Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E16742g66165132810.0
YOR035C (SHE4)7896159341e-115
Scas_699.377686049131e-112
CAGL0I01034g7835878241e-99
AER389C7585546954e-81
Kwal_55.199912752824542e-51
Scas_582.2121053780.33
KLLA0C16269g48471692.7
CAGL0I06358g198199684.2
YER147C (SCC4)624160684.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E16742g
         (651 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534 Saccha...  1268   0.0  
YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein r...   364   e-115
Scas_699.37                                                           356   e-112
CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces cer...   322   1e-99
AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH] (1367924..1...   272   4e-81
Kwal_55.19991                                                         179   2e-51
Scas_582.2                                                             35   0.33 
KLLA0C16269g complement(1423302..1424756) similar to sgd|S000230...    31   2.7  
CAGL0I06358g complement(608945..614890) similar to sp|P39526 Sac...    31   4.2  
YER147C (SCC4) [1576] chr5 complement(462963..464837) Protein re...    31   4.6  

>KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534
           Saccharomyces cerevisiae YOR035c SHE4 required for
           mother cell-specific gene expression singleton,
           hypothetical start
          Length = 661

 Score = 1268 bits (3281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/651 (96%), Positives = 625/651 (96%)

Query: 1   MNKVWDRIVGSDSADAQSVLKERCSSPKDVTDLLHVIQNWTSEIHNNGEETRCWKCVPML 60
           MNKVWDRIVGSDSADAQSVLKERCSSPKDVTDLLHVIQNWTSEIHNNGEETRCWKCVPML
Sbjct: 1   MNKVWDRIVGSDSADAQSVLKERCSSPKDVTDLLHVIQNWTSEIHNNGEETRCWKCVPML 60

Query: 61  AGYVKDWGQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEA 120
           AGYVKDWGQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEA
Sbjct: 61  AGYVKDWGQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEA 120

Query: 121 EEDSGNVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRL 180
           EEDSGNVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRL
Sbjct: 121 EEDSGNVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRL 180

Query: 181 LAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCINLF 240
           LAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCINLF
Sbjct: 181 LAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCINLF 240

Query: 241 IDSLSNGENIEINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLYGLLII 300
           IDSLSNGENIEINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLYGLLII
Sbjct: 241 IDSLSNGENIEINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLYGLLII 300

Query: 301 LANVSEHPSQNEDTVDKLKASLKTNQEKNDEPTLENVKDIEEFNRDYIIDLDLIGSLKSI 360
           LANVSEHPSQNEDTVDKLKASLKTNQEKNDEPTLENVKDIEEFNRDYIIDLDLIGSLKSI
Sbjct: 301 LANVSEHPSQNEDTVDKLKASLKTNQEKNDEPTLENVKDIEEFNRDYIIDLDLIGSLKSI 360

Query: 361 KLSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSKDEWYLLSIRALS 420
           KLSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSKDEWYLLSIRALS
Sbjct: 361 KLSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSKDEWYLLSIRALS 420

Query: 421 KTLIYVNPETAFSKYSPLSAAPFLFENLPLPNDNALSELQFTQLDTYEXXXXXXXXXXIN 480
           KTLIYVNPETAFSKYSPLSAAPFLFENLPLPNDNALSELQFTQLDTYE          IN
Sbjct: 421 KTLIYVNPETAFSKYSPLSAAPFLFENLPLPNDNALSELQFTQLDTYEALLALTNLATIN 480

Query: 481 QGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMAISAKFFCFENPKS 540
           QGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMAISAKFFCFENPKS
Sbjct: 481 QGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMAISAKFFCFENPKS 540

Query: 541 AQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSEKRNLIETAIRVFKTQNXX 600
           AQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSEKRNLIETAIRVFKTQN  
Sbjct: 541 AQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSEKRNLIETAIRVFKTQNTD 600

