Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E16797g67164129070.0
Scas_699.3570946612991e-171
YOR033C (EXO1)70245412831e-168
Sklu_1321.265644912781e-168
Kwal_55.1998164546012371e-162
CAGL0H08085g67436911981e-156
AER387C65545011761e-153
YDR263C (DIN7)43042810471e-137
Scas_538.64123689761e-126
Kwal_26.76873802431852e-14
KLLA0F02992g3812401833e-14
AFR133C9701321776e-13
CAGL0K11506g3812431682e-12
Scas_717.643793361673e-12
CAGL0F08327g9921231679e-12
YGR258C (RAD2)10311231642e-11
Scas_645.810001241605e-11
Sklu_2443.2510331251597e-11
Sklu_2149.23812431522e-10
YKL113C (RAD27)3822071495e-10
Kwal_23.434310311231508e-10
KLLA0A09427g10111921453e-09
ABL052C3792821319e-08
Scas_687.237451671151e-05
YER041W (YEN1)759571087e-05
KLLA0A01320g5843061078e-05
Kwal_47.191686732321052e-04
CAGL0C02255g648129970.002
AER414W76975870.025
AFR238W698117820.092
Scas_709.54470117750.63
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E16797g
         (660 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E16797g 1487301..1489316 some similarities with sp|P39875 S...  1124   0.0  
Scas_699.35                                                           504   e-171
YOR033C (EXO1) [4845] chr15 complement(392415..394523) Double-st...   498   e-168
Sklu_1321.2 YOR033C, Contig c1321 793-2763                            496   e-168
Kwal_55.19981                                                         481   e-162
CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces c...   466   e-156
AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C (...   457   e-153
YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondr...   407   e-137
Scas_538.6                                                            380   e-126
Kwal_26.7687                                                           76   2e-14
KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces c...    75   3e-14
AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH] (675260..67...    73   6e-13
CAGL0K11506g 1114740..1115885 highly similar to sp|P26793 Saccha...    69   2e-12
Scas_717.64                                                            69   3e-12
CAGL0F08327g complement(829426..832404) similar to sp|P07276 Sac...    69   9e-12
YGR258C (RAD2) [2205] chr7 complement(1007676..1010771) Structur...    68   2e-11
Scas_645.8                                                             66   5e-11
Sklu_2443.25 YGR258C, Contig c2443 54418-57519                         66   7e-11
Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement          63   2e-10
YKL113C (RAD27) [3150] chr11 complement(224373..225521) Single-s...    62   5e-10
Kwal_23.4343                                                           62   8e-10
KLLA0A09427g complement(821244..824279) similar to sp|P07276 Sac...    60   3e-09
ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH] (300564..30...    55   9e-08
Scas_687.23                                                            49   1e-05
YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nucleas...    46   7e-05
KLLA0A01320g complement(118369..120123) weakly similar to sp|P40...    46   8e-05
Kwal_47.19168                                                          45   2e-04
CAGL0C02255g complement(228009..229955) similar to sp|P40028 Sac...    42   0.002
AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH] complement(...    38   0.025
AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH] complement(...    36   0.092
Scas_709.54                                                            33   0.63 

>KLLA0E16797g 1487301..1489316 some similarities with sp|P39875
           Saccharomyces cerevisiae YOR033c DHS1 exonuclease which
           interacts with MSH2P, hypothetical start
          Length = 671

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/641 (85%), Positives = 550/641 (85%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI
Sbjct: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60

Query: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQ 120
           KRISMLRHFKITPFFVFDGDSIQVKKETEL               LFEAGDRRLAYDYFQ
Sbjct: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELKRAEKRKENREKAHALFEAGDRRLAYDYFQ 120

Query: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180
           KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT
Sbjct: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180

Query: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240
           RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT
Sbjct: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240

Query: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300
           AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI
Sbjct: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300

Query: 301 PNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNRE 360
           PNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNRE
Sbjct: 301 PNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNRE 360

Query: 361 HKLRLKSQSVVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNNGSGIMSKLETALKR 420
           HKLRLKSQSVVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNNGSGIMSKLETALKR
Sbjct: 361 HKLRLKSQSVVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNNGSGIMSKLETALKR 420

Query: 421 RKLSGPANEHSTKKVVNSQFFAAKRXXXXXXXXXXXXXXGLAYSAAFHSDTFSDVMLLDS 480
           RKLSGPANEHSTKKVVNSQFFAAKR              GLAYSAAFHSDTFSDVMLLDS
Sbjct: 421 RKLSGPANEHSTKKVVNSQFFAAKREPKAVPKVEPKPEPGLAYSAAFHSDTFSDVMLLDS 480

Query: 481 DEESETQTGEQQKKEPSQKLSQEDXXXXXXXXXXXXXXXXXXFNEKEKKDALSMAXXXXX 540
           DEESETQTGEQQKKEPSQKLSQED                  FNEKEKKDALSMA     
Sbjct: 481 DEESETQTGEQQKKEPSQKLSQEDVETEVPSSLVPSSEPDSSFNEKEKKDALSMAEEESE 540

Query: 541 XXXXXXXXXXXXXXXXXXXXXNQILAALRNKFLHTGGLTENIETSKNRPKERVPLKNVTN 600
                                NQILAALRNKFLHTGGLTENIETSKNRPKERVPLKNVTN
Sbjct: 541 VLSEVEEKEKTEEEDLQKKQDNQILAALRNKFLHTGGLTENIETSKNRPKERVPLKNVTN 600

Query: 601 IMRVTSTKTKXXXXXXXXXXXXXXXXXXARRTMSGAMTAMQ 641
           IMRVTSTKTK                  ARRTMSGAMTAMQ
Sbjct: 601 IMRVTSTKTKIPEISSQPIPKPIPTPRPARRTMSGAMTAMQ 641

>Scas_699.35
          Length = 709

 Score =  504 bits (1299), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 251/466 (53%), Positives = 327/466 (70%), Gaps = 26/466 (5%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG+ GLLPQLKPIQNPV L RY+G+TLAIDGYAWLHR+A SCA ELAM++PT KYLQFFI
Sbjct: 1   MGIQGLLPQLKPIQNPVGLHRYEGQTLAIDGYAWLHRAACSCAYELAMEKPTQKYLQFFI 60

Query: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQ 120
           K+ SMLR F I P+ VFDGDSI VKK TEL               L+ +G+++ A DYFQ
Sbjct: 61  KKFSMLRKFNIEPYLVFDGDSIPVKKGTELKRRERRVENRAIAERLWTSGEKKNAMDYFQ 120

Query: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180
           KCV ITPDMAKCVI+Y ++N I Y+VAP+EAD+QMVYLE+ G+VQGIISEDSDLLVFGC 
Sbjct: 121 KCVDITPDMAKCVIDYCKVNQINYIVAPFEADSQMVYLEQTGIVQGIISEDSDLLVFGCR 180

