Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E16786g1011005239e-71
Kwal_47.1739489960640.46
Kwal_23.5168107337630.66
YLR214W (FRE1)68646620.96
ADR080W69178620.98
AEL270W63727582.9
Kwal_27.10365161942574.0
KLLA0C13387g21172556.1
Kwal_27.1079453556549.3
CAGL0K05291g104847549.7
KLLA0E23331g30696549.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E16786g
         (100 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E16786g 1487084..1487389 no similarity, hypothetical start       206   9e-71
Kwal_47.17394                                                          29   0.46 
Kwal_23.5168                                                           29   0.66 
YLR214W (FRE1) [3615] chr12 (568569..570629) Membrane-associated...    28   0.96 
ADR080W [1821] [Homologous to ScYLR214W (FRE1) - SH] complement(...    28   0.98 
AEL270W [2235] [Homologous to ScYPR179C (PLO1) - SH] complement(...    27   2.9  
Kwal_27.10365                                                          27   4.0  
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    26   6.1  
Kwal_27.10794                                                          25   9.3  
CAGL0K05291g 515641..518787 similar to sp|Q12038 Saccharomyces c...    25   9.7  
KLLA0E23331g 2071111..2072031 no similarity, hypothetical start        25   9.8  

>KLLA0E16786g 1487084..1487389 no similarity, hypothetical start
          Length = 101

 Score =  206 bits (523), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%)

Query: 1   MLNLLLPGNRVNISSRDPQSIFTYHAKLLTFEERKQLKESSLIPLTDVSAIRNKDTKPIS 60
           MLNLLLPGNRVNISSRDPQSIFTYHAKLLTFEERKQLKESSLIPLTDVSAIRNKDTKPIS
Sbjct: 1   MLNLLLPGNRVNISSRDPQSIFTYHAKLLTFEERKQLKESSLIPLTDVSAIRNKDTKPIS 60

Query: 61  NICFTTLSKLRDYGCFWTTSAVKADTESRELGSLSRRDVG 100
           NICFTTLSKLRDYGCFWTTSAVKADTESRELGSLSRRDVG
Sbjct: 61  NICFTTLSKLRDYGCFWTTSAVKADTESRELGSLSRRDVG 100

>Kwal_47.17394
          Length = 899

 Score = 29.3 bits (64), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 26  AKLLTFEERKQLKESSLIPLTDVSAIRNKDTKPISNICFTTLSKLRDYGCFWTTSAVKAD 85
           + LLTFE   Q  +  +IP   +  I N  T+    ICF++L K       W  S V  D
Sbjct: 517 SSLLTFEGVAQGIDCCIIP--HLPPISNSGTEDDDAICFSSLVKEVGNDTIWNYSIVTKD 574

>Kwal_23.5168
          Length = 1073

 Score = 28.9 bits (63), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 7   PGNRVNISSRDPQSIFTYHAKLLTFEERKQLKESSLI 43
           PGNR     RD Q +F    + LTFEER  + E  L+
Sbjct: 674 PGNR---GKRDSQVLFMSFLQRLTFEERMTVFEYHLL 707

>YLR214W (FRE1) [3615] chr12 (568569..570629) Membrane-associated
           flavocytochrome with ferric and cupric reductase
           activities, acts on ferric iron chelates external to the
           cell to facilitate iron uptake [2061 bp, 686 aa]
          Length = 686

 Score = 28.5 bits (62), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 3/46 (6%)

Query: 34  RKQLKESSLIPLTDVSAIRNKDTKPISNICFTTLS---KLRDYGCF 76
           R  L   +L P+  +  IRN    PI+ + F+T +   K   Y CF
Sbjct: 257 RADLMAIALFPVVYLFGIRNNPFIPITGLSFSTFNFYHKWSAYVCF 302

>ADR080W [1821] [Homologous to ScYLR214W (FRE1) - SH]
           complement(850509..852584) [2076 bp, 691 aa]
          Length = 691

 Score = 28.5 bits (62), Expect = 0.98,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 31/78 (39%), Gaps = 3/78 (3%)