Query: 601 XXXXXXXXXXXXXXFNANAHAVACVKNDEEFVKELQKYRNTPSQKDPLTPE 651
                         FNANAHAVACVKNDEEFVKELQKYRNTPSQKDPLTPE
Sbjct: 601 TDLRIRLLVLLSSIFNANAHAVACVKNDEEFVKELQKYRNTPSQKDPLTPE 651

>YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein
           required for mother cell-specific expression of HO and
           receptor mediated as well as membrane lipid endocytosis
           [2370 bp, 789 aa]
          Length = 789

 Score =  364 bits (934), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 234/615 (38%), Positives = 355/615 (57%), Gaps = 53/615 (8%)

Query: 24  CSSPKDVTDLLHVIQNWTSEIHNNGEETRCWKCVP----MLAGYVKDWGQLEFLCRRILL 79
           C S KD T  + ++      IH  GE+T     +     +L  +  ++ ++ FL + ++L
Sbjct: 118 CFSNKDAT--IALLNELQIRIHY-GEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELIL 174

Query: 80  RSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEAEEDSGNVSLRLLVDAMSLV 139
           R S  E++ ++L+    L S+   + ++   + +  L++EAE D GN  L ++V  +S +
Sbjct: 175 RISEDEVKSMMLIIFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSEL 234

Query: 140 FPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRLLAVSCIDEAVRRFIAEHYL 199
           +P    +C ++FL+     +  + +     D       LRLL+ +CIDE +R +I E+YL
Sbjct: 235 YPSLTTLCSEIFLTKGLSKLFKKRV-FEEQDLQFTKELLRLLSSACIDETMRTYITENYL 293

Query: 200 KTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCINL------FIDSLSNG-----E 248
           + L++S  VE  ++ +ALVL+K WSFTK+      +CINL      FI+++S       E
Sbjct: 294 QLLERSLNVEDVQIYSALVLVKTWSFTKL------TCINLKQLSEIFINAISRRIMPKIE 347

Query: 249 NI-------------EINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLY 295
           N+             E++ EALAYL+LK SV++++R N      ++ +IKSQ  T   LY
Sbjct: 348 NVNESAVKLEEVPKVEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHC-LY 406

Query: 296 GLLIILANVSEHPSQN---EDTVDKLK--ASLKTNQEKNDEPTLENVKDIEEFNRDYIID 350
           GLL+I+AN+S  P ++     +++ LK  A LK           E+ +DI  FN  YI+ 
Sbjct: 407 GLLVIMANLSTLPEESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILR 466

Query: 351 LDLIGSLKS--IKLSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSK 408
            +LI  LK     LS +   Q +R+IYN+TR K  I +C+ QG   ++L +LA K+++  
Sbjct: 467 TELISFLKREMHNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIG- 525

Query: 409 DEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFENLPLP---NDNAL-SELQFTQL 464
           +   +L  RAL++ LI+ NP   F KYS L+A PFLFE LP     +DN L ++ Q    
Sbjct: 526 EPIRILGCRALTRMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLT 585

Query: 465 DTYEXXXXXX--XXXXINQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLM 522
           D YE             + G ++ K I+S   YW +IENL+LD +V +QRSTLELISN+M
Sbjct: 586 DNYEALLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMM 645

Query: 523 SNPMAISAKFFCFENPKSAQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSE 582
           S+P+ I+AKFF  ENP+S +NF ILVKLL+L D++SQRAVAAIFANIA+T+P I KEL  
Sbjct: 646 SHPLTIAAKFFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLT 705

Query: 583 KRNLIETAIRVFKTQ 597
           K+ LIE AI+VF  Q
Sbjct: 706 KKELIENAIQVFADQ 720

>Scas_699.37
          Length = 768

 Score =  356 bits (913), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 228/604 (37%), Positives = 358/604 (59%), Gaps = 46/604 (7%)

