Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E19371g34831616230.0
Kwal_56.239543773398061e-106
AFL071C3513287534e-98
YGL082W3813337512e-97
Scas_720.144033387229e-93
YPL191C3603116214e-78
CAGL0G09251g3633055842e-72
CAGL0H03289g3853405731e-70
Scas_611.4*2992605294e-65
Scas_675.1760297820.037
KLLA0E11231g114836790.11
ACR273W151107710.36
Scas_621.678185681.8
KLLA0F01342g46937636.1
YKL159C (RCN1)21161618.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E19371g
         (343 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces...   629   0.0  
Kwal_56.23954                                                         315   e-106
AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH] (3...   294   4e-98
YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF...   293   2e-97
Scas_720.14                                                           282   9e-93
YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member...   243   4e-78
CAGL0G09251g complement(882028..883119) similar to sp|Q08930 Sac...   229   2e-72
CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces c...   225   1e-70
Scas_611.4*                                                           208   4e-65
Scas_675.17                                                            36   0.037
KLLA0E11231g 988846..992292 similar to sp|P38426 Saccharomyces c...    35   0.11 
ACR273W [1320] [Homologous to ScYKL096W (CWP1) - NSH] complement...    32   0.36 
Scas_621.6                                                             31   1.8  
KLLA0F01342g 124864..126273 similar to sp|P38348 Saccharomyces c...    29   6.1  
YKL159C (RCN1) [3111] chr11 complement(153821..154456) Protein t...    28   8.5  

>KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 348

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/316 (97%), Positives = 308/316 (97%)

Query: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL 60
           MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL
Sbjct: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL 60

Query: 61  EDLITTLANIGVMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLFQV 120
           EDLITTLANIGVMMDNGQSEDVNE        HTGLNVNPAFNGTFQDDQALALFRLFQV
Sbjct: 61  EDLITTLANIGVMMDNGQSEDVNELLQLLPQLHTGLNVNPAFNGTFQDDQALALFRLFQV 120

Query: 121 SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKS 180
           SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKS
Sbjct: 121 SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKS 180

Query: 181 FLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNI 240
           FLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNI
Sbjct: 181 FLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNI 240

Query: 241 VWQSLKSVKGNQDSFFTSEFLLTTLEQATASGLDPNSNGSQLDEETPMTDEQLARLLQEE 300
           VWQSLKSVKGNQDSFFTSEFLLTTLEQATASGLDPNSNGSQLDEETPMTDEQLARLLQEE
Sbjct: 241 VWQSLKSVKGNQDSFFTSEFLLTTLEQATASGLDPNSNGSQLDEETPMTDEQLARLLQEE 300

Query: 301 EDARAVRGIRSRQDRR 316
           EDARAVRGIRSRQDRR
Sbjct: 301 EDARAVRGIRSRQDRR 316

>Kwal_56.23954
          Length = 377

 Score =  315 bits (806), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 220/339 (64%), Gaps = 25/339 (7%)

Query: 3   FETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTLED 62
           F  K + ++G +  ILLQNENGPCAL+AL NVL+LSPQ    A  L QL+ +  +V L +
Sbjct: 5   FVVKGVDINGCSHRILLQNENGPCALIALCNVLLLSPQCARYAGPLTQLVANKSEVALRE 64

Query: 63  LITTLANIGVMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLFQVSL 122
           LIT LANIGV +  G   DV+         HTGL++NP FNG+F+D   +ALFRLF VS+
Sbjct: 65  LITILANIGVQIPQGAQMDVDRLLQSLPQLHTGLSINPIFNGSFEDGDEMALFRLFNVSI 124

Query: 123 VHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQV------ENSEQILQDAQ 176
           VHGWI D   +  QY  VS YSY++AQ +L+ AYDIQ+            ++EQ+L+DA 
Sbjct: 125 VHGWIADYADDPAQYEHVSKYSYEEAQKVLIEAYDIQHGSGSPASPNPGHSAEQVLEDAG 184

Query: 177 YLKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKK 236
           Y+KSFLARSATQLTEYG+  L++LL E+S++V FRNDHFSTI K+   LY LVTDLG+K 
Sbjct: 185 YIKSFLARSATQLTEYGLHQLRELLIENSFAVLFRNDHFSTIVKHKNELYALVTDLGYKD 244