Query: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240
           RLITKLND  ECIEI + +F +L   KFPL +L  +  R+LVCLSGCDYT GIPKVGLVT
Sbjct: 181 RLITKLNDYGECIEICKDDFNKLPR-KFPLGQLNMECFRTLVCLSGCDYTDGIPKVGLVT 239

Query: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300
           AMK V K R M++++++I+R+GKL +P TF +EY+ AN+AFQ+QRV+CP++ R+V LN I
Sbjct: 240 AMKMVYKLRNMDRILLSIQRDGKLKIPTTFKDEYKLANYAFQYQRVFCPISRRIVPLNKI 299

Query: 301 PNELLNNEKLF---NCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLV 357
           P E    + L     CIG+ IH++ ++K  + + ED+DH LH RI+ G+LNPYDF++PL 
Sbjct: 300 PEEKFTADDLIILSQCIGNVIHRDSQVKQCVINDEDIDHELHARIANGDLNPYDFHRPLT 359

Query: 358 NREHKLRL------------KSQSVVMTIDKF---CTAKTTAGSSAN---SKSMNAFIAR 399
           NRE KL+L            K+Q     ID F      K T   + N   +K +  F++ 
Sbjct: 360 NREQKLQLVSKSEMGISIPSKNQGETKGIDSFFKKTALKVTEKKAVNVVQNKKIPQFLST 419

Query: 400 KSQSLNNGSGIM-SKLETALKRRKLSGPANEHSTKKVVNSQFFAAK 444
            S ++NN +     +LE  LKRRKLS   N+++  ++ +S   ++K
Sbjct: 420 SSFNINNKNKTHEGRLEAMLKRRKLS---NQNTKSQIEDSTTTSSK 462

>YOR033C (EXO1) [4845] chr15 complement(392415..394523)
           Double-stranded DNA 5'->3' exonuclease, involved in
           mismatch repair and recombination [2109 bp, 702 aa]
          Length = 702

 Score =  498 bits (1283), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 248/454 (54%), Positives = 324/454 (71%), Gaps = 19/454 (4%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG+ GLLPQLKPIQNPVSL RY+GE LAIDGYAWLHR+A SCA ELAM +PTDKYLQFFI
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60

Query: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQ 120
           KR S+L+ FK+ P+ VFDGD+I VKK TE                L+  G+++ A DYFQ
Sbjct: 61  KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ 120

Query: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180
           KCV ITP+MAKC+I Y ++N I Y+VAP+EAD+QMVYLE++ +VQGIISEDSDLLVFGC 
Sbjct: 121 KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR 180

Query: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240
           RLITKLND  EC+EI R NF +L + KFPL  LT +++ ++VCLSGCDYT+GIPKVGL+T
Sbjct: 181 RLITKLNDYGECLEICRDNFIKLPK-KFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239

Query: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300
           AMK V +  T+E++I++I+REGKL +P T+  EY+ A  AFQFQRV+CP+ +++V+LN I
Sbjct: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299

Query: 301 PNELLNNE----KLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPL 356
           P  L + E    +L+ CIG  IH+E + K ++   +D+DHHLH +I+ G+LNPYDF++PL
Sbjct: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPL 359

Query: 357 VNREHKLRLKSQSVVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNN---GSGIMS- 412
            NREHKL+L S+S +    +F    TT  S A  K + +F  + ++  +N    + I S 
Sbjct: 360 ANREHKLQLASKSNI----EFGKTNTT-NSEAKVKPIESFFQKMTKLDHNPKVANNIHSL 414

Query: 413 -----KLETALKRRKLSGPANEHSTKKVVNSQFF 441
                KL  A+KRRKLS       T K   S+FF
Sbjct: 415 RQAEDKLTMAIKRRKLSNANVVQETLKDTRSKFF 448

>Sklu_1321.2 YOR033C, Contig c1321 793-2763
          Length = 656

 Score =  496 bits (1278), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 321/449 (71%), Gaps = 10/449 (2%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG+ GLLPQLKPIQ P +L RY G+TLAIDGYAWLHR+AHSCAMELA DQPT KYLQFFI
Sbjct: 1   MGIQGLLPQLKPIQQPATLRRYSGQTLAIDGYAWLHRAAHSCAMELATDQPTTKYLQFFI 60

Query: 61  KRISMLRH-FKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYF 119
           KR++MLR  F ITP+ VFDGDSI VKKET+                L+  GD++ + +YF
Sbjct: 61  KRLTMLRSTFNITPYLVFDGDSINVKKETDSKRREKRQENKERGLKLWHMGDKKRSLEYF 120

Query: 120 QKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGC 179
           QKCV+ITP+MAKCVIEY ++  + Y+VAP+EADAQMVYLE  G   GIISEDSDLL+FGC
Sbjct: 121 QKCVAITPEMAKCVIEYCKVQKVQYIVAPFEADAQMVYLENHGFAHGIISEDSDLLIFGC 180

Query: 180 TRLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLV 239
            RLITKLND  ECIEI   +F  L   KFPL +L  +++R +VCLSGCDYTSGIP+VGL+
Sbjct: 181 RRLITKLNDYGECIEICSDDFNHL-PSKFPLCQLNREEIRMMVCLSGCDYTSGIPQVGLL 239

Query: 240 TAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNA 299
           TAMK V K R M++++++I+REGKL +P  F +EYQ ANFAFQFQRV+CP ++R+VTLN 
Sbjct: 240 TAMKLVKKFRNMDKILLSIQREGKLKIPQDFTQEYQLANFAFQFQRVFCPKSQRIVTLNV 299

Query: 300 IPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNR 359
           IP  L NN+ +F C+G  I K+ KIK V+ D +D+DH LH+ +SLGELNPYDF+KPLVNR
Sbjct: 300 IPETLYNNKLVFQCVGKVISKQHKIKTVVEDDDDIDHDLHRLVSLGELNPYDFHKPLVNR 359

Query: 360 EHKLRLKSQS---VVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNNGSGIMSKLET 416
           EH+L+L S+S   ++   +       T  S  + K ++     K+Q ++  +   +KL +
Sbjct: 360 EHRLQLVSKSEPILINNRENENNKNNTIDSFFHRKKLSTPKMAKNQEIDIQNA-NNKLGS 418

Query: 417 ALKRRKLSGPANEHSTKKVVNSQFFAAKR 445
            ++RRKL    +   +     S+FFA  +
Sbjct: 419 TVERRKLCKVDDNLGS----TSKFFATAK 443

