Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E19393g33633114040.0
AFL072C3141912531e-24
Kwal_56.239583561972373e-22
YGL081W3201221349e-09
Scas_720.14d1961201151e-06
Scas_516.528937662.1
Kwal_56.2415830756662.3
CAGL0L13112g103749672.4
AER389C75841672.6
Scas_538.148662645.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E19393g
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E19393g 1720040..1721050 no similarity, hypothetical start       545   0.0  
AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [...   102   1e-24
Kwal_56.23958                                                          96   3e-22
YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containin...    56   9e-09
Scas_720.14d                                                           49   1e-06
Scas_516.5                                                             30   2.1  
Kwal_56.24158                                                          30   2.3  
CAGL0L13112g complement(1399816..1402929) similar to tr|Q07999 S...    30   2.4  
AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH] (1367924..1...    30   2.6  
Scas_538.1                                                             29   5.4  

>KLLA0E19393g 1720040..1721050 no similarity, hypothetical start
          Length = 336

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/331 (82%), Positives = 273/331 (82%)

Query: 1   MYQFIKTPHTTRTIEFNGSHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVK 60
           MYQFIKTPHTTRTIEFNGSHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVK
Sbjct: 1   MYQFIKTPHTTRTIEFNGSHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVK 60

Query: 61  KLPPTNDEESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLD 120
           KLPPTNDEESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLD
Sbjct: 61  KLPPTNDEESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLD 120

Query: 121 EPVSVNQQRGAKLKFNLNIRPGAWPFNYRIVLTDVTDQKSPCTSRSSDFLDSIMQHVSDE 180
           EPVSVNQQRGAKLKFNLNIRPGAWPFNYRIVLTDVTDQKSPCTSRSSDFLDSIMQHVSDE
Sbjct: 121 EPVSVNQQRGAKLKFNLNIRPGAWPFNYRIVLTDVTDQKSPCTSRSSDFLDSIMQHVSDE 180

Query: 181 SDSENAWSKATDWNEEIKVEIGKXXXXXXXXXXXXXXXXLKPTXXXXXXXXXXXXXXXXX 240
           SDSENAWSKATDWNEEIKVEIGK                LKPT                 
Sbjct: 181 SDSENAWSKATDWNEEIKVEIGKEDEVVAVVDDTAPTVALKPTSDPSTLSSSKESSVSGN 240

Query: 241 XXXRACIYINXXXXXXXXXXXHTFMDPEKKHHHFKCRYKRGRGNRSRWSTFRVNKAXXXX 300
              RACIYIN           HTFMDPEKKHHHFKCRYKRGRGNRSRWSTFRVNKA    
Sbjct: 241 SHSRACIYINSDSDSDSGYDDHTFMDPEKKHHHFKCRYKRGRGNRSRWSTFRVNKAKGKK 300

Query: 301 XXXXXXXDLYSGSLGFMLGSIGTLGVLATVA 331
                  DLYSGSLGFMLGSIGTLGVLATVA
Sbjct: 301 FGRKRRFDLYSGSLGFMLGSIGTLGVLATVA 331

>AFL072C [3121] [Homologous to ScYGL081W - SH] (300464..301408) [945
           bp, 314 aa]
          Length = 314

 Score =  102 bits (253), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 102/191 (53%), Gaps = 10/191 (5%)

Query: 9   HTTRTIEFNGSHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVKKLP-PTND 67
           H  R + FN + G+  +IG+  + D  + +   NL F +  L  +HA L VK+   P   
Sbjct: 7   HEQRRLIFNINEGLAEVIGRASERDAERVARADNLFFAERSLSKQHAMLYVKRFTGPGGA 66

Query: 68  EESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLDEPVSVNQ 127
           ++    NI   RI++E LG    +VDL+S       ++IDLKNG+RFG+V +D+P++  Q
Sbjct: 67  QDGDEENI---RIWVEDLGSTHGLVDLQSTARGVS-QLIDLKNGERFGVVYMDKPITSTQ 122

Query: 128 QRGAKLKFNLNIRPGAWPFNYRIVLTDVTDQKSPCTSRSS--DFLDSIMQHVSDESDSEN 185
            RGA+LKF +N+     P  + +++ DVT   SPC ++ S  D  D  +     E  S+ 
Sbjct: 123 SRGARLKFQVNVMQKQGPL-WELLVRDVTFGDSPCITKGSPLDGTDGSLTPYHTEPSSD- 180

Query: 186 AWSKATDWNEE 196
            WS +  W  E
Sbjct: 181 -WSYSEMWCGE 190

>Kwal_56.23958
          Length = 356

 Score = 95.9 bits (237), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 108/197 (54%), Gaps = 10/197 (5%)

Query: 12  RTIEFN----GSHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVKKLPPTND 67
           R I FN       G++  IG+   +D  +     N ++ +  L  +HA L +K+L P++D
Sbjct: 10  RKITFNIKETEGAGLQFPIGRASFKDPQRSDRNDNFMYHEKSLSKKHAMLCIKRLIPSDD 69