Query: 2   LNLLLPGNRVNISSRDPQSIFTYHAKLLTFEERKQLKESSLIPLTDVSAIRNKDTKPISN 61
           L +LL     NI    P +   +   L     R  L   SL P+     IRN    P+S 
Sbjct: 233 LTVLLCCFDYNIKLPHPFTTSQWFMDLDLISYRVDLMAISLFPVIYFFGIRNNPFIPLSG 292

Query: 62  ICFTTLS---KLRDYGCF 76
           + F+T +   K   Y CF
Sbjct: 293 MSFSTFNFYHKWTAYACF 310

>AEL270W [2235] [Homologous to ScYPR179C (PLO1) - SH]
           complement(132790..134703) [1914 bp, 637 aa]
          Length = 637

 Score = 26.9 bits (58), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 1   MLNLLLPGNRVNISSRDPQSIFTYHAK 27
           +L  LL GN+VNI   D QSI T   K
Sbjct: 145 LLEALLLGNKVNIRRHDGQSIKTKQKK 171

>Kwal_27.10365
          Length = 1619

 Score = 26.6 bits (57), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 26   AKLLTFEERKQLKESSLIPLTDVSAIRNKDTKPISNICFTTL 67
            + LL FEE   L E +L  +T++ +I +   K ISN  F+ L
Sbjct: 1387 SHLLNFEEEPVLCELALTFITELCSINDVAEKLISNGLFSVL 1428

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 25.8 bits (55), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 27  KLLTFEERKQLKESSLIPLTDVSAIRNKDTKPISNICFTTLSKL-RDYGCFWTTSAVKAD 85
           + +++EE + L +    P  + SA +N + +      F  L +L RD G  +++S+ +AD
Sbjct: 58  RQVSYEEGQTLAKQFDAPFLETSAKQNINVEE----SFYGLVRLIRDEGKGFSSSSARAD 113

Query: 86  TESRELGSLSRR 97
            E  +L  L  +
Sbjct: 114 AEKDKLAKLENQ 125

>Kwal_27.10794
          Length = 535

 Score = 25.4 bits (54), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 26  AKLLTFEERKQLKESSLIPLTDV---------SAIRNKDTKPISNICFTTLSKLRD 72
           AKLL F    + K S++    D+         +AI+  DT+ + +IC   +S+++D
Sbjct: 432 AKLLLFHILSEAKSSAVTEAADIKSLIESFSLNAIQEIDTQELRSICSDIISEVKD 487

>CAGL0K05291g 515641..518787 similar to sp|Q12038 Saccharomyces
           cerevisiae YPR032w, start by similarity
          Length = 1048

 Score = 25.4 bits (54), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 28  LLTFEERKQLKESSLIPLTDVSAIRNKDTKPISNICFTTLSKLRDYG 74
           ++ F E KQ  + S  P+  +     K T+     CF T+SK++D G
Sbjct: 729 VVEFVEIKQTNDKS--PILKIDTFEKKTTES----CFATISKMQDLG 769

>KLLA0E23331g 2071111..2072031 no similarity, hypothetical start
          Length = 306

 Score = 25.4 bits (54), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 38/96 (39%), Gaps = 23/96 (23%)

Query: 16  RDP-QSIFTYHAKLLTFEERK---QLKESSLIPLTDVSAI-------------------R 52
           +DP QS+  Y   +   +E K   Q+ +   I ++D+S I                   +
Sbjct: 200 KDPLQSLLNYQPDVKESDESKLIEQVAKIHEINISDISDILINPPVRTLKRALNVNNQTK 259

Query: 53  NKDTKPISNICFTTLSKLRDYGCFWTTSAVKADTES 88
             D   ISN C   L+K R++   W     K  T+S
Sbjct: 260 KHDISHISNKCSRLLTKERNHSLPWPVKKKKKQTDS 295

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,972,244
Number of extensions: 102307
Number of successful extensions: 330
Number of sequences better than 10.0: 17
Number of HSP's gapped: 330
Number of HSP's successfully gapped: 17
Length of query: 100
Length of database: 16,596,109
Length adjustment: 71
Effective length of query: 29
Effective length of database: 14,138,231
Effective search space: 410008699
Effective search space used: 410008699
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)