>Kwal_55.19981
          Length = 645

 Score =  481 bits (1237), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 312/460 (67%), Gaps = 26/460 (5%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG+ GLLPQLK IQ PV+L RY G+TLAIDGYAWLHR+AHSCA ELA+ +PT KYL+FF+
Sbjct: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60

Query: 61  KRISMLRH-FKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYF 119
           KR++ML++ + I P+ VFDGD+I VKK+TE+               L+ +G++R AY+YF
Sbjct: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTEVKRKSKRVESREKALALWRSGEKRQAYEYF 120

Query: 120 QKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGC 179
           QKCV +TP+MAKCVIEY Q+ +I YVVAP+EADAQMVYLEK GLV GIISEDSDLL+FGC
Sbjct: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180

Query: 180 TRLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLV 239
            RLITKLND+ E IEI   +F+ L   KFPLS+L+ +++R +VCLSGCDYT+GIPKVGL+
Sbjct: 181 RRLITKLNDHGEGIEICSDDFQYLPH-KFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLL 239

Query: 240 TAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNA 299
           TAMK V K+RT++ +I  I+REGK +VP  F  EYQ A FAFQFQRV+CP    + TLN 
Sbjct: 240 TAMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNV 299

Query: 300 IPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNR 359
           IP +LL    LF  IG  I KE   K+VI D   VDH  H RI+ GEL PY+  K LVNR
Sbjct: 300 IPEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNR 359

Query: 360 EHKLRLKSQ----------SVVMTIDKF----CTAKTTAGSSANSKSMNAFIARKSQSLN 405
           E KL+L ++          S V  ID F         +A S+  S  + A I ++ +   
Sbjct: 360 ERKLQLSTKSEPILSRSTTSTVGKIDSFFGKSALVSVSAASTGASAQVRAAIRKQEEKQI 419

Query: 406 NGSGIMSKLETALKRRKLSGPANEHSTKKVVN---SQFFA 442
               I  KL + ++RRKLS     H+T  V     S+FF+
Sbjct: 420 E---ISRKLVSTVERRKLS----RHNTPVVAGVGMSRFFS 452

>CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces
           cerevisiae YOR033c DHS1 or sp|Q12086 Saccharomyces
           cerevisiae YDR263c DIN7, start by similarity
          Length = 674

 Score =  466 bits (1198), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 209/369 (56%), Positives = 287/369 (77%), Gaps = 2/369 (0%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG+ GLLPQLKPIQNPVSL RY+G+TL IDGYAWLHR++ SCA ELAM  PT+KYL+FFI
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGQTLGIDGYAWLHRASCSCAYELAMGLPTEKYLKFFI 60

Query: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQ 120
           KR +ML+ F +TP+ VFDGDSI VK+ET                 L+++G++R A DYFQ
Sbjct: 61  KRFNMLKSFGVTPYLVFDGDSINVKQETNKKRREKRQENREIAMRLWQSGNKRNAMDYFQ 120

Query: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180
           KCV +TP+M KCVI+Y + N I Y+VAP+EAD QMVYLEK+GL+QGII+EDSDLLVFGC 
Sbjct: 121 KCVDVTPEMVKCVIDYCKNNGIKYIVAPFEADPQMVYLEKKGLIQGIIAEDSDLLVFGCR 180

Query: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240
           RL+TKLND  ECIEI R +F +L   KFP+ +L+ +++R +VCLSGCDYT+GIP++GL+ 
Sbjct: 181 RLVTKLNDFGECIEICRDSFGQLT-SKFPIGQLSNEEIRMMVCLSGCDYTNGIPRIGLIK 239

Query: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300
           A+K V+ +R M++++M+++ EGK SVP  F++EY+YA+++FQFQRV+CPL++++V+L  I
Sbjct: 240 AIKLVMTHRNMDRILMSLQTEGKFSVPENFYDEYRYADYSFQFQRVFCPLSKQIVSLTEI 299

Query: 301 PNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNRE 360
           P  L +++ L +CIG AI +    K    + +++DH +H  ++ G+LNPYDF K LVNRE
Sbjct: 300 PMGLQSDKILHSCIGKAICRLDGTKRYCLN-DEIDHEIHGYLARGDLNPYDFTKRLVNRE 358

Query: 361 HKLRLKSQS 369
           HKL+L+S+S
Sbjct: 359 HKLQLQSKS 367

>AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C
           (DIN7) - SH] (1363438..1365405) [1968 bp, 655 aa]
          Length = 655

 Score =  457 bits (1176), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 228/450 (50%), Positives = 302/450 (67%), Gaps = 11/450 (2%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG++GLLPQLK IQ PV+L RY+ + LAIDGYAWLHRSAHSCA EL M QPT+KYLQFF+
Sbjct: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60

Query: 61  KRISMLR-HFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYF 119
           KR+++LR  + I P+ VFDG  I+VK  TE                L+E G+RR +++YF
Sbjct: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120

Query: 120 QKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGC 179
           QKCV ITP+M K +I+Y       YVVAPYEAD Q+VYLEK GLVQGIISEDSDLLVFGC
Sbjct: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180

Query: 180 TRLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLV 239
            RLITKLND  E  EI R +F  L + KFPL+ L E  LR++VCL+GCDYT GIP+VGL+
Sbjct: 181 RRLITKLNDYGEGFEICRDDFVHLPD-KFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLL 239

Query: 240 TAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNA 299
           TA+K VVK++TM+Q+++ IKREGK  VP  F +EY++A+ AFQFQRV+CPL  +L TLN 
Sbjct: 240 TAVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNE 299

Query: 300 IPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNR 359
           +P+ L  +  L+ CIGHA+HK    + VI D   +DH +H RI++G+LNP +  + L+NR
Sbjct: 300 VPSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINR 359

Query: 360 EHKLRLKSQSVVMTIDKF-CTAKTTAGSSANSKSMNAFIARKS---QSLNNGSGIMSKLE 415
           E +L +    V +T+    CT+  T   S + K     +        S     G+M ++E
Sbjct: 360 ERQLGVDKGVVHLTVSSVPCTSAPTRPVSTSWKIKQTTVEPGPPVRTSAGTSLGVMDRIE 419

Query: 416 TALKRRKLSGPANEHSTKKVVNSQFFAAKR 445
             +++RKL   A+ H  +  +N   F  +R
Sbjct: 420 RIVQKRKL---ADSHEGQ--LNESTFFVRR 444

>YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondrial
           inner membrane nuclease with a role in stabilizing the
           mitochondrial genome, expression is induced by DNA
           damage [1293 bp, 430 aa]
          Length = 430

 Score =  407 bits (1047), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 203/428 (47%), Positives = 281/428 (65%), Gaps = 20/428 (4%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MG+ GLLPQLK IQ  VSL +Y  +TLAIDGYAWLHR++ +CA EL M++PT+KYLQFFI
Sbjct: 1   MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFI 60

