Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E19437g34231814100.0
AFL073W3351503485e-38
Kwal_56.239673421583214e-34
CAGL0G09218g3791633226e-34
Scas_611.33891333174e-33
YPL193W (RSA1)3811413086e-32
Scas_686.372840672.7
KLLA0E24761g44594644.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E19437g
         (337 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E19437g complement(1721747..1722775) some similarities with...   547   0.0  
AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH] complement(...   138   5e-38
Kwal_56.23967                                                         128   4e-34
CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces c...   128   6e-34
Scas_611.3                                                            126   4e-33
YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic prote...   123   6e-32
Scas_686.3                                                             30   2.7  
KLLA0E24761g 2191359..2192696 similar to sp|P20049 Saccharomyces...    29   4.6  

>KLLA0E19437g complement(1721747..1722775) some similarities with
           sp|Q08932 Saccharomyces cerevisiae YPL193w RSA1
           nucleoplasmic protein involved in assembly of 60S
           ribosomal subunits singleton, hypothetical start
          Length = 342

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/318 (85%), Positives = 272/318 (85%)

Query: 20  LLQHTLQTTRMQYYPIPQMNQPNQYGVPAMQHAPMGMRYGTHHPFYPNPHQYQQSWYGFN 79
           LLQHTLQTTRMQYYPIPQMNQPNQYGVPAMQHAPMGMRYGTHHPFYPNPHQYQQSWYGFN
Sbjct: 20  LLQHTLQTTRMQYYPIPQMNQPNQYGVPAMQHAPMGMRYGTHHPFYPNPHQYQQSWYGFN 79

Query: 80  QAQPPYVDVTKSSKINYDDXXXXXXXXVIEHQQSNLEANDKIEVPKKGPIKKFANTNLRN 139
           QAQPPYVDVTKSSKINYDD        VIEHQQSNLEANDKIEVPKKGPIKKFANTNLRN
Sbjct: 80  QAQPPYVDVTKSSKINYDDEEEEEEEEVIEHQQSNLEANDKIEVPKKGPIKKFANTNLRN 139

Query: 140 SALVENKIAXXXXXXXXXXXXXXXXXXXXXXXXXXTVKGSDLYIPGTSIVLKTEEDIAKW 199
           SALVENKIA                          TVKGSDLYIPGTSIVLKTEEDIAKW
Sbjct: 140 SALVENKIASDEDDKRKEEEDEEEEEASADEDIIETVKGSDLYIPGTSIVLKTEEDIAKW 199

Query: 200 KEERRKMWLIKISNKKEMYREKFNVKDEDLNRNPLQESRKERYFIQNIQNQVKRFNYKPN 259
           KEERRKMWLIKISNKKEMYREKFNVKDEDLNRNPLQESRKERYFIQNIQNQVKRFNYKPN
Sbjct: 200 KEERRKMWLIKISNKKEMYREKFNVKDEDLNRNPLQESRKERYFIQNIQNQVKRFNYKPN 259

Query: 260 LTIGLHQRILKEENGKILDFIKELGDANXXXXXXXXXXXXVLFGGKDHKNDQNRRSNRRY 319
           LTIGLHQRILKEENGKILDFIKELGDAN            VLFGGKDHKNDQNRRSNRRY
Sbjct: 260 LTIGLHQRILKEENGKILDFIKELGDANYLKYELTEEEKEVLFGGKDHKNDQNRRSNRRY 319

Query: 320 DRQLNQRDTQYRNHSRKR 337
           DRQLNQRDTQYRNHSRKR
Sbjct: 320 DRQLNQRDTQYRNHSRKR 337

>AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH]
           complement(298718..299725) [1008 bp, 335 aa]
          Length = 335

 Score =  138 bits (348), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 93/150 (62%), Gaps = 3/150 (2%)

Query: 180 DLYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDLNRNPLQESRK 239
           D  I GTSIVL T EDI KW+ ERRKMWL+KISN+KE + E+  V +++L  +PL + RK
Sbjct: 174 DGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQELRCSPLVQGRK 233

Query: 240 ERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANXXXXXXXXXXXX 299
           ++ FI  IQ+ V RF  K NL++GL QR +  EN KIL FIKELGDAN            
Sbjct: 234 DKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELGDANLLEHVLTEKEKE 293

Query: 300 VLFGGKDHKNDQNRR--SNRRYDRQLNQRD 327
            LF GK  +  +NR+  + R +  Q + R 
Sbjct: 294 ALF-GKAMRAAENRKQFAGRSFTSQNDGRG 322

>Kwal_56.23967
          Length = 342

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 99/158 (62%), Gaps = 1/158 (0%)

Query: 181 LYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKD-EDLNRNPLQESRK 239
           + IPGTSI L++EEDI KW+EERRKMWL+KISN++E +R++  V++ E  N    Q+ +K
Sbjct: 178 VAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEEKEPTNAGAFQQVKK 237

Query: 240 ERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANXXXXXXXXXXXX 299
           ++ FIQ+IQNQ+ R N  PNL++ L QR + EEN  +L+FI+ELGDA             
Sbjct: 238 DKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELGDAKLLEYELTEEEKN 297

Query: 300 VLFGGKDHKNDQNRRSNRRYDRQLNQRDTQYRNHSRKR 337
           VLFG    +N      NR+         ++Y  +++K+
Sbjct: 298 VLFGNTFKRNKPRADFNRKRPNFTRDGPSRYEGNTKKQ 335

>CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces
           cerevisiae YPL193w RSA1, start by similarity
          Length = 379

 Score =  128 bits (322), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 102/163 (62%), Gaps = 5/163 (3%)

Query: 177 KGSDLYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDLNR--NPL 234
           +G+ + IPGTSI L+TEEDI KWK+ERRKMWL++ISN K+ + EK   KDEDL +  N L
Sbjct: 198 EGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKETNVL 257

Query: 235 QESRKERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANXXXXXXX 294
           +ESRK++ FI+NIQ+Q+ R N   NL   L QR + EEN K+LDFI ELG+         
Sbjct: 258 KESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELGECGFLEYELT 317

Query: 295 XXXXXVLFGGKDHKNDQNRRS--NRRYDRQLNQRDTQYRNHSR 335
                 LFGG  +    NR++   RR +   N++  +Y   SR
Sbjct: 318 EEEKEKLFGGYSNNFSNNRKNYHGRRNNNNSNEK-REYNGASR 359

>Scas_611.3
          Length = 389

 Score =  126 bits (317), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 88/133 (66%), Gaps = 2/133 (1%)

Query: 181 LYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDL--NRNPLQESR 238
           + +PGTSI L T+EDI KW+EERRKMWL+KISN K+ + E+  +K+ED+   ++ L ESR
Sbjct: 215 IVVPGTSISLVTDEDIIKWREERRKMWLLKISNNKQKHMEEMGLKEEDVKKQKSVLVESR 274

Query: 239 KERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANXXXXXXXXXXX 298
           K+  FIQ+IQNQV RFN K NL + L QR +  +N K+LDFI  LGDA            
Sbjct: 275 KQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSKLLDFITNLGDAGLLEYELTQDEK 334

Query: 299 XVLFGGKDHKNDQ 311
             LFGG  + +D+
Sbjct: 335 DKLFGGFGNHDDK 347

>YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic protein
           involved in assembly of 60S ribosomal subunits [1146 bp,
           381 aa]
          Length = 381

 Score =  123 bits (308), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 90/141 (63%), Gaps = 2/141 (1%)

Query: 178 GSDLYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDLNRNP--LQ 235
           G  + +PGTSI L T+ED+ KW+EER+KMWL+KISN K+ + ++  +K+++L   P   +
Sbjct: 224 GKVVLVPGTSIALITDEDVKKWREERKKMWLLKISNNKQKHMQEMGIKEDELKSQPSIFK 283

Query: 236 ESRKERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELGDANXXXXXXXX 295
           ESRKE+ FIQ+IQNQV+R N K +L + L QR    EN ++LDFI+ELGD          
Sbjct: 284 ESRKEKQFIQSIQNQVQRGNPKIDLNLKLIQREFANENSQLLDFIRELGDVGLLEYELSQ 343

Query: 296 XXXXVLFGGKDHKNDQNRRSN 316
               VLFG  +  N  + + N
Sbjct: 344 QEKDVLFGSSEDNNKNHYKPN 364

>Scas_686.3
          Length = 728

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 176 VKGSDLYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKK 215
           V G DLY P + ++      I K++E  R  WL K+S +K
Sbjct: 281 VCGVDLYYPHSQVLDVANACIVKYEEYLRPTWLKKLSKRK 320

>KLLA0E24761g 2191359..2192696 similar to sp|P20049 Saccharomyces
           cerevisiae YBR166c TYR1 prephenate dehydrogenase (NADP+)
           singleton, start by similarity
          Length = 445

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 27/94 (28%)

Query: 189 VLKTEEDIAKWKEER-------------------RKMWLIKISNKKEMY---REKFNVKD 226
           ++ T+E IAKWK E+                   +  W +   ++ E Y   +EK++ + 
Sbjct: 1   MIGTDEQIAKWKHEKTIGIIGLGDMGLLYATRFSKAGWRVICCDRPEFYEELKEKYSSES 60

Query: 227 EDLNRNPLQESRKERYFI-----QNIQNQVKRFN 255
            ++  N    SR   Y I     +NI+N VK + 
Sbjct: 61  FNVVENGTLVSRASDYIIYSVEAENIENIVKMYG 94

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,947,403
Number of extensions: 410883
Number of successful extensions: 1502
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1511
Number of HSP's successfully gapped: 30
Length of query: 337
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 235
Effective length of database: 13,065,073
Effective search space: 3070292155
Effective search space used: 3070292155
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)