Query: 68  EESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLDEPVSVNQ 127
           +  +P+ +  FRI ++ LG    +VDL+S DS  +  IIDLKNG+RFGL+RL  P++  Q
Sbjct: 70  DPFVPL-LCQFRISVQDLGSTHGLVDLQSQDS--EASIIDLKNGERFGLIRLHHPIAPGQ 126

Query: 128 QRGAKLKFNLNIRPGAWPFN---YRIVLTDVTDQKSPCTSRSSDFLDSIMQHVSDESDSE 184
            RGAKLKF + I+      +     ++L +VT + SP  SR +   D  ++     S   
Sbjct: 127 SRGAKLKFQVLIKSNENEDDDGTLDLILRNVTHEDSPYVSRPATSADLELETQLTSSSCS 186

Query: 185 NAWSKATDWNEEIKVEI 201
            + S   +++E++ +E+
Sbjct: 187 TSSSSEMNYSEDLDLEL 203

>YGL081W (YGL081W) [1901] chr7 (357378..358340) Protein containing a
           forkhead associated (FHA) domain, which bind
           phosphopeptides [963 bp, 320 aa]
          Length = 320

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 19  SHGIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAKLVVKKLPPTNDEESLPMNIDSF 78
           + G+   IG+    D++      NL FD+ +L  +HA L +K   P    E +P +I+  
Sbjct: 17  TQGLCKTIGRSSSFDQNSLCKPYNLYFDEPELSRQHAVLCIK--TPIPKIEGVP-SIEQL 73

Query: 79  RIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLD-EPVSVNQQRGAKLKFNL 137
           RI +  L +    V+L S   N +   IDLKNGD FGL+ +D  P   N    AKL F +
Sbjct: 74  RICIRDLNNKTGTVNLVSDGPNDE---IDLKNGDAFGLIAIDNHPFRDNHHLAAKLIFRI 130

Query: 138 NI 139
            +
Sbjct: 131 EL 132

>Scas_720.14d
          Length = 196

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 2   YQFIKTPHTTRTIEFNGSH-----GIEVIIGKEVKEDESKHSSESNLIFDDDDLFVEHAK 56
           Y  I T H  R I F         GI + IG             +NL F +  L  +HA+
Sbjct: 19  YIEIMTTHFKRNIYFKEQEALREEGINIPIG-------YGDPQIANLEFSNSALEKKHAR 71

Query: 57  LVVKKLPPTNDEESLPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGL 116
           LV+K  P  ++E  +P  + +FR ++E L + + IVDL S    +   I++LKNG+ F +
Sbjct: 72  LVIKMFPSVSNE-GIP--VPNFRAHVEDLTEGNGIVDLYSKKDPSFNNIVELKNGESFAI 128

>Scas_516.5
          Length = 289

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 5/37 (13%)

Query: 262 HTFMDPEKKHHHFK-----CRYKRGRGNRSRWSTFRV 293
           +T  DP  K H  K      R KR R NR +W  FRV
Sbjct: 170 YTTFDPSTKEHCIKKGTISVRVKRVRFNRKKWKLFRV 206

>Kwal_56.24158
          Length = 307

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 90  RIVDLESADSNT-DGKIIDLKNGDRFGLVRLDEPVSVNQQRGAKLKFNLNIRPGAW 144
           R +D +  DS T D K+  L++   F L+++D+ V + ++   +   +L   PGAW
Sbjct: 31  RWIDRQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAW 86

>CAGL0L13112g complement(1399816..1402929) similar to tr|Q07999
           Saccharomyces cerevisiae YLR071c DNA-directed RNA
           polymerase II holoenzyme subunit, hypothetical start
          Length = 1037

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%), Gaps = 4/49 (8%)

Query: 116 LVRLDEPV--SVNQQ--RGAKLKFNLNIRPGAWPFNYRIVLTDVTDQKS 160
           +++LD P+  SVN +  +   L+ ++ IR  +WP N+ ++LT V+   S
Sbjct: 529 VIKLDNPIATSVNSEEIKTNLLQNDMFIRLASWPVNWYLILTIVSSNSS 577

>AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH]
           (1367924..1370200) [2277 bp, 758 aa]
          Length = 758

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 35  SKHSSESNLIFDDDDLFVEHAKLVVKKLPPTNDEESLPMNI 75
           S   ++S+L+ D+ DL+    KLV+ KLPP + E  L  +I
Sbjct: 700 SPSKNDSHLLVDNKDLYKTLQKLVITKLPPESFEAQLLSSI 740

>Scas_538.1
          Length = 486

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 71  LPMNIDSFRIYLESLGDADRIVDLESADSNTDGKIIDLKNGDRFGLVRLDEPVSVNQQRG 130
           +P+ I+   IYLE+  D    + L   ++++ GKI DL       LV L++P    QQ+ 
Sbjct: 106 IPLFIEQLYIYLEAQSDLQYQIGLSVWEADSKGKIRDL-------LVPLNDP---QQQKS 155

Query: 131 AK 132
            K
Sbjct: 156 LK 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,606,352
Number of extensions: 402259
Number of successful extensions: 1467
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1494
Number of HSP's successfully gapped: 20
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)