Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E16720g30530015260.0
AER390W3163037601e-100
CAGL0M08690g3283176943e-90
Scas_615.133303166874e-89
YDR265W (PEX10)3373146874e-89
Kwal_55.199991521462951e-32
Sklu_1676.3101622422e-25
CAGL0B05049g1470461224e-07
Sklu_2432.91475391181e-06
Kwal_14.12871518571145e-06
YOL054W406431101e-05
CAGL0E01441g717351082e-05
KLLA0F12166g1528411082e-05
CAGL0J03586g411431063e-05
KLLA0E03960g704251064e-05
Scas_720.89469391054e-05
Scas_573.91502421064e-05
AFR499C250551035e-05
YDR143C (SAN1)610351055e-05
Scas_665.1392431037e-05
Kwal_23.6285458391029e-05
YLR247C1556421012e-04
AAL030C1539581002e-04
Scas_477.724451972e-04
KLLA0C08756g42739983e-04
AAR049C44339983e-04
Kwal_56.2252251365983e-04
YCR066W (RAD18)48739983e-04
AGL217W41443974e-04
ACL019C57565974e-04
CAGL0I09988g38748964e-04
Sklu_2317.249333966e-04
Kwal_56.2390058948930.001
KLLA0B08679g36350920.001
YLR323C (CWC24)25954910.002
Kwal_47.1777197258920.002
YOL013C (HRD1)55157920.002
Scas_713.4557034910.002
Scas_625.476131910.003
Sklu_2102.175131910.003
Sklu_1785.333136890.004
AGL191W58236890.004
CAGL0K08052g30548870.005
CAGL0E02299g54551880.005
Scas_644.651053870.006
AER074W64339870.008
YKL034W (TUL1)75831860.009
KLLA0C18260g22939840.010
CAGL0L01947g75730860.011
Kwal_27.1041930033840.011
Sklu_2411.239348850.011
KLLA0F25674g75730860.011
Kwal_26.809975030850.012
Kwal_26.824738649840.015
AFR275W75330840.016
Kwal_23.366076845830.024
CAGL0A00935g22656800.029
CAGL0D00638g69341810.037
Sklu_2423.864741810.039
Scas_672.226351790.048
Kwal_27.1072322947780.056
Kwal_23.413966839800.059
YDL074C (BRE1)70041790.066
Scas_551.371239780.091
Scas_674.12d132347780.11
YOL138C134146780.11
Scas_705.4142846760.15
YHL010C58549760.17
Kwal_47.1763824858740.17
CAGL0J04796g59957760.17
CAGL0G03553g21047730.23
Sklu_2412.7112758750.25
YLR427W (MAG2)67067740.26
AER113W66567740.28
Scas_719.5164757730.33
KLLA0F17479g111452740.35
CAGL0H10274g11451690.36
KLLA0B02981g66341730.39
CAGL0K02563g58644730.41
CAGL0G09493g140832730.41
Scas_591.1077246730.42
Scas_534.226541710.44
CAGL0A03432g115151720.46
Kwal_47.1709960558720.47
KLLA0D02552g61960720.52
AGL289C24147700.58
CAGL0M08668g65746710.68
YLR032W (RAD5)116954710.72
KLLA0F18458g14045661.1
YBR114W (RAD16)79045691.2
KLLA0C05874g55325681.3
Kwal_26.809052044681.4
AAR147W158043681.7
Scas_721.100113735681.8
Scas_699.3861246671.8
Scas_625.1127424662.0
CAGL0K07766g83045672.3
AFR220W108550663.0
KLLA0F25740g51744653.5
ADL181W10857613.7
AGR034W15924624.2
Kwal_26.803066044644.9
Kwal_27.1054610449604.9
ABR104W32847635.0
Sklu_2185.297454645.3
Scas_615.1267441636.4
KLLA0E16698g65646636.5
Scas_601.995754636.5
KLLA0E07139g11059596.8
YMR202W (ERG2)22240618.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E16720g
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...   592   0.0  
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...   297   e-100
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...   271   3e-90
Scas_615.13                                                           269   4e-89
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...   269   4e-89
Kwal_55.19999                                                         118   1e-32
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         98   2e-25
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    52   4e-07
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              50   1e-06
Kwal_14.1287                                                           49   5e-06
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    47   1e-05
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    46   2e-05
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    46   2e-05
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    45   3e-05
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    45   4e-05
Scas_720.89                                                            45   4e-05
Scas_573.9                                                             45   4e-05
AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH] (1339549.....    44   5e-05
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    45   5e-05
Scas_665.1                                                             44   7e-05
Kwal_23.6285                                                           44   9e-05
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    44   2e-04
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    43   2e-04
Scas_477.7                                                             42   2e-04
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    42   3e-04
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    42   3e-04
Kwal_56.22522                                                          42   3e-04
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    42   3e-04
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    42   4e-04
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    42   4e-04
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    42   4e-04
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            42   6e-04
Kwal_56.23900                                                          40   0.001
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    40   0.001
YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein ...    40   0.002
Kwal_47.17771                                                          40   0.002
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    40   0.002
Scas_713.45                                                            40   0.002
