 185 IRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANELSRA 244
           +RERD+EI+ + +G+ E++ IF++            D I+ NL N     ++A  EL++A
Sbjct: 247 LRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKA 306

>KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 364

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%)

Query: 182 QHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANEL 241
           Q  +++RD+EI+ + +G+ E++ IF++            D I+ NL N     + A  EL
Sbjct: 232 QQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTVIELKQAQKEL 291

Query: 242 SRAMRSGRSS 251
            +A    + S
Sbjct: 292 DKATHYQKRS 301

>Scas_697.44
          Length = 281

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 168 IEREPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANL 227
           I RE    ++  +Q  + +ER Q+IS I   + E+N IF              D+I+ N+
Sbjct: 176 IRRE--TGDDVDFQTIIQQERSQQISRIHTAVKEVNAIFHQLGSLVQEQGEQVDTIDGNI 233

Query: 228 YNVEDNTRNAANELSRA 244
             +  N + A  +L RA
Sbjct: 234 SQLSGNMQKADEQLRRA 250

>Scas_670.26
          Length = 1305

 Score = 34.7 bits (78), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 146 NSLMDTVLREEEDEHAKRTQVVIEREPINNEEFAYQQHLIRERDQEISNI 195
           N  + T+LR E D+  K TQ++   EP  N   A Q+ L+++RD    NI
Sbjct: 480 NFAIPTLLRLEPDQKEKETQLL---EPFYNLALATQRFLLKKRDANYDNI 526

>Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement
          Length = 377

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 113 SVQEFKKYQQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEE-------DEHAKRT- 164
           S  +F+  Q ++L    + +D   +     +Q+  L+   L+EEE       D ++++T 
Sbjct: 175 SSNKFRVLQNNYLRFLNK-DDFKPLPTASSDQDTLLL---LQEEENDTQQEIDSYSRQTL 230

Query: 165 QVVIEREPINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIE 224
           Q   +R+   N +F      +++R++EI+ + +G+ E++ IF++            D I+
Sbjct: 231 QKQTQRQNSANTQF------LQQREEEITELARGVLEVSTIFREMQNLIIDQGTVVDRID 284

Query: 225 ANLYNVEDNTRNAANELSRA 244
            NL N     + A  EL RA
Sbjct: 285 YNLENTVIELKQAQKELDRA 304

>Kwal_26.8414
          Length = 260

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 163 RTQVVIERE-----PINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXX 217
           R Q+  +R+      ++ +E  +   + +ER +EIS I   + E+N IF           
Sbjct: 143 RAQLQAQRQEQTQSTVSQDELNFHTLVQQERSEEISRIHSAVQEVNAIFHQLGTLVREQG 202

Query: 218 XXXDSIEANLYNVEDNTRNAANELSRAMRSGR 249
              D+I+ N+  +  N + A  +L +A +S R
Sbjct: 203 DDVDNIDNNISGLAGNLQRANEQLGKADQSQR 234

>AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH]
           (585366..586415) [1050 bp, 349 aa]
          Length = 349

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 82/194 (42%), Gaps = 14/194 (7%)

Query: 59  IDNINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQ--- 115
           I+ ++ KT+  + +  + +  +     +    +  AL +  L   E   R     +Q   
Sbjct: 110 IEALSFKTIAGLQRCYEAIKRLQAG-REAQRFQGRALGRGELAILENCCRAYAAKIQAAS 168

Query: 116 -EFKKYQQHFLEVTKRINDMAK---VALEDEEQNNSLMDTVLREEEDEHAKRTQVVIERE 171
             F+  Q ++L+     ND  K    A  D+E    L +   RE + E    +Q  ++++
Sbjct: 169 HRFRVMQNNYLKFLN--NDDFKPLPAATNDQETLQLLEEEGEREAQQELDSYSQQTLQKQ 226

Query: 172 PINNEEFAYQQHLIRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVE 231
                E  Y    + +RD EI+ + +G+ +++ IF++            D I+ NL N  
Sbjct: 227 RQKQRETQY----LEDRDAEITQLAKGVLKVSTIFREMQTLILDQGTVVDRIDYNLENTN 282

Query: 232 DNTRNAANELSRAM 245
            + + A  EL +A+
Sbjct: 283 IDLKQAQRELDQAV 296

>YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin
           homolog (t-SNARE) involved in vesicle transport from
           Golgi to plasma membrane [888 bp, 295 aa]
          Length = 295

 Score = 30.8 bits (68), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 54/133 (40%), Gaps = 25/133 (18%)

Query: 144 QNNSLMDTVLREEEDEHAKRTQVVIEREP-----------INNEEFAYQQHL-------- 184
           Q+  ++D+  +EE  E AKR   +I+ E            +N ++   Q  L        
Sbjct: 131 QDYRIIDSNYKEESKEQAKRQYTIIQPEATDEEVEAAINDVNGQQIFSQALLNANRRGEA 190

Query: 185 ------IRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAA 238
                 ++ R QE+  +E+ + EL  +F D            D I+ N+ + + +     
Sbjct: 191 KTALAEVQARHQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGV 250

Query: 239 NELSRAMRSGRSS 251
              ++A++S R +
Sbjct: 251 GHTNKAVKSARKA 263

>Scas_512.4
          Length = 1112

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 18/95 (18%)

Query: 103 REKLTRD---AKFSVQEFKKYQQHFLEVTKRINDMAKVALEDEEQNNSLMDTVLREEEDE 159
           REK+      A F   + K+Y +HFL+   R+  MA VA ++ + N  ++          
Sbjct: 583 REKILEGILGANFVGFQTKEYARHFLQTANRL-LMADVATDELKFNGKIVS--------- 632