Query: 237 ASNIVWQSLKSVKGNQDSFFTSEFLLTTLEQ------ATASG-------LDPNSNGSQLD 283
             NIVW+SLKSV G+QD+F+T  F+  T+++      +  SG        DP ++ +   
Sbjct: 245 DENIVWESLKSVNGSQDTFYTGRFIPATMQKTNTQVTSLTSGSRANNPFSDPFTSSAHER 304

Query: 284 EETP--MTDEQLARLLQEEEDARAVRGIR----SRQDRR 316
            E    ++DEQ AR LQEEEDAR  R I+    + Q RR
Sbjct: 305 SENSNGLSDEQYARQLQEEEDARVARNIQRQYEASQSRR 343

>AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH]
           (301720..302775) [1056 bp, 351 aa]
          Length = 351

 Score =  294 bits (753), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 215/328 (65%), Gaps = 14/328 (4%)

Query: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL 60
           + F TK I V+G    ILLQNENGPCAL+AL+NVL+LSP +    ++L  L  +   VTL
Sbjct: 3   LTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAP-TVTL 61

Query: 61  EDLITTLANIGVMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLFQV 120
            DL+  LA+I + +      D++          TGL ++PAFNGTF++   +ALFR+FQV
Sbjct: 62  RDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQV 121

Query: 121 SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKS 180
            LVH W++D ++  Q Y  +S  SY++AQ LLV AYDIQ   +  E ++Q+LQDA  L+S
Sbjct: 122 GLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQGSVASEKADQLLQDAHILRS 181

Query: 181 FLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNI 240
           FL+RSATQ+T YG+QHL+++L E +Y+V FRNDHF+TI K  G L++LVTDLG++   +I
Sbjct: 182 FLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYRHDI 241

Query: 241 VWQSLKSVKGNQDSFFTSEFLLTTLE------QATASGLDP--NSNGSQLDEETP----- 287
           VWQSL    G++D+F+T +F+ T LE        TA+G DP  + N +      P     
Sbjct: 242 VWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDTAAGEDPFADKNATFSAPSLPPDSAF 301

Query: 288 MTDEQLARLLQEEEDARAVRGIRSRQDR 315
           +TDE+LAR LQ+EED   VR ++ +Q+R
Sbjct: 302 LTDEELARHLQQEEDGLYVRSLQRQQER 329

>YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF544
           protein of unknown function family, has moderate
           similarity to uncharacterized S. cerevisiae Ypl191p
           [1146 bp, 381 aa]
          Length = 381

 Score =  293 bits (751), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 212/333 (63%), Gaps = 28/333 (8%)

Query: 3   FETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTLED 62
           F TK ++++G    ILLQN  G CAL+AL NVL++SP H   A E+ +L+     VTL +
Sbjct: 5   FLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETVTLNE 64

Query: 63  LITTLANIGVMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLFQVSL 122
           L+ TLA++GV   NG   D  +        ++GLN+NP FNG+F+D   +++FRL+ V +
Sbjct: 65  LVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLYNVGI 124

Query: 123 VHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKSFL 182
           VHGWI+D   +   Y  VS YSY  AQ +LV +Y+IQ N  Q ENSEQI  DA YLKSFL
Sbjct: 125 VHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQIQSDAPYLKSFL 184

Query: 183 ARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNIVW 242
           ARSATQLTEYG+ HL+++L E SY+V FRNDHF T++KNNG L+ LVTD  ++   +I W
Sbjct: 185 ARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRKDINW 244

Query: 243 QSLKSVKGNQDSFFTSEFLLTTLE--QATASG----------------------LDPNSN 278
           QSLKSV G+QDS++T  F+ T+LE  + TA+G                      ++  ++
Sbjct: 245 QSLKSVNGSQDSYYTGNFIPTSLERTETTATGQNESYISNPFSDQNTGHVTSNQVNSGAS 304

Query: 279 GSQLDEETPMTDEQLARLLQEEEDARAVRGIRS 311
           G Q  E+    DE+LAR LQE+ED RA   +++
Sbjct: 305 GVQQIED----DEELARRLQEQEDMRAANNMQN 333

>Scas_720.14
          Length = 403

 Score =  282 bits (722), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 215/338 (63%), Gaps = 34/338 (10%)

Query: 3   FETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLIN--SNRKVTL 60
           F+TKT+ ++G    ILL+NE GP ALVALTNVL+LSP  +  A ELIQL+N  SN  V+ 
Sbjct: 5   FQTKTVDINGTQHKILLENEQGPTALVALTNVLLLSPGLQQTAYELIQLVNNASNNFVSW 64