Scas_625.4                                                             40   0.003
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          40   0.003
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         39   0.004
AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH] complement(...    39   0.004
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    38   0.005
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    39   0.005
Scas_644.6                                                             38   0.006
AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH] complement(...    38   0.008
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    38   0.009
KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces...    37   0.010
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    38   0.011
Kwal_27.10419                                                          37   0.011
Sklu_2411.2 YMR026C, Contig c2411 3617-4798                            37   0.011
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    38   0.011
Kwal_26.8099                                                           37   0.012
Kwal_26.8247                                                           37   0.015
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    37   0.016
Kwal_23.3660                                                           37   0.024
CAGL0A00935g complement(97372..98052) some similarities with sp|...    35   0.029
CAGL0D00638g complement(80947..83028) similar to tr|Q07457 Sacch...    36   0.037
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       36   0.039
Scas_672.2                                                             35   0.048
Kwal_27.10723                                                          35   0.056
Kwal_23.4139                                                           35   0.059
YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin l...    35   0.066
Scas_551.3                                                             35   0.091
Scas_674.12d                                                           35   0.11 
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    35   0.11 
Scas_705.41                                                            34   0.15 
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    34   0.17 
Kwal_47.17638                                                          33   0.17 
CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces c...    34   0.17 
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    33   0.23 
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          33   0.25 
YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing ...    33   0.26 
AER113W [2618] [Homologous to ScYLR427W - SH] complement(848584....    33   0.28 
Scas_719.51                                                            33   0.33 
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    33   0.35 
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    31   0.36 
KLLA0B02981g complement(267798..269789) similar to sgd|S0002232 ...    33   0.39 
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    33   0.41 
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    33   0.41 
Scas_591.10                                                            33   0.42 
Scas_534.2                                                             32   0.44 
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    32   0.46 
Kwal_47.17099                                                          32   0.47 
KLLA0D02552g complement(215290..217149) similar to sgd|S0004419 ...    32   0.52 
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    32   0.58 
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...    32   0.68 
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    32   0.72 
KLLA0F18458g complement(1697871..1698293) some similarities with...    30   1.1  
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    31   1.2  
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    31   1.3  
Kwal_26.8090                                                           31   1.4  
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    31   1.7  
Scas_721.100                                                           31   1.8  
Scas_699.38                                                            30   1.8  
Scas_625.11                                                            30   2.0  
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    30   2.3  
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    30   3.0  
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    30   3.5  
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    28   3.7  
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    28   4.2  
Kwal_26.8030                                                           29   4.9  
Kwal_27.10546                                                          28   4.9  
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    29   5.0  
Sklu_2185.2 YNL023C, Contig c2185 1566-4490 reverse complement         29   5.3  
Scas_615.12                                                            29   6.4  
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...    29   6.5  
Scas_601.9                                                             29   6.5  
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    27   6.8  
YMR202W (ERG2) [4158] chr13 (667536..668204) Sterol C8-C7 isomer...    28   8.0  