Query: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQ 120
           KR+ +L+  KI P+ VFDGDS+ VK  TE                L+ AG+R  A +YFQ
Sbjct: 61  KRLQLLKRLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYFQ 120

Query: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180
           K V ITP+MAKC+I+Y +++SIPY+VAP+EAD QMVYLEK GL+QGIISEDSDLLVFGC 
Sbjct: 121 KSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGCK 180

Query: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240
            LITKLND  + +EI + +F  L E  FPL +L+E Q R+LVCL+GCDYTSGI KVG+VT
Sbjct: 181 TLITKLNDQGKALEISKDDFSALPEN-FPLGELSEQQFRNLVCLAGCDYTSGIWKVGVVT 239

Query: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300
           AMK V +   M+ +++ I+R  KL     F ++ ++AN+AFQ+QRV+CPL+ ++ TLN I
Sbjct: 240 AMKIVKRYSEMKDILIQIERTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNI 299

Query: 301 PNELLNNE----KLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPL 356
           P  + N+     K+  CIG  + +   ++  + + +++DH +H+ I+ GEL+P D    L
Sbjct: 300 PKAVTNSHAEIIKIMKCIGSVVERGSGVRKDVINTKNIDHKVHEMIAKGELHPVDMASKL 359

Query: 357 VNREHKLRLKSQSVVMTIDKFCTAKTTAGSSANSKSMNAFIARKSQSLNNGSGIMSKLET 416
           +NRE KL+ +         K        G S      N+F  +  Q L +   ++S+ E 
Sbjct: 360 INRERKLKAR---------KLFKVGLLGGES------NSFNKKVEQPLVDTQDVLSEREN 404

Query: 417 ALKRRKLS 424
           +L  +  S
Sbjct: 405 SLDNKNAS 412

>Scas_538.6
          Length = 412

 Score =  380 bits (976), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 256/368 (69%), Gaps = 5/368 (1%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
           MGV+GLLP LK IQ  V+L +Y G TL ID Y+WLH++A SCA ELAMD+PT+KYLQ+FI
Sbjct: 1   MGVAGLLPHLKTIQKHVTLKKYAGMTLGIDAYSWLHKAACSCAYELAMDKPTEKYLQYFI 60

Query: 61  KRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQ 120
           ++ ++++   I P+ +FDGD+I VK E E                L+  G+R+ A ++FQ
Sbjct: 61  RKFNLMKKLNIKPYLIFDGDAILVKGEVESSRLNKRKTNKLMGEKLWRIGERKAATEFFQ 120

Query: 121 KCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCT 180
           K V+IT  MAK +I Y + NSI YVVAP+EAD+QMVYLEK   VQGIISEDSDL+VFG  
Sbjct: 121 KSVNITTQMAKHIINYCRENSIQYVVAPFEADSQMVYLEKTVQVQGIISEDSDLIVFGSK 180

Query: 181 RLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVT 240
           RLITKLN+  ECIEI   +F  L  GKFP  +L+ DQ+R LVCLSGCDYT GI K+GLVT
Sbjct: 181 RLITKLNEFGECIEIASCDFGDLT-GKFPFGELSMDQIRMLVCLSGCDYTVGIWKIGLVT 239

Query: 241 AMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAI 300
           A+K V +   M+ ++  IK  GK S+   F +EY+YAN++FQ+QRV+ P   R+VTLN I
Sbjct: 240 AIKLVRQFDNMDDIVNHIKESGKYSLNCNFLQEYKYANYSFQYQRVFDPKENRIVTLNRI 299

Query: 301 PNELLNNEK----LFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPL 356
           P EL N+ K    +  CIG+ I K+  IK ++ + +D+DH++H  I+ G+L+P+++ + L
Sbjct: 300 PTELKNDRKELGIVGQCIGNVISKKSGIKSIVVNDDDIDHNIHTMIANGDLDPHNWKETL 359

Query: 357 VNREHKLR 364
           ++RE  L 
Sbjct: 360 ISREEYLH 367

>Kwal_26.7687
          Length = 380

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 111/243 (45%), Gaps = 15/243 (6%)

Query: 24  GETLAIDG----YAWLHRSAHSCAMELAMD--QPTDKYLQFFIKRISMLRHFKITPFFVF 77
           G  +AID     Y +L        ++LA +  + T   +  F + + M+ +  I P +VF
Sbjct: 28  GRKVAIDASMSLYQFLIAVRQQDGVQLASESGETTSHLMGIFYRTLRMIDN-GIKPCYVF 86

Query: 78  DGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQKCVSITPDMAKCVIEYL 137
           DG    + K  EL               L EA +      + ++ V +TP+      + L
Sbjct: 87  DGKP-PILKSHELDKRSARRATTEEK--LKEAVEEAEKLKHERRLVRVTPEHNDEAKKLL 143

Query: 138 QMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLN-DNAECIEID 196
           ++  +PYV AP EA+AQ   L K G V    SED D L +    L+  L    A+   I 
Sbjct: 144 RLMGLPYVEAPCEAEAQCAELAKAGKVYAAASEDMDTLCYRTPYLLRHLTFSEAKKEPIH 203

Query: 197 RRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMIM 256
             N E L +G     +LT +Q   L  + GCDY   I  VG VTA+K + +++T+E ++ 
Sbjct: 204 EINVEVLLQG----LELTIEQFIDLGIMLGCDYCDSIRGVGPVTALKLIKEHKTLENIVQ 259

Query: 257 AIK 259
            I+
Sbjct: 260 YIE 262

>KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces
           cerevisiae YKL113c RAD27 ssDNA endonuclease and 5 -3
           exonuclease, start by similarity
          Length = 381

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 109/240 (45%), Gaps = 13/240 (5%)

Query: 22  YQGETLAIDG----YAWLHRSAHSCAMELAMD--QPTDKYLQFFIKRISMLRHFKITPFF 75
           + G  +AID     Y +L        ++LA +  + T   +  F + + M+ H  I P +
Sbjct: 26  FHGRKVAIDASMSLYQFLIAVRQQDGVQLAGEDGETTSHLMGMFYRTLRMIDH-GIKPCY 84

Query: 76  VFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQKCVSITPDMAKCVIE 135
           VFDG   ++KK                   L EA ++     + ++ V + P   +   +
Sbjct: 85  VFDGSPPELKK---YELDKRKVRREDTEAKLKEATEQAEIIKHERRLVKVLPWHNEEAQK 141

Query: 136 YLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLNDNAECIEI 195
            L +  IPYVVAP EA+AQ   L K G V    SED D L +    L+  L   +E  ++
Sbjct: 142 LLSLMGIPYVVAPAEAEAQCAELAKSGKVFAAASEDMDTLCYQTPVLLRHLT-FSEARKL 200