Query: 32  DLLHVIQNWTSEIHNNGEETR---CWKC-VPMLAGYVKDWGQLEFLCRRILLRSSIQEIR 87
           D + +I+     IH  GE+T       C V  L  Y   W Q+EF+ R + LR    + +
Sbjct: 102 DTIPLIKELKDRIHY-GEDTHPKYLLSCIVQSLNKYSYAWDQIEFIVRDVCLRMGEPDFK 160

Query: 88  PLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEAEEDSGNVSLRLLVDAMSLVFPICLGVC 147
            + L+    L  +  +   +K  NI+  L++EAE D GN  L L+V+  + ++P    +C
Sbjct: 161 SIGLIIFTLLQESFEEQFYKKFTNIIDSLILEAEADVGNDPLSLIVEIFTELYPALTNIC 220

Query: 148 RDMFLSTDFQDILTRNLNSSADDEHLVNGALRLLAVSCIDEAVRRFIAEHYLKTLQQSFK 207
            ++FL ++   +       + +DE  +   L+LL+V+CIDE VR FIAE+YL  L++S K
Sbjct: 221 SELFLGSELDKLFKEKAMHNNEDE-FIKKLLKLLSVACIDENVRNFIAENYLDMLERSLK 279

Query: 208 VEKYKVLTALVLIKIWSFTKIEKETL---------NSCINLFIDSLSNGENIE----INT 254
           +E++K  +A+VLIK WSFTK++  T+         N  +NL ID   +G+++     +  
Sbjct: 280 LEQFKTYSAVVLIKTWSFTKLKGVTIGDLGTTLTDNFLMNLKID---DGQSLNDECVMCI 336

Query: 255 EALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTD---LYGLLIILANVSEHP--- 308
           E LAYLTLK  +++ LR + +    II L+K QDT P D    YG+L+IL N+S +P   
Sbjct: 337 EGLAYLTLKKQMKMTLRYHEEFSTTIINLLKKQDT-PVDDSVKYGILVILGNISTYPMDV 395

Query: 309 ----SQNEDTVDKLK--ASLKTNQEKNDEPTLENVKDIEEFNRDYIIDLDLIGSLKS--I 360
               + +   +  LK  + LK+ ++++    +EN +D+  + + YI+  +L+  L++   
Sbjct: 396 TMDGAMDPQALQDLKTYSELKSPKKRDANDVIENNEDVTRYIQKYILKTELLSYLRTKLA 455

Query: 361 KLSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSKDEWYLLSIRALS 420
           ++S  S  Q IRIIYN+TR +  IS  V+QG  + ++ +LA K++  K+   LL++R+L+
Sbjct: 456 EVSPGSRQQIIRIIYNLTRARENISASVEQGCVVTVIEYLANKKD-KKEPTRLLALRSLT 514

Query: 421 KTLIYVNPETAFSKYSPLSAAPFLFENLPLPN---DNALS--ELQFTQLDTYEXXXXXXX 475
           K L   +P+  F+KYS L+A PFL+E L  P+   +N LS  EL  TQ D+YE       
Sbjct: 515 KMLTLSDPKLIFNKYSRLTAIPFLYELLQTPSLSAENPLSTDELITTQ-DSYEALCALTN 573

Query: 476 XXXI--NQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMAISAKFF 533
                 +   D+ K ++++  YW  IENL+LD ++ +QR+TLELI+NLM  P++I+AK F
Sbjct: 574 LASTEDSNADDVCKQVVTDVNYWSIIENLILDDNILVQRATLELIANLMCYPLSIAAKIF 633

Query: 534 CFENPKSAQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSEKRNLIETAIRV 593
            FENP+S +NF ILVKLLEL+D+ +QRAVAAIFANI+S+VP I + L +K+ LIE A  +
Sbjct: 634 NFENPQSLRNFNILVKLLELNDVAAQRAVAAIFANISSSVPLIAQTLLDKKELIEKATGI 693

Query: 594 FKTQ 597
           F  Q
Sbjct: 694 FAEQ 697

>CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces
           cerevisiae YOR035c SHE4, start by similarity
          Length = 783