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/300 (95%), Positives = 287/300 (95%)

Query: 1   MAPDMKFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLI 60
           MAPDMKFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLI
Sbjct: 1   MAPDMKFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLI 60

Query: 61  YLSITTLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKLN 120
           YLSITTLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKLN
Sbjct: 61  YLSITTLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKLN 120

Query: 121 ERGSGFLKVFNGKSFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVE 180
           ERGSGFLKVFNGKSFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVE
Sbjct: 121 ERGSGFLKVFNGKSFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVE 180

Query: 181 FKKKSSQNYKILGFILGMQLASKLLPQIAEYIADRIGTDDGXXXXXXXXXXXXXTSKDLS 240
           FKKKSSQNYKILGFILGMQLASKLLPQIAEYIADRIGTDDG             TSKDLS
Sbjct: 181 FKKKSSQNYKILGFILGMQLASKLLPQIAEYIADRIGTDDGKSHKSLSALAKKHTSKDLS 240

Query: 241 DLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRCPRQL 300
           DLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRCPRQL
Sbjct: 241 DLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRCPRQL 300

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 147/303 (48%), Positives = 203/303 (66%), Gaps = 10/303 (3%)

Query: 7   FPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLIYLSITT 66
           FPFADAPSIVQAHQKD  +E++L  K++D L+ +KGQ F NRY  EI I SK++YL +TT
Sbjct: 8   FPFADAPSIVQAHQKDVYIESILGTKLEDALKALKGQLFANRYYQEISIASKILYLGLTT 67

Query: 67  LRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKL-----NE 121
           LR RRTLGEEYVDL YV R G G+ +  RR+ F +SY  +P+ LSK+F + K        
Sbjct: 68  LRERRTLGEEYVDLIYVSRNGMGLVKAWRRLLFVLSYAALPYGLSKLFKRLKRRYEDDTP 127

Query: 122 RGSGFLKVFNGKSFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVEF 181
             +G L    G +F+DI+D+ L++HL++FYL+G +Y ISKRIFG+RY +GH++ K E EF
Sbjct: 128 NKNGILHYLAGLTFKDIMDNALSVHLLVFYLTGGFYQISKRIFGLRYAIGHDVTKEEKEF 187

Query: 182 KKKSSQNYKILGFILGMQLASKLLPQIAEYIAD--RIGTDDGXXXXXXXXXXXXXTSK-- 237
           +K SS++Y+ILG ++ +QL +K+ P +   +    +  T++               +   
Sbjct: 188 RKSSSRSYRILGGLVLLQLLAKVQPHVNTMLKMYLKSPTENATNKNGILTNGSPEATARH 247

Query: 238 -DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRC 296
            +LS+ E+ PFI E SRKC+LCL  M DPS  PCGH+FCW C+M+W  ER ECPLCRQ C
Sbjct: 248 IELSNPEIFPFISEQSRKCILCLADMTDPSCLPCGHMFCWACVMQWCNERNECPLCRQHC 307

Query: 297 PRQ 299
            +Q
Sbjct: 308 TKQ 310

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score =  271 bits (694), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 201/317 (63%), Gaps = 24/317 (7%)

Query: 6   KFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLIYLSIT 65
           K PFA APSIVQAHQKD+ +E +L  K+ ++LR V+GQ F N Y  EI ++ KLIYL +T
Sbjct: 9   KLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRGQLFINNYQKEISVVVKLIYLGLT 68

Query: 66  TLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKLNERGSG 125
           T   RRTLGEEYVDL YV++RG  + R ++R+ F +SY  +P++++K+    K+N R + 
Sbjct: 69  TALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVLSYTSIPYLVTKL--SKKVNNRSTN 126

Query: 126 FLKVFNGK--SFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVEFKK 183
             +  +G   ++ DIL + ++LHL++FY++G YYD+ KR +GMRY +GH +++ E  ++ 
Sbjct: 127 NEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVFKRFWGMRYALGHTLSQEEENYRD 186

Query: 184 KSSQNYKILGFILGMQLASK----------LLPQIAEYI---ADRIGTDDGXXXXXXXXX 230
           KSS++YKILG+I+ +Q  SK          +LPQ  E +   ++ +G  +G         
Sbjct: 187 KSSKSYKILGYIILLQHISKVKPIINKVLSILPQTKETLNAGSNGVGLKEGFAPAATPGL 246