Query: 196 DRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMI 255
             + F+   +  +    LT+ Q   L  + GCDY  GI  VG V A+K + ++ ++E ++
Sbjct: 201 PIQEFD--TDVIYNTLDLTQTQFIDLGIILGCDYCEGIKGVGPVNALKLIKEHGSLEAIV 258

>AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH]
           (675260..678172) [2913 bp, 970 aa]
          Length = 970

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 75/132 (56%), Gaps = 10/132 (7%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +TP+M + + + L +  IPY+ AP EA+AQ   L +  L+ GII++DSD+ +FG +++  
Sbjct: 705 VTPEMIRDIQQLLSIFGIPYLTAPMEAEAQCAELLRLKLIDGIITDDSDVFLFGGSKVFK 764

Query: 185 KLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLR--SLVCLSGCDYTSGIPKVGLVTAM 242
            +      +E    N E ++      ++L  D+L+  +L  L G DYT+GI  +G V+ +
Sbjct: 765 NMFQEKNYVEY--YNTETIS------AELGLDRLKFIALAQLMGSDYTNGIKGIGPVSGI 816

Query: 243 KYVVKNRTMEQM 254
           + +    T+E+ 
Sbjct: 817 EILANYNTLEEF 828

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
          MGV  L   L P   PV L       +A+D   W+++     A +   ++    ++  F 
Sbjct: 1  MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQFLK-AARDKNGNRLKGAHIIGFF 59

Query: 61 KRISMLRHFKITPFFVFDGDSIQVKKET 88
          +RI  L +F I P FVFDG    +K+ET
Sbjct: 60 RRICKLLYFGIKPVFVFDGGVPPLKRET 87

>CAGL0K11506g 1114740..1115885 highly similar to sp|P26793
           Saccharomyces cerevisiae YKL113c RAD27 ssDNA
           endonuclease and 5 -3 exonuclease, start by similarity
          Length = 381

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 106/243 (43%), Gaps = 15/243 (6%)

Query: 24  GETLAIDGYAWLH------RSAHSCAMELAMDQPTDKYLQFFIKRISMLRHFKITPFFVF 77
           G  +AID    L+      R      +     + T   +  F + + M+ +  I P +VF
Sbjct: 28  GRKVAIDASMSLYQFLIAVRQQDGGQLSTETGETTSHLMGMFYRTLRMIDN-GIKPCYVF 86

Query: 78  DGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQKCVSITPDMAKCVIEYL 137
           DG    V K  EL               L EA +      + ++ V ++ +      + L
Sbjct: 87  DGKP-PVLKSHELDKRTSRREETEKK--LAEATEEAEKMKHERRLVKVSKEHNDEAKKLL 143

Query: 138 QMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLN-DNAECIEID 196
           ++  IPYV AP EA+AQ   L K+G V    SED D L +    L+  L    A    I 
Sbjct: 144 ELMGIPYVNAPGEAEAQCAELAKKGKVYAAASEDMDTLCYRTPYLLRHLTFSEARKEPIH 203

Query: 197 RRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMIM 256
             N E + +G     +LT DQ   L  + GCDY   I  VG VTA+K + ++ ++E+++ 
Sbjct: 204 EINTEIVLQG----LELTIDQFIDLGIMLGCDYCDSIKGVGPVTALKLMKEHGSLEKIVE 259

Query: 257 AIK 259
            I+
Sbjct: 260 YIE 262

>Scas_717.64
          Length = 379

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 140/336 (41%), Gaps = 41/336 (12%)

Query: 1   MGVSGLLPQLKPIQNPVSLARYQ-----GETLAIDGYAWLH------RSAHSCAMELAMD 49
           MG+ GL   +     P+++ + +     G  +AID    L+      R      +     
Sbjct: 1   MGIKGLTAIISE-NAPLAIRKSEIKAFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAG 59

Query: 50  QPTDKYLQFFIKRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEA 109
           + T   +  F + + M+ +  I P +VFDG    +K                    L EA
Sbjct: 60  ETTSHLMGMFYRTLRMIDN-GIKPCYVFDGKPPTLKSH---ELSKRTSRREETEKKLAEA 115

Query: 110 GDRRLAYDYFQKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIIS 169
            D+       ++ V ++ +      + L++  IPYV AP EA++Q   L K+G V    S
Sbjct: 116 VDQAEKMKQERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAESQCAELAKKGKVYAAAS 175

Query: 170 EDSDLLVFGCTRLITKLN-DNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCD 228
           ED D L +    L+  L    A+   I   N E++ +G      LT +Q   L  + GCD
Sbjct: 176 EDMDTLCYRTPYLLRHLTFSEAKKEPIQEINTEQVLQG----LDLTLEQFIDLGIMLGCD 231

Query: 229 YTSGIPKVGLVTAMKYVVKNRTMEQMIMAIKR-EG--KLSVPHTFWEEYQYANFAF---- 281
           Y   I  VG VTA+K + ++ ++E+++  I+  EG  K  VP  +   Y+ A   F    
Sbjct: 232 YCDNIRGVGPVTALKLIKEHGSLEKIVEFIESDEGNKKWKVPENW--PYKEARELFLKPD 289

Query: 282 -----QFQRVWCPLNERLVTLNAIPNELLNNEKLFN 312
                +    W P  E+ +       + L  EKLFN
Sbjct: 290 VIDGDEITLKWQPPKEQELI------DYLCGEKLFN 319

>CAGL0F08327g complement(829426..832404) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 992

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 6/123 (4%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +T DM K V E L    IPY+ AP EA+AQ   L    LV GII++DSD+ +FG  ++  
Sbjct: 728 VTMDMIKDVQELLARFGIPYITAPMEAEAQCAELVNLKLVDGIITDDSDVFLFGGKKVYK 787

Query: 185 KLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKY 244
            +      +E    + E + +G      LT + +  L  L G DYT+GI  +G V++M+ 
Sbjct: 788 NMFQEKNYVEY--YDSEDIYQG----LGLTRETMIELAQLLGSDYTTGIKGMGPVSSMEI 841

Query: 245 VVK 247
           + +
Sbjct: 842 LAE 844

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 13/94 (13%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLH------RSAHSCAMELAMDQPTDK 54
          MGV      + P   PV L       +A+D   W++      R     A++ A       
Sbjct: 1  MGVHSFWDIVGPTAKPVRLESLHDRRMAVDASIWIYQFLKAVRDKEGNAIKSA------- 53

Query: 55 YLQFFIKRISMLRHFKITPFFVFDGDSIQVKKET 88
          ++  F +R+  L +F I P FVFDG    +K++T
Sbjct: 54 HITGFFRRVCKLLYFGIKPVFVFDGGVPVLKRKT 87