 Score =  322 bits (824), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 205/587 (34%), Positives = 326/587 (55%), Gaps = 55/587 (9%)

Query: 59  MLAGYVKDWGQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLI 118
           +L+ +   +    FL R + LR    ++ P++L+    L   + D  + K    +  L++
Sbjct: 136 LLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPDEFKVKFLETMDVLIM 195

Query: 119 EAEEDSGNVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGAL 178
           EAEED G+  L L+V+ ++ ++P   G+C ++ L+     +L     S   D++  +  L
Sbjct: 196 EAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLLTRGAGKMLKERATSEDSDKNFRSKLL 255

Query: 179 RLLAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCIN 238
           +LL+++CIDE VR  I+E Y++TL+ S +  +YKVL ALVLIK WSF K++   +N   +
Sbjct: 256 KLLSIACIDETVRVHISEKYIETLETSMQFSEYKVLAALVLIKTWSFLKLKHIDINKLAS 315

Query: 239 LFIDSLSNGENIE--------------INTEALAYLTLKPSVRVLLRGNGDVCLKIIELI 284
           + +D+  +   +E                 E LAYLTLK  ++ +LR +     +II+L 
Sbjct: 316 ILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLA 375

Query: 285 KSQDTTPTDLYGLLIILANVSEHPSQNEDTVDKLKAS------------LKTNQEKNDEP 332
           K +  T  + +G+LII+AN++  P+   +  ++  +               TN+ K++ P
Sbjct: 376 KKESGTNPNYFGILIIIANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVP 435

Query: 333 TLENVKDIEEFNRDYIIDLDLIGSLKSI--KLSTSSYNQAIRIIYNVTRDKTQISECVKQ 390
             E  ++++EF   +I+  DL+  +K+    +S  S  Q +RI+YN+TR K  IS CV+Q
Sbjct: 436 DSE--EEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQ 493

Query: 391 GAGLMLLVFLAQKRNLSKDEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFE---- 446
           G    +L +L  K++       LL+ R+L++ LI  +P   F+KYSPL+A PFLF+    
Sbjct: 494 GVTTNILEYLVSKQD-KGVAVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGT 552

Query: 447 -------------NLPLPNDNALSELQFTQLDTYEXXXXXXXXXX--INQGVDLGKIILS 491
                        N  L ND+ +       LD YE             + G ++ K I +
Sbjct: 553 TESGEETQEKIELNPLLENDDNIE-----VLDRYEALLALTNLAATPTSNGEEICKSISN 607

Query: 492 NAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMAISAKFFCFENPKSAQNFEILVKLL 551
             +YW+SI NL+L+ ++ IQRSTLELISNLMS+P+ ++AKFF F NP+S +NF  LV+L+
Sbjct: 608 TPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLI 667

Query: 552 ELHDIQSQRAVAAIFANIASTVPFICKELSEKRNLIETAIRVFKTQN 598
           EL DI SQRA+AA+FANI  +VPFI +EL EK  LI  AIR+   QN
Sbjct: 668 ELDDIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQN 714

>AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH]
           (1367924..1370200) [2277 bp, 758 aa]
          Length = 758

 Score =  272 bits (695), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 204/554 (36%), Positives = 321/554 (57%), Gaps = 36/554 (6%)

Query: 65  KDW---GQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLIEAE 121
           K+W     L FL R +  R   +++RPL LV    L S++  + E++  + +  L IEA 
Sbjct: 141 KNWYTFSDLAFLVRVLPRRMDSEQVRPLSLVLFARLHSSYPSDFEKEFTDTIDTLAIEA- 199

Query: 122 EDSG-NVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGALRL 180
            D G   SL  ++  ++ +FP+   +C  + L  + Q +L    + S  +   +  AL L
Sbjct: 200 -DVGIEGSLDAVLLTLTELFPLLPLLCSQLLLKPELQQVLR---DESTRNRKTLLLALNL 255