Query: 231 XXXXTSK------DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTL 284
                         LS+ + L FI  +SR C+LCL  M DPS  PCGH+FCWDCI +WT 
Sbjct: 247 LTDVPENFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPSCLPCGHVFCWDCITDWTK 306

Query: 285 ERQECPLCRQRC-PRQL 300
           E  ECPLCRQR  P+Q+
Sbjct: 307 ENPECPLCRQRSYPQQV 323

>Scas_615.13
          Length = 330

 Score =  269 bits (687), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 197/316 (62%), Gaps = 22/316 (6%)

Query: 2   APDMKFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLIY 61
           +  +  PFADAP+IVQAHQKD  +E++L +K+  +L  +KGQ FTN Y  EI I  KL+Y
Sbjct: 13  SSSLALPFADAPTIVQAHQKDLQIESILTEKLTTLLTSLKGQLFTNTYPKEISIAVKLLY 72

Query: 62  LSITTLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVF----YKY 117
           L++TT R RRTLGEEYVDL YVDR+G G+ +  R++ F +SY   P++++KV+     K 
Sbjct: 73  LTLTTFRGRRTLGEEYVDLIYVDRKGTGLVKRYRKLLFILSYTLGPYLITKVYNKLCAKI 132

Query: 118 KLNERGSGFLKVFNGKSFRDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKN 177
             NE      K+    S + +L + +  HL++FY  G YY+ISKR+FG+RY +GHE + N
Sbjct: 133 YANEEDENRKKI----SLKQVLSAIVETHLVLFYFKGAYYEISKRLFGLRYSIGHEPSAN 188

Query: 178 EVEFKKKSSQNYKILGFILGMQLASKLLPQI-----AEYIADRIGT---------DDGXX 223
           E + +++S+  YK+LG I+ +Q  +++LP       + Y  D  GT         D    
Sbjct: 189 EAQTREQSTNTYKLLGNIMLLQQTAEVLPICKGWFKSYYSKDEKGTLTNEKQSQGDIQAG 248

Query: 224 XXXXXXXXXXXTSKDLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWT 283
                         +LSD E+ PFI ED+RKC+LCL YM DPS +PCGH+FCW+CI++W 
Sbjct: 249 ILTRIPNESEVNHLNLSDKEIFPFIPEDARKCILCLAYMTDPSCSPCGHIFCWECILDWC 308

Query: 284 LERQECPLCRQRCPRQ 299
            ER ECPLCRQ C  Q
Sbjct: 309 KERPECPLCRQECQIQ 324

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score =  269 bits (687), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 186/314 (59%), Gaps = 18/314 (5%)

Query: 4   DMKFPFADAPSIVQAHQKDDTVENLLLQKIQDVLRKVKGQQFTNRYVSEIMILSKLIYLS 63
            ++FPFADAPSIVQAHQKD+ ++ LL+ K+ ++ + +K Q F N Y  E+ I +KL+YL 
Sbjct: 17  QLRFPFADAPSIVQAHQKDEQIQGLLIMKVTELCKLIKSQLFVNSYPKELSIFAKLLYLL 76

Query: 64  ITTLRYRRTLGEEYVDLAYVDRRGKGVARLLRRIGFAISYCGVPWILSKVFYKYKLNERG 123
            TT R  RTLGEEYVDL Y +R+G  +A  L+ I FA +Y   P+ ++K++ K   N + 
Sbjct: 77  FTTGRRGRTLGEEYVDLTYTNRKGTRLAGRLKMIVFAFAYPLCPYFITKLYKKIMKNNKE 136

Query: 124 SGFLKVFNGKSF-RDILDSTLNLHLIIFYLSGQYYDISKRIFGMRYVVGHEMNKNEVEFK 182
           S      +  +F + +LD  L++H+ +FY  G +Y ISKRIFGMRYV  H ++KNE  F+
Sbjct: 137 SKIEDTESVAAFCKGLLDFILDVHMTLFYFKGAFYSISKRIFGMRYVFKHILSKNEANFR 196