Query: 61  EDLITTLANIGVMMDNGQSEDVNEXXXXXXXX-HTGLNVNPAFNGTFQDDQALALFRLFQ 119
            +L+  L+ +G+   N  S   NE          +GLNVNP FNG+F+D   ++LFRLF 
Sbjct: 65  NELLQVLSRVGLQNHNYVSNLNNEQLVQYLPQLQSGLNVNPGFNGSFEDGIEMSLFRLFN 124

Query: 120 VSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLK 179
           V +VHGWI+D   +   Y  V+ Y+Y+ AQ LLV +YDI+ N LQV+N + IL+DA Y+K
Sbjct: 125 VGIVHGWIIDGDNDPVAYDHVARYTYESAQRLLVQSYDIKKNNLQVDNKDLILEDANYIK 184

Query: 180 SFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASN 239
           SFLARSATQLTEYG++HL+++L E  ++V FRN+ + T++KNNG LY LVTDL  +  ++
Sbjct: 185 SFLARSATQLTEYGLKHLKEILVERGFAVLFRNEVYVTLYKNNGQLYTLVTDLQHRNDTD 244

Query: 240 IVWQSLKSVKGNQDSFFTSEFLLTTLEQATASGL----------------DPNSNGSQLD 283
           I+WQSLKSV G QDS++T  F+ T+LE+    G                 +P S+ +Q  
Sbjct: 245 IIWQSLKSVNGTQDSYYTGNFISTSLERTNGYGPPQAAALQNPQIESVVSNPFSDQNQTS 304

Query: 284 EET--PM-------------TDEQLARLLQEEEDARAV 306
            +   P+             TDE+LAR LQ+EED+RA 
Sbjct: 305 RQRTQPVETFHEDTRGQQLETDEELARRLQDEEDSRAA 342

>YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member of
           the DUF544 protein of unknown function family, has
           moderate similarity to uncharacterized S. cerevisiae
           Ygl082p [1083 bp, 360 aa]
          Length = 360

 Score =  243 bits (621), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 200/311 (64%), Gaps = 4/311 (1%)

Query: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL 60
           + F TK++K++G    ILLQNENGPCAL+AL N+L+LSP H   +NELI+L+N   +++L
Sbjct: 3   LSFTTKSVKINGQNHRILLQNENGPCALLALANILILSPDHTRFSNELIRLVNKGSQISL 62

Query: 61  EDLITTLANIGVMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLFQV 120
           ++LI  LA+I + + +  S D++E        H GLN+NP FNG+F++ + +++FRLF V
Sbjct: 63  KELIEVLADIALQVTDKPSTDISELLSLLPRLHEGLNINPEFNGSFENTKEMSIFRLFNV 122

Query: 121 SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQYLKS 180
            +VHGW+++   NE     +SHYSY+ AQ +L  A DI     Q ENS+++L+DA +L  
Sbjct: 123 DVVHGWVINSFINENIDEKLSHYSYESAQRILTQAADINCGISQDENSDEVLRDAMHLGL 182

Query: 181 FLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKASNI 240
           FL  S TQLT +G+  L++ L  + +S+ FRNDHFST+ K    LY LVTD G+K   +I
Sbjct: 183 FLNESPTQLTAFGLLRLREKLLHNKFSILFRNDHFSTLFKYEDRLYTLVTDFGYKNCKDI 242

Query: 241 VWQSLKSVKGNQDSFFTSEFLLTTLE-QATASGLDPN-SNGSQLDEETPMT--DEQLARL 296
           VWQSL SV G+ D+FF   F    +  Q  ++ ++ +   G+ L EE      D++LA+ 
Sbjct: 243 VWQSLDSVDGSCDAFFAGNFSAAEVNGQQLSTDIERDFGTGNLLLEEIQQIENDKELAKQ 302

Query: 297 LQEEEDARAVR 307
           LQE+E  R  +
Sbjct: 303 LQEQEQERVTK 313

>CAGL0G09251g complement(882028..883119) similar to sp|Q08930
           Saccharomyces cerevisiae YPL191c, hypothetical start
          Length = 363

 Score =  229 bits (584), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 127/305 (41%), Positives = 189/305 (61%), Gaps = 16/305 (5%)

Query: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTL 60
           M F TK I+VDG  R+IL+QNENGPCALVALTNVL+LS  H  + +EL++L+   +KV L
Sbjct: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVLLLSSHH--EHSELLELVQP-KKVDL 57