Query: 181 LAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIE----KETLNSC 236
           L+V+CID+ VRR+IA++ LK L+ +F     K+  ++VLIK W+F K++    ++   +C
Sbjct: 256 LSVACIDDTVRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAFKKLQSIDIEQLCATC 315

Query: 237 INLFIDSLSNGENIEINTEALAYLTLKPSVRVLLRGNGDVCLKIIELIKSQDTTPTDLYG 296
           +      +     I +  E LAYLTLK +VR+ +R +GD  L +++L+K    + T +YG
Sbjct: 316 VTELQSPVVKRRAIAV--EGLAYLTLKSTVRISIRADGDSSLILVQLLKKNPDSST-IYG 372

Query: 297 LLIILANVSEHPSQN---EDTVDKLKA--SLKTNQEKNDEPTLENVKDIEEFNRDYIIDL 351
           +L  L N++  PS+    + +++ LKA   L        EP LE+  +I+ F  DYI+DL
Sbjct: 373 ILSTLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEP-LEDDDEIDAFIEDYILDL 431

Query: 352 DLIGSLKSIK--LSTSSYNQAIRIIYNVTRDKTQISECVKQGAGLMLLVFL--AQKRNLS 407
            +IG+L+S K  L  +   Q  ++IY VT+ +  I  CVKQGA   LL +L  A   N+ 
Sbjct: 432 QVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYLNDAPVHNII 491

Query: 408 KDEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFENLP----LPNDNALSELQFTQ 463
           +    +L+ RAL++ LI  +P+  F ++SP+++ P LF  +P    L N+ ALS L  T 
Sbjct: 492 Q----ILAARALARILINTDPKLLFHRHSPMNSVPALFGLIPILDGLDNEEALSYL--TT 545

Query: 464 LDTYEXXXXXXXXXXINQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMS 523
            D+YE           +   +L K+I+SN +YW  + N +LD +V+IQRS LEL++NLM+
Sbjct: 546 RDSYEALLALTNLAATDSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELLANLMA 605

Query: 524 NPMAISAKFFCFENPKSAQNFEILVKLLELHDIQSQRAVAAIFANIASTVPFICKELSEK 583
            P+ I+AKFF   NP+S +NF+ LV LL L DI+SQRA+AAIFANIA ++PFI +EL ++
Sbjct: 606 RPINIAAKFFNLANPESRKNFDTLVCLLRLEDIRSQRAIAAIFANIAGSIPFIAEELLKE 665

Query: 584 RNLIETAIRVFKTQ 597
             LI+  I   K Q
Sbjct: 666 DELIKAVILTLKEQ 679

>Kwal_55.19991
          Length = 275

 Score =  179 bits (454), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 176/282 (62%), Gaps = 17/282 (6%)

Query: 298 LIILANVSEHPSQNEDTVDKLKASLKTNQEKNDEPTLENVKDI-----EE---FNRDYII 349
           +++LAN+S   S  +++  + +A L+  Q   D    +N+KD+     EE   FN+ YI+
Sbjct: 1   MVVLANLS---SPLDESSSRQRA-LQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYIL 56

Query: 350 DLDLIGSLKS-IKLSTSSYN-QAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLS 407
           DL+ +G LKS  +  +S  N Q +RII+N++R+K  I+E V+QG+  +LL  LA  +   
Sbjct: 57  DLNTLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIK--M 114

Query: 408 KDEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFENLPLPNDNALSELQFTQLDTY 467
             ++ LL++R+L++ L  VNPE  F ++S L+A P+LFE +P+P   A S  Q    DTY
Sbjct: 115 PADFKLLALRSLARILAMVNPELVFRRFSALTAVPYLFELIPVPTQPA-SNDQIDPKDTY 173

Query: 468 EXXXXXXXXXXINQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMA 527
           E          I +   + + I+++  YW+ +E L+LD++V IQRS LEL+ NLM+  + 
Sbjct: 174 EALLALTNLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLH 233