Query: 183 KKSSQNYKILGFILGMQLASKLLP----QIAEYIADRIGTDDGXXXXXX----------- 227
           ++ SQ YK+LG+IL  Q   K  P     +  +I  R  T+D                  
Sbjct: 197 EEGSQKYKVLGYILLAQNVMKWYPVLTSTLGSWIYGRKRTNDSITRSSVGLQERSEHESI 256

Query: 228 --XXXXXXXTSKDLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLE 285
                    T  +LSD   LPFI E SRKC+LCL  M DPS  PCGHLFCW C+M W  E
Sbjct: 257 EGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSCAPCGHLFCWSCLMSWCKE 316

Query: 286 RQECPLCRQRCPRQ 299
           R ECPLCRQ C  Q
Sbjct: 317 RPECPLCRQHCQPQ 330

>Kwal_55.19999
          Length = 152

 Score =  118 bits (295), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 78/146 (53%), Gaps = 12/146 (8%)

Query: 166 MRYVVGHEMNKNEVEFKKKSSQNYKILGFILGMQLASKLLPQIAEYIADRIGTDDGXXXX 225
           MRY VGH+++++E+ F++  ++ Y+ILG +L +QL SK L     ++   I  D      
Sbjct: 1   MRYAVGHKLDESEIRFRESGNKTYRILGTLLLVQLFSKRLLPAFRWMKGLIADDQNEKAT 60

Query: 226 XXXXXXXXXTSK------------DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHL 273
                     S              L     + FI  DSRKC+LCL +MLDPS  PCGH+
Sbjct: 61  SSLSVGETTLSTAGLPTDSQVEHIGLEQASEMSFIPSDSRKCILCLGFMLDPSCAPCGHV 120

Query: 274 FCWDCIMEWTLERQECPLCRQRCPRQ 299
           FCW C++ W  ER ECPLCRQ C  Q
Sbjct: 121 FCWKCLLSWCNERPECPLCRQTCHAQ 146

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 97.8 bits (242), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 47/62 (75%)

Query: 238 DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
           DLSD   +PFI E SRKC+LCL  M DPS  PCGH+FCW+CI+ W  ER ECPLCRQ+C 
Sbjct: 34  DLSDPAQMPFINESSRKCILCLTEMKDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCL 93

Query: 298 RQ 299
           +Q
Sbjct: 94  KQ 95

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 249  KEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQ 294
            K  + +C +CL  + + +   CGHLFC  CI  W   R+ CPLC+ 
Sbjct: 1158 KNTTMECSICLQPITNGAMVNCGHLFCTSCIFSWLKNRKTCPLCKH 1203

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 255  CVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293
            C +C N +   S   CGH FC+ CI  W  E   CPLC+
Sbjct: 1165 CAVCFNEIFVGSVVKCGHFFCYSCIHTWLKEHNTCPLCK 1203

>Kwal_14.1287
          Length = 1518

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 242  LEVLPFIKEDSR-----KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293
            LE L  +KE+        C +CL  +   S   CGH FC DCI  W      CPLC+
Sbjct: 1171 LETLLRLKENLNGEHKFSCTICLGEIYMGSVIKCGHFFCQDCICSWLKNHSSCPLCK 1227

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 4/43 (9%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEW----TLERQECPLCR 293
           C +C +YM  P  TPCGH +C+ C+  W    T +   CP CR
Sbjct: 30  CSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCR 72

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 261 YMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQR 295
           Y+  P   PCGH+F   C+ EWT     CPLCR++
Sbjct: 286 YLHSPVKIPCGHIFGRSCLYEWTRLENSCPLCRKK 320

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 255  CVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQR 295
            C +C + +   S   CGH FC DC+  W  +   CP+C+ R
Sbjct: 1208 CAVCYSDIYTGSILKCGHFFCKDCVTHWFKKNTSCPMCKNR 1248

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%)

Query: 250 EDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +D  +C +C +++ +P  TPCGH FC  CI  +     +CPLC
Sbjct: 22  DDLLRCHICKDFLKNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 269 PCGHLFCWDCIMEWTLERQECPLCR 293
           PCGH+F  +C+ +WT E   CP+CR
Sbjct: 218 PCGHVFGRECLYKWTTEHNSCPICR 242