Query: 160 HAKRTQVVIEREPIN----NEEFAYQQHLIRERDQ 190
             K T V I+   +N    +E+    +HLIRER Q
Sbjct: 633 -VKYTPVGIDMFTLNDQLKDEKVLQWRHLIRERWQ 666

>YPL232W (SSO1) [5217] chr16 (107275..108147) Syntaxin homolog
           (t-SNARE) involved in vesicle transport from Golgi to
           plasma membrane [873 bp, 290 aa]
          Length = 290

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 25/133 (18%)

Query: 144 QNNSLMDTVLREEEDEHAKRTQVVIEREPINNEEFA----------YQQHL--------- 184
           Q+  ++D+  +EE  E AKR  ++I+ E   +E  A          + Q L         
Sbjct: 127 QDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLNANRRGEA 186

Query: 185 ------IRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAA 238
                 ++ R QE+  +E+ + EL  +F D            D I+ N+ + + +     
Sbjct: 187 KTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGV 246

Query: 239 NELSRAMRSGRSS 251
               +A++S R +
Sbjct: 247 GHTDKAVKSARKA 259

>Scas_502.2
          Length = 1116

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 132 NDMAKVALEDEEQNNSL-MDTVLREEEDEHAKRTQVVIEREPINNEEFAYQQHLIRE 187
           +D A +  +D    N L MD   ++ +DE A+R    I +E IN E     +H++++
Sbjct: 113 DDQASLGSQDNTTMNGLSMDASFKKRKDEWAERGAAKIIQESINPETGQKMRHVVKK 169

>AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH]
           (811271..812260) [990 bp, 329 aa]
          Length = 329

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 5/100 (5%)

Query: 146 NSLMDTVLREEEDEHAKRTQVVIEREP----INNEEFAYQQHLIRERDQEISNIEQGITE 201
           N  M ++L E++       Q+ +  E     +  ++ A QQ+L +ER + +  IE  I E
Sbjct: 199 NPFMSSLLAEDDASGQPNGQLSLPNEESVLLLEEQQTANQQYL-QERGRAVETIESTIQE 257

Query: 202 LNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANEL 241
           +  +F+               I+AN+ +++ N   A  EL
Sbjct: 258 VGNLFQQLAHMVQEQGETIQRIDANVEDIDINIAGAQREL 297

>Kwal_56.24259
          Length = 288

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 106/249 (42%), Gaps = 49/249 (19%)

Query: 44  ALETNVSHGKSNTKVI---DNINKKTVELIDKSTKLVSSINEN----IHKVNELEESALD 96
           A++ NV H ++    +   + IN+  VEL D  T L++ I+ N    + +VNE +E AL 
Sbjct: 18  AMQDNVEHSQAGGDFVTFMNGINQINVEL-DDYTHLINQIDSNQKRLLTEVNEDQELAL- 75

Query: 97  KPHLITREKLTRDAKFSVQ-EFKKYQQHFLEVTKRINDMAKVALEDEE--------QNNS 147
           + HL +      D ++ ++ + K  QQ      +  +D +K A  +          Q+  
Sbjct: 76  RQHLDSLISRASDLQYQLRNKIKSAQQ------QGASDSSKQAQAENSRQRFLKLIQDYR 129

Query: 148 LMDTVLREEEDEHAKRTQVVIEREPINNEEFA----------YQQHL------------- 184
           +++   +E+  + AKR   +I+ E  ++E  A          + Q L             
Sbjct: 130 IIEANYKEQNKDQAKRQYRIIQPEATDDEVEAAISDVGGQQIFSQALLNANRRGEAKTAL 189

Query: 185 --IRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANELS 242
             ++ R QE+  +E+ + EL  +F D            + I+ N+   + +        +
Sbjct: 190 AEVQARHQELLKLEKTMAELTQLFNDMEQLVIEQQENIEVIDKNVEEAQQDVEQGVGHTN 249

Query: 243 RAMRSGRSS 251
           +A++S R +
Sbjct: 250 KAVKSARRA 258

>Scas_720.32
          Length = 310

 Score = 28.1 bits (61), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 32/67 (47%)

Query: 185 IRERDQEISNIEQGITELNGIFKDXXXXXXXXXXXXDSIEANLYNVEDNTRNAANELSRA 244
           +++R QE+  +E+ + ELN +F D            D I+ N+ + + +        ++A
Sbjct: 212 VQQRHQELLQLEKSMAELNQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGYTNKA 271

Query: 245 MRSGRSS 251
           + S R +
Sbjct: 272 VDSARRA 278

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 47   TNVSHGKSNTK--VIDNINKKTVELIDKSTKLVSSINENIHKVNELEESALDKPHLITRE 104
            T +SH K + K  +I  I K    L   S+K+ +  +  +  + ELE  A  K  L  RE
Sbjct: 968  TVLSHSKVSAKNNLILAILKHYQPLCKLSSKVSAIFSTPLQHIVELESKATAKVALQARE 1027

Query: 105  KLTRDAKFSVQEFKKYQQHFLE 126
             L + A  SV+E  +  +H L+
Sbjct: 1028 ILIQGALPSVKERTEQIEHILK 1049

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,869,929
Number of extensions: 340657
Number of successful extensions: 2161
Number of sequences better than 10.0: 271
Number of HSP's gapped: 2095
Number of HSP's successfully gapped: 291
Length of query: 271
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 171
Effective length of database: 13,134,309
Effective search space: 2245966839
Effective search space used: 2245966839
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)