Query: 528 ISAKFFCFENPKSAQNFEILVKLLELHDIQSQRAVAAIFANI 569
           ++ KFF F+NP+S +NF ILVKLL L DI+SQ AV  IFANI
Sbjct: 234 LAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGIFANI 275

>Scas_582.2
          Length = 1210

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 279 KIIELIKSQDTTPTDLYGLLIILANVSEHPSQNEDTVDKLKASLKTNQEKNDE 331
           K ++   SQD +PTD+Y  +++L N  E  ++NE     +KA   ++ +K ++
Sbjct: 266 KFVQRRHSQDISPTDMYRSIMMLRNQHEEHAENEGPALVIKAPSGSDDKKGND 318

>KLLA0C16269g complement(1423302..1424756) similar to sgd|S0002305
           Saccharomyces cerevisiae YDL146w, hypothetical start
          Length = 484

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 116 LLIEAEEDSGNVSLRLLVDAMSLVFPICLGVCRDMFLSTD---FQDILTRNLNSSADDEH 172
           LL++   ++    L ++   + ++    L V +D F   D   F D+L RNLN+ +D+E 
Sbjct: 269 LLLKFNRETDTSLLIMICKVIYIILTKDLKVAKDFFYLNDLHVFVDVLLRNLNNISDNEE 328

Query: 173 LV-NGALRLLA 182
           ++ N  LR+L 
Sbjct: 329 ILRNTYLRVLT 339

>CAGL0I06358g complement(608945..614890) similar to sp|P39526
            Saccharomyces cerevisiae YJL207c, start by similarity
          Length = 1981

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 15/99 (15%)

Query: 30   VTDLLHVIQNWTSEIHNNGEETRCWKC-------------VPMLAGYVKD--WGQLEFLC 74
            + DLL  +Q+  SE  N+G+E    +              +P      K   +  L F+ 
Sbjct: 1681 IKDLLPFVQHTVSETTNSGKELNSMEVNLLRKTFKVLEQNIPSFDAIFKLDLYACLLFVI 1740

Query: 75   RRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNIL 113
             RI L  S + + P++L  +KS++++   + EQK  +I 
Sbjct: 1741 GRIFLSDSNEALVPVILPLLKSIITDLVKSNEQKMLDIF 1779

>YER147C (SCC4) [1576] chr5 complement(462963..464837) Protein
           required for sister chromatid cohesion [1875 bp, 624 aa]
          Length = 624

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (45%), Gaps = 23/160 (14%)

Query: 312 EDTVDKLKASLKTNQEKNDEPTLENVKDIEEFNR-DYII--DLDLIGSLK-SIKLSTSSY 367
           E  +  LK  L+T+Q   D         +EE  R ++++  DL L+   K   K++  + 
Sbjct: 87  ELYISSLKERLQTHQSDTDL--------VEEIMRCEFLLLHDLPLMRDSKFHYKIALRNC 138

Query: 368 NQAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLSKDEWYLLS-IRALSKTLIYV 426
           N+ ++ + N+  +  Q    V Q  G+ML + L Q R +      LLS  R  S+   ++
Sbjct: 139 NELVQYMVNLQDELYQNWASVFQYVGVMLCIKLKQHRRVKTSFHGLLSQCREKSQWKWFL 198

Query: 427 NPETAFSKYSPLSAAPFLFENLPLPNDNALSELQFTQLDT 466
           N    +  Y        L E  P+P D AL EL+ T+L T
Sbjct: 199 N--LCYVNY-------LLNERFPIPED-ALQELRSTELHT 228

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,768,538
Number of extensions: 807968
Number of successful extensions: 3021
Number of sequences better than 10.0: 24
Number of HSP's gapped: 3101
Number of HSP's successfully gapped: 24
Length of query: 651
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 543
Effective length of database: 12,857,365
Effective search space: 6981549195
Effective search space used: 6981549195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)