>YGR258C (RAD2) [2205] chr7 complement(1007676..1010771)
           Structure-specific single-stranded DNA endonuclease of
           the nucleotide excision repairosome [3096 bp, 1031 aa]
          Length = 1031

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 6/123 (4%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +T DM K V E L    IPY+ AP EA+AQ   L +  LV GII++DSD+ +FG T++  
Sbjct: 767 VTMDMIKEVQELLSRFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIYK 826

Query: 185 KLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKY 244
            +      +E          E    L  L    +  L  L G DYT+G+  +G V++++ 
Sbjct: 827 NMFHEKNYVEF------YDAESILKLLGLDRKNMIELAQLLGSDYTNGLKGMGPVSSIEV 880

Query: 245 VVK 247
           + +
Sbjct: 881 IAE 883

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
          MGV        P   PV L   + + +A+D   W+++   +   +   +   + ++  F 
Sbjct: 1  MGVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDQEG-NAVKNSHITGFF 59

Query: 61 KRISMLRHFKITPFFVFDGDSIQVKKET 88
          +RI  L +F I P FVFDG    +K+ET
Sbjct: 60 RRICKLLYFGIRPVFVFDGGVPVLKRET 87

>Scas_645.8
          Length = 1000

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 68/124 (54%), Gaps = 8/124 (6%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +TP+M + V E L    +PY+ AP EA+AQ   L +  LV G++++DSD+ +FG +++  
Sbjct: 736 VTPEMIQDVQELLSRFGVPYITAPMEAEAQCAELLQLKLVDGVVTDDSDVFLFGGSKIYK 795

Query: 185 KLNDNAECIEI-DRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMK 243
            +      +E  D  +  R N G      L  + +  L  L G DYT+GI  +G V++++
Sbjct: 796 NMFHEKNYVEFYDSESILR-NLG------LDRENMIELAELLGSDYTNGIKGMGPVSSLE 848

Query: 244 YVVK 247
            + +
Sbjct: 849 VLAE 852

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 9/92 (9%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQP----TDKYL 56
          MGV      + P   PV L   Q + +A+D   W+++      M+   DQ     ++ ++
Sbjct: 1  MGVHSFWDVVGPTARPVRLKSLQDKKMAVDASIWIYQ-----FMKAVRDQDGNRVSNSHI 55

Query: 57 QFFIKRISMLRHFKITPFFVFDGDSIQVKKET 88
            F +RI  L +F I P FVFDG    +K++T
Sbjct: 56 TGFFRRICKLLYFGIQPVFVFDGGVPALKRDT 87

>Sklu_2443.25 YGR258C, Contig c2443 54418-57519
          Length = 1033

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 10/125 (8%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +T  M K + E L    IPY+ AP EA+AQ   L +  LV GII++DSD+ +FG  R+  
Sbjct: 768 VTAVMIKEIQELLSRFGIPYITAPMEAEAQCAELIRLELVDGIITDDSDVFLFGGDRVYK 827

Query: 185 KLNDNAECIEIDRRNFERLNEGKFPLSK--LTEDQLRSLVCLSGCDYTSGIPKVGLVTAM 242
            +           +N+    E    L    L  D++  L  L G DYT G+  +G V  M
Sbjct: 828 NM--------FHEKNYVEFYESGAILRDLGLNRDRMIELAQLLGSDYTEGVKGIGPVYGM 879

Query: 243 KYVVK 247
           + + +
Sbjct: 880 EVLAE 884

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLH------RSAHSCAMELAMDQPTDK 54
          MGV      + P   PV L     + +A+D   W++      R     AM  +       
Sbjct: 1  MGVYAFWDIVGPTARPVRLESLADKRMAVDASIWIYQFLKAVRDKEGNAMRHS------- 53

Query: 55 YLQFFIKRISMLRHFKITPFFVFDGDSIQVKKET 88
          ++  F +R+  L +F I P F+FDG +  +K++T
Sbjct: 54 HVVGFFRRVCKLLYFGIKPVFIFDGGAPALKRQT 87

>Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement
          Length = 381

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 107/243 (44%), Gaps = 15/243 (6%)

Query: 24  GETLAIDG----YAWLHRSAHSCAMELAMD--QPTDKYLQFFIKRISMLRHFKITPFFVF 77
           G  +AID     Y +L        ++LA +  + T   +  F + + M+ +  I P +VF
Sbjct: 28  GRKVAIDASMSLYQFLIAVRQQDGVQLASESGETTSHLMGMFYRTLRMVDN-GIKPCYVF 86

Query: 78  DGDSIQVKKETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQKCVSITPDMAKCVIEYL 137
           DG    +K                      +  ++R+   + ++ V +TP   +     L
Sbjct: 87  DGKPPTLKSHELGKRSQKRDETQKKLEAATDEAEKRM---HERRLVKVTPLHNEEAKRLL 143

Query: 138 QMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLN-DNAECIEID 196
           ++  IPYV AP EA+AQ   L K   V    SED D L +    L+  L    A+   I 
Sbjct: 144 ELMGIPYVNAPGEAEAQCAALAKADKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIH 203

Query: 197 RRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMIM 256
             + E + +G      LT +Q   L  + GCDY   I  VG VTA+K + ++ ++++++ 
Sbjct: 204 EIDTELVLKG----LDLTLEQFIDLCIMLGCDYCDNIRGVGPVTALKLIKEHGSLDKIVE 259

Query: 257 AIK 259
            I+
Sbjct: 260 FIE 262

>YKL113C (RAD27) [3150] chr11 complement(224373..225521)
           Single-stranded DNA endonuclease and 5'-3' exonuclease
           that functions in the MSH2-MLH1-PMS1-dependent mismatch
           repair system [1149 bp, 382 aa]
          Length = 382

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 92/207 (44%), Gaps = 9/207 (4%)

Query: 50  QPTDKYLQFFIKRISMLRHFKITPFFVFDGDSIQVKKETELXXXXXXXXXXXXXXXLFEA 109
           + T   +  F + + M+ +  I P +VFDG    +K   EL               L EA
Sbjct: 60  ETTSHLMGMFYRTLRMIDN-GIKPCYVFDGKPPDLKSH-ELTKRSSRRVETEKK--LAEA 115

Query: 110 GDRRLAYDYFQKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIIS 169
                     ++ V ++ +  +   + L +  IPY++AP EA+AQ   L K+G V    S
Sbjct: 116 TTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAAS 175

Query: 170 EDSDLLVFGCTRLITKLN-DNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCD 228
           ED D L +    L+  L    A+   I   + E +  G      LT +Q   L  + GCD
Sbjct: 176 EDMDTLCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRG----LDLTIEQFVDLCIMLGCD 231