Query: 61  EDLITTLANIGVMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLFQV 120
           + L+T LA+I +   N + E+++         HTGLN+NP F+GTF+D + L++F+LF +
Sbjct: 58  DQLLTVLADIAIAT-NPKDEELSVLLSLLPQLHTGLNINPRFDGTFEDTKELSVFKLFDI 116

Query: 121 SLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNN---GLQVENSEQILQDAQY 177
            ++HGWI    +       V  Y+Y+++Q LL  A DI++    G      + IL +A  
Sbjct: 117 DIIHGWISSDDK-------VQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANL 169

Query: 178 LKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKKA 237
           ++ FL  S+TQLT  G+ ++   ++E +Y+V FRNDHF+TI K+NG  Y LVTDLGF+  
Sbjct: 170 IEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSC 229

Query: 238 SNIVWQSLKSVKGNQDSFFTSEFLLTTLEQATASGLDPNSNGSQLDEETPMTDEQLARLL 297
           +NIVW+ + S+ G+ D FF   F  T L     + ++      ++  E    D QLA+ L
Sbjct: 230 NNIVWEYMGSIDGSNDIFFDGIFEETELNDTAYTTMEATERKERV--EQVDKDAQLAQQL 287

Query: 298 QEEED 302
           Q EE+
Sbjct: 288 QLEEN 292

>CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 385

 Score =  225 bits (573), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/340 (40%), Positives = 199/340 (58%), Gaps = 29/340 (8%)

Query: 3   FETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLINSNRKVTLED 62
           +  K+I+  G    ILL  +    ALVALTN LVLS  H    ++L  + ++  ++ +ED
Sbjct: 5   YSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHNRVTSQLKSIFDNCNEIAVED 64

Query: 63  LITTLANIG----VMMDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALFRLF 118
           L+  LANIG    VM + GQ  D  +          GL++NP FNG+F D    ++F  F
Sbjct: 65  LLDELANIGLQLGVMSNYGQ--DKEQLIATLKEFRKGLHINPKFNGSFTDSLETSVFSGF 122

Query: 119 QVSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQN--NGLQVE-NSEQILQDA 175
            V+LVHGW+VD  R+   Y+ +S YSY++AQ +LV AY+I+   NG+ +  N++Q+L D+
Sbjct: 123 NVALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAYEIRKDQNGVALNTNAQQVLDDS 182

Query: 176 QYLKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFK 235
            Y+KSFLARSATQLTEYG+QHL+++L E S++V FRND + T++KN G L++LVT+    
Sbjct: 183 AYIKSFLARSATQLTEYGLQHLKEILVEKSFAVLFRNDRYFTLYKNAGELFILVTNPSQS 242

Query: 236 KASNIVWQSLKSVKGNQDSFFTSEFLLTTL--EQATASGL---------DPNSN------ 278
           + +NIVWQSL SV G +D ++   F+      +Q T   +         DP +N      
Sbjct: 243 RNNNIVWQSLHSVNGARDLYYNGVFVEINPDNDQNTFDDVVVPQSNPFSDPQTNQEFQNI 302

Query: 279 --GSQLDEETPMTDEQLARLLQEEEDARAVRGIRSRQDRR 316
                 D +    DE LAR LQEEED +A  G+     RR
Sbjct: 303 DRNDTFDAQQVEDDELLARQLQEEEDRQAA-GLMQNAYRR 341

>Scas_611.4*
          Length = 299

 Score =  208 bits (529), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 162/260 (62%), Gaps = 23/260 (8%)

Query: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANELIQLI-NSNRKVT 59
           ++F  K I++ G    ILLQNENGPCAL+A+ N+L++SPQHK     L +L+      V+
Sbjct: 5   LQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVS 64

Query: 60  LEDLITTLANIGVM----MDNGQSEDVNEXXXXXXXXHTGLNVNPAFNGTFQDDQALALF 115
           L+++   LANI +     M      D+++        HTGLN+NP F+GTF+D   +ALF
Sbjct: 65  LDEVNQVLANIALQSNTEMKGSNGADMDQLLELLPHLHTGLNINPKFDGTFEDSNEMALF 124

Query: 116 RLFQVSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDA 175
           R+F++ +VHGW+++         ++S YSY+ AQ +L+ A          E  E+ + +A
Sbjct: 125 RMFKIPIVHGWVIE---------TLSKYSYESAQQVLLKA---------AEGDEEAVGEA 166

Query: 176 QYLKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFK 235
             ++ F   + TQLT+ G+ +L  +L+E  + V FRNDHFSTI+K N  LY LVTDLG++
Sbjct: 167 TLIQLFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYR 226

Query: 236 KASNIVWQSLKSVKGNQDSF 255
           +  +IVW+++KS+ G++D+F
Sbjct: 227 RRKDIVWENIKSIDGSEDTF 246

>Scas_675.17
          Length = 602

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 25/97 (25%)

Query: 118 FQVSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNNGLQVENSEQILQDAQY 177
           F   LVHG    PT  +   HS +H S  D  +               EN  Q LQ+   
Sbjct: 242 FPQPLVHG--PTPTNRDSSGHSTNHTSITDGPH---------------ENIYQQLQE--- 281

Query: 178 LKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDH 214
               L +SAT+L   G +H++++    S+ +++R+DH
Sbjct: 282 ----LEQSATELVP-GNKHIRRMFSRCSFPIYYRHDH 313

>KLLA0E11231g 988846..992292 similar to sp|P38426 Saccharomyces
           cerevisiae YMR261c TPS3 alpha, alpha-trehalose-phosphate
           synthase, 115 KD subunit, start by similarity
          Length = 1148

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 26/36 (72%)

Query: 42  KLDANELIQLINSNRKVTLEDLITTLANIGVMMDNG 77
           +L AN ++ L+NSN +  LE L + ++N+G++ +NG
Sbjct: 887 ELSANNIVYLMNSNSRGVLERLYSRVSNVGLIAENG 922

>ACR273W [1320] [Homologous to ScYKL096W (CWP1) - NSH]
           complement(853045..853500) [456 bp, 151 aa]
          Length = 151

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 46/107 (42%), Gaps = 14/107 (13%)

Query: 214 HFSTIHKNNG---------GLYVLVTD---LGFKKAS-NIVWQSLKSVKGNQDSFFTSEF 260
           H+S+IH  NG         GL  +VTD   L F   +  +V Q    V+G++D+  T  F
Sbjct: 37  HYSSIHPVNGQLKVIGKPDGLSAVVTDDRKLKFSDGTYAVVTQKGPVVEGSKDNASTGFF 96

Query: 261 LLTTLEQATASGLDPNSNGSQLD-EETPMTDEQLARLLQEEEDARAV 306
           +     Q       P  NG   D   TP TD ++   ++   ++  V
Sbjct: 97  VADGHLQYADLSFMPAPNGDSFDLSVTPSTDPRVVLAIRATNNSGGV 143

>Scas_621.6
          Length = 781

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 100 PAFNGTFQDDQALALFRLFQVSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQ 159
           P  NG F  D A  + ++  V++ +GW +D         S ++ SY+D         D  
Sbjct: 346 PYVNGPFTPDLATPISKMKDVAVANGWPLD--VRVGLIGSCTNSSYEDMSRAASIIKDAA 403

Query: 160 NNGLQVENSEQILQDAQYLKSFLAR 184
           ++GL+ +    +   ++ +++ + R
Sbjct: 404 SHGLKAKTIFTVTPGSEQIRATIER 428

>KLLA0F01342g 124864..126273 similar to sp|P38348 Saccharomyces
           cerevisiae YBR272c HSM3 mismatch repair protein
           singleton, start by similarity
          Length = 469

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 163 LQVENSEQILQDAQYLKSFLARSATQLTEYGIQHLQQ 199
           L+ E + + L D  Y++  L      LT YGIQHL +
Sbjct: 361 LKDEINSKTLNDMPYIEKMLLLDGLTLTSYGIQHLTR 397

>YKL159C (RCN1) [3111] chr11 complement(153821..154456) Protein
          that modulates calcineurin function [636 bp, 211 aa]
          Length = 211

 Score = 28.1 bits (61), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 11/61 (18%)

Query: 13 LTRNILLQ---NENGPCALVALTN---VLVLSP-----QHKLDANELIQLINSNRKVTLE 61
          L++NIL +   NEN P  L+ L     +L++ P     QH +DA+  +++ N N   +L+
Sbjct: 31 LSKNILRKFQINENEPLQLIILKRFKRILLICPSHDISQHVMDASRALEMENFNFSYSLQ 90

Query: 62 D 62
          D
Sbjct: 91 D 91

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,222,221
Number of extensions: 442970
Number of successful extensions: 1524
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1531
Number of HSP's successfully gapped: 25
Length of query: 343
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 241
Effective length of database: 13,065,073
Effective search space: 3148682593
Effective search space used: 3148682593
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)