Query: 229 YTSGIPKVGLVTAMKYVVKNRTMEQMI 255
           Y   I  VG VTA+K +  + ++E+++
Sbjct: 232 YCESIRGVGPVTALKLIKTHGSIEKIV 258

>Kwal_23.4343
          Length = 1031

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +T  M   V E L    IPY+ AP EA+AQ   L    LV GII++DSD+ +FG  ++  
Sbjct: 764 VTAAMVSEVQELLTRFGIPYMTAPMEAEAQCAELLALKLVDGIITDDSDIFLFGGDKVYK 823

Query: 185 KLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKY 244
            +      +E       +   G      L  ++   +  L G DYTSG+  VG V+AM+ 
Sbjct: 824 NMFHEKNYVEYYVTELIKRELG------LDREKFIEMAQLLGSDYTSGVKSVGPVSAMEI 877

Query: 245 VVK 247
           + +
Sbjct: 878 LAE 880

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLH------RSAHSCAMELAMDQPTDK 54
          MGV  L   + P   PV L     + LA+D   W++      R     AM  +       
Sbjct: 1  MGVHALWDVIGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRDKEGNAMRYS------- 53

Query: 55 YLQFFIKRISMLRHFKITPFFVFDGDSIQVKKET 88
          ++  F +RI  L +F I P FVFDG +  +K+ T
Sbjct: 54 HVIGFFRRICKLLYFGIKPVFVFDGGAPALKRRT 87

>KLLA0A09427g complement(821244..824279) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 1011

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 88/192 (45%), Gaps = 18/192 (9%)

Query: 125 ITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLIT 184
           +T +M   +   L    IPY+ AP EA+AQ   L +  LV G+I++DSD+ +FG T +  
Sbjct: 746 VTIEMIHEIQSLLSRFGIPYITAPMEAEAQCATLLQLKLVDGVITDDSDVFLFGGTHVYK 805

Query: 185 KLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLVTAMKY 244
            +      +E    +   L + K  L +   D+L  L  L G DYT G+  +G V  ++ 
Sbjct: 806 NMFQEKNYVEYYSLD---LFDQKLGLDR---DKLIQLAQLLGSDYTPGLRGIGPVMGVEI 859

Query: 245 VVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNAIPNEL 304
           + +         ++K   K      F ++      AFQ Q     L +RLV+   I ++ 
Sbjct: 860 LAE-------FGSLKEFAKWYNEGQFDKQKLEGETAFQKQ-----LRKRLVSNEIILDDN 907

Query: 305 LNNEKLFNCIGH 316
             +E +++   H
Sbjct: 908 FPSEAVYDAYIH 919

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1  MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60
          MGV  L   + P+  PV L       +A+D   W+++   +   +   D   + ++  F 
Sbjct: 1  MGVHSLWDIVSPVAKPVRLESLNERRMAVDASIWIYQFLKAMRNKEG-DALRNAHIIGFF 59

Query: 61 KRISMLRHFKITPFFVFDG 79
          +RI  L ++ I P FVFDG
Sbjct: 60 RRICKLLYYGIKPVFVFDG 78

>ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH]
           (300564..301703) [1140 bp, 379 aa]
          Length = 379

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 114/282 (40%), Gaps = 36/282 (12%)

Query: 1   MGVSGL----LPQLKPIQNPVSLARYQGETLAIDGYAWLH------RSAHSCAMELAMDQ 50
           MG+ GL      Q+     P  + ++ G  +AID    L+      R A    +  A  +
Sbjct: 1   MGIKGLNSIIQQQVPSAIRPREMKQFFGRRVAIDASMSLYQFLIAVRQADGVQLASADGE 60

Query: 51  PTDKYLQFFIKRISMLRHFKITPFFVFDGDSIQVK------KETELXXXXXXXXXXXXXX 104
            T   +  F + + M+ H  + P +VFDG    +K      K T                
Sbjct: 61  TTSHLMGMFYRTLWMVDH-GLKPCYVFDGSRRCLKAPPKLTKRTNAKEPEQKLAEADLNS 119

Query: 105 XLFEA---GDRRLAYDYFQKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQ 161
             +EA   G  R +   ++      PD       + +M ++P      EA+AQ   L K+
Sbjct: 120 RDYEARTRGWSRWSNGMWRGQEIAGPD------GHTRMWTLPG-----EAEAQCAELAKK 168

Query: 162 GLVQGIISEDSDLLVFGCTRLITKLN-DNAECIEIDRRNFERLNEGKFPLSKLTEDQLRS 220
           G V    SED D L +    L+  L    A    I   + E + +G      L+++QL  
Sbjct: 169 GKVFAAASEDMDTLCYRTPYLLRHLTFSEARKEPIHEIDTELVLQG----LGLSQEQLVD 224

Query: 221 LVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMIMAIKREG 262
           L  + GCDY   I  VG VTA+K + ++ ++E ++  I   G
Sbjct: 225 LGIMLGCDYCESIKGVGPVTALKLIKEHGSLENIVEFISSGG 266

>Scas_687.23
          Length = 745

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 10/167 (5%)

Query: 27  LAIDGYAWLHR----SAHSCAMELAMDQPTDKYLQFFIKRISMLRHFKITPFFVFDGDSI 82
           +AID Y WL       +H  +++        K +  FI R+  L    +T   VFDG   
Sbjct: 38  IAIDAYNWLFECGFIKSHGNSIKYNSQGTLPKAILNFISRLKDLLSLDVTFLLVFDGPMK 97

Query: 83  QVKKETELXXXXXXXXXXXXXXXLF-EAGDRRLAY--DYFQKCVSIT---PDMAKCVIEY 136
              K   +                + +  +  + Y  D    C++ T   P+   C+   
Sbjct: 98  PSFKNNFMNESDATLDFNQIDMIEYMKQWELHIQYHKDNATGCLTSTNHQPEFMSCITTI 157

Query: 137 LQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLI 183
           L+  +I ++ +  E +AQ  +L+  G V  I + DSD L+FG T+L+
Sbjct: 158 LRAMNISFLESCGEGEAQCAWLQINGYVDFIWTNDSDTLIFGGTKLL 204

>YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nuclease,
           has similarity to DNA repair nucleases Rad2p and Rad27p
           [2280 bp, 759 aa]
          Length = 759

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 127 PDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLI 183
           P+    V + L + +I YV+A  E +AQ V+L+  G V  I+S DSD LVFG  +++
Sbjct: 170 PEFISLVRKLLDLMNISYVIACGEGEAQCVWLQVSGAVDFILSNDSDTLVFGGEKIL 226

>KLLA0A01320g complement(118369..120123) weakly similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1 singleton, start
           by similarity
          Length = 584

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 122/306 (39%), Gaps = 58/306 (18%)

Query: 1   MGVSGLLPQLKPIQNP-VSLARYQGE---------TLAIDGYAWLHRSAHSCAMELAMDQ 50
           MG S L  Q+     P V+  ++  E          +AIDGY WL    +        D+
Sbjct: 1   MGSSELWNQISQYNVPRVAFKQFVAEFVEKNGRFPRIAIDGYLWLFECGY-------FDE 53

Query: 51  PTDK--YLQFFIKRISMLRHFKITPFFVFDG----DSIQVKKETELXXXXXXXXXXXXXX 104
           P +K   L  +++++  + H +     +FDG    D  + KK                  
Sbjct: 54  PQNKSKTLLNWLRKLKEMLHLQCFIVIIFDGTFKLDGKRRKKRK--------VATLWDSY 105

Query: 105 XLFEAGDRRLAYDYFQKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLV 164
            L  + +R     +    VS   D    +IE  ++ +I  + AP E +AQ  +L+  G V
Sbjct: 106 WLMRSMNR-----FNHDSVSYVDDY---IIECCKLFNIQTINAPGEGEAQCAFLQLVGQV 157

Query: 165 QGIISEDSDLLVFGCTRLITKLND-------NAECIEIDRRNFERLNEGKFPLSKLTEDQ 217
             ++S D+D+L FG ++++   +        N+    +  +  ER     F    + +D 
Sbjct: 158 DFVLSNDADVLSFGASKVLKNYSKHGWQDLPNSSNSPVKSKQNERF--VTFVDLDIIKDW 215

Query: 218 LRSLVC----LSGCDYTSGIPKVG-----LVTAMKYVVKNRTMEQMIMAIKREGKLSVPH 268
            R        L G DY  G+  +G     +++  +    ++ +  ++   K E K  + H
Sbjct: 216 DRDRFVLFNLLVGSDYNGGVKGLGGKRAAILSKSREPDISKKLPAVLADAKFEEKAKIQH 275

Query: 269 TFWEEY 274
             WEE+
Sbjct: 276 K-WEEF 280

>Kwal_47.19168
          Length = 673

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 90/232 (38%), Gaps = 18/232 (7%)

Query: 27  LAIDGYAWLHRSAHSCAMELAMDQPTDKY-LQFFIKRISMLRHFKITPFFVFDGDSIQVK 85
           +AID + WL         +      TD + +  F+ R+ +     +T   VFDG      
Sbjct: 38  IAIDAFTWLFECGFISEFQPEKAYKTDAHSVISFLNRLKLFLSLDVTFILVFDGPMKPSF 97

Query: 86  KETELXXXXXXXXXXXXXXXLFEAGDRRLAYDYFQKCVS-----ITPDMAKCVIEYLQMN 140
           K                        +    ++    C+       TP + K   E L+  
Sbjct: 98  KNKFKSKTAVQSPIEVEEDYFGVYNEHHRQHEQSGTCIGGPGIQSTPTIVK---EILKAM 154

Query: 141 SIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLNDNAECI------E 194
           +I Y+ +  E +A+   L+K  LV  ++S DSD  VFG  +++  ++   E +       
Sbjct: 155 NISYIESCSEGEAECARLQKLNLVDYVLSNDSDAFVFGANKVLRNMSKFWEDLPATSSSP 214

Query: 195 IDRRNFERLNEGKFPLSKLTEDQLRSLV---CLSGCDYTSGIPKVGLVTAMK 243
           + +R+ + +      L ++++    S+V    L G DY  G+  +G   A K
Sbjct: 215 VKKRDHKEMFVTIVDLQQISDWNRASIVFFCTLLGADYNQGVRGLGSKKAAK 266

>CAGL0C02255g complement(228009..229955) similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1, start by
           similarity
          Length = 648

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 19/129 (14%)

Query: 131 KCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLNDNA 190
           K V E L +  + Y  A  E ++   +L+    V  ++S DSD L+FG TR++  L+ N 
Sbjct: 156 KKVQELLNLLKVNYTFAYGEGESHCAWLQISDHVDYVMSNDSDTLMFGATRVLRNLSKNL 215

Query: 191 ECIEIDRR-----------------NFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGI 233
           E      R                 N + +N+ K+ L +L+   L     + G DY SG+
Sbjct: 216 EDKSPSSRQGNNSTSSEAEYYITEVNLQEINQ-KYGL-QLSSASLLFFSLIIGGDYNSGL 273

Query: 234 PKVGLVTAM 242
             +G   A+
Sbjct: 274 SGLGKTKAL 282

>AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH]
           complement(1431488..1433797) [2310 bp, 769 aa]
          Length = 769

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 133 VIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLNDNAEC 192
           +I+Y     I Y+VAPY +  Q+ YL + G V GI      LLV    + I  +      
Sbjct: 166 LIQYFISKGINYMVAPYSSWIQLAYLLEDGYVDGIYGPTDLLLVESVPKFILGM------ 219

Query: 193 IEIDRRNFERLNEGK 207
            E   R F  ++ G+
Sbjct: 220 -EFPNREFRFVDRGR 233

>AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH]
           complement(869659..871755) [2097 bp, 698 aa]
          Length = 698

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 49/117 (41%), Gaps = 30/117 (25%)

Query: 142 IPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGCTRLITKLNDNAECIEIDRRNFE 201
           + Y+ A  E +A+   L+  G V  I++ DSD  +FG +R++   + +A+ +        
Sbjct: 149 VDYITAAGEGEAECAALQVAGSVDYILTNDSDAAIFGASRILRNFSKHAQDLP------- 201

Query: 202 RLNEGKFPLSKLTEDQLRSLV---------------------CLSGCDYTSGIPKVG 237
             + G  P+ K   +   ++V                      L+G DY +G+  +G
Sbjct: 202 --SSGVSPVKKHVSEYFVTVVDIRAATEEHPTFSRKAFALFAILTGADYGTGLQHLG 256

>Scas_709.54
          Length = 470

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 30/117 (25%)

Query: 217 QLRSLVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQY 276
           Q   L+CLS          + L T  K V K++ +E             V H +WE YQ 
Sbjct: 119 QFAKLLCLSKS--------IKLTTG-KIVPKSKKIEDTPQWF-------VKHNYWEIYQD 162

Query: 277 ANFAFQFQRVWCPLNERLVTLNAIPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFED 333
            N  F   R+W  +  ++   +A+ + ++N++              K+KD+I  FE+
Sbjct: 163 KNNEFNPSRIWNEVIMKIKKSDALVSLIMNDK--------------KVKDIIQSFEN 205

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,469,229
Number of extensions: 684172
Number of successful extensions: 2340
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2345
Number of HSP's successfully gapped: 41
Length of query: 660
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 552
Effective length of database: 12,857,365
Effective search space: 7097265480
Effective search space used: 7097265480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)