>Scas_720.89
          Length = 469

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +C +C +++  P  TPC H FC  CI E+  +  +CPLC
Sbjct: 27  RCHICKDFLKVPVLTPCSHTFCSLCIREYLKDNSKCPLC 65

>Scas_573.9
          Length = 1502

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 252  SRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293
            S KC +CL  +   S   CGH FC  CI  W   ++ CP+C+
Sbjct: 1188 SFKCSICLQDISLGSMLKCGHFFCKRCITSWLKNKKNCPMCK 1229

>AFR499C [3691] [Homologous to ScYLR323C (CWC24) - SH]
           (1339549..1340301) [753 bp, 250 aa]
          Length = 250

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 238 DLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +  DL+ +PF      +CVLC  +   P  T CGH FC  C      E ++C +C
Sbjct: 147 EARDLDSIPF------RCVLCRGHYRAPVRTRCGHYFCGGCFARRVRETRQCAVC 195

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 261 YMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQR 295
           Y   P   PCGH+F  +CI +W+     CPLCRQ+
Sbjct: 248 YKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQK 282

>Scas_665.1
          Length = 392

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 4/43 (9%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEW--TLERQE--CPLCR 293
           C +C  YM  P  T CGH +C+ C+  W  T  ++E  CP CR
Sbjct: 30  CTICSEYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCR 72

>Kwal_23.6285
          Length = 458

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +C +C +++  P  TPC H FC  CI E+      CPLC
Sbjct: 36  RCHICKDFIKSPVLTPCAHTFCSLCIREYLNRELRCPLC 74

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 255  CVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQRC 296
            C +CL  +   +   CGH FC  CI+ W     +CP+C+  C
Sbjct: 1239 CSICLGEVEIGAIIKCGHYFCKSCILTWLRAHSKCPICKGFC 1280

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 237  KDLSDLEVLPFIKEDSR-KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293
            ++L+ LE    +K++ R  C +CL  + D +    GH +C +CI  W   +Q CPLC+
Sbjct: 1202 QNLTKLE--QALKDNMRFNCTICLCDICDGAIIGRGHFYCQECISSWLETKQSCPLCK 1257

>Scas_477.7
          Length = 244

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 6/51 (11%)

Query: 242 LEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           LE +PF      KCVLC +    P  T CGH FC  C  +   E   C +C
Sbjct: 14  LEEIPF------KCVLCKDDYKSPIVTNCGHYFCSSCFTKRVREDASCFIC 58

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +C +C +++     TPCGH FC  CI ++  +  +CPLC
Sbjct: 31  RCHICKDFLKASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +C +C + +  P  T CGH FC  CI E+  +   CPLC
Sbjct: 31  RCHICKDMLQTPVLTQCGHTFCSLCIREYLNKESRCPLC 69

>Kwal_56.22522
          Length = 513

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 10/65 (15%)

Query: 239 LSDLEVLPFIKEDSRKCVLCLNYMLDPSAT----------PCGHLFCWDCIMEWTLERQE 288
           L D+        D + C++C++ ML PS            PC H     C+  W    Q 
Sbjct: 300 LPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQT 359

Query: 289 CPLCR 293
           CP+CR
Sbjct: 360 CPICR 364

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
           repair protein, required for post-replication repair
           [1464 bp, 487 aa]
          Length = 487

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +C +C +++  P  TPCGH FC  CI      +  CPLC
Sbjct: 27  RCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLC 65

>AGL217W [4095] [Homologous to ScYOL054W - SH]
           complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 4/43 (9%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEW----TLERQECPLCR 293
           C +C +YM  P  T CGH +C+ CI  W    +     CP CR
Sbjct: 38  CTICHDYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCR 80

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 239 LSDLEVLPFIKEDSRKCVLCLNYMLDPSAT----------PCGHLFCWDCIMEWTLERQE 288
           LSD+        DS  C++C++ ML  + T          PCGH+  + C+  W    Q 
Sbjct: 305 LSDVSEEQLDDTDS-MCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQT 363

Query: 289 CPLCR 293
           CP+CR
Sbjct: 364 CPICR 368

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 5/48 (10%)

Query: 251 DSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQE-----CPLCR 293
           D+  C +C +YM  P  T CGH +C+ C+  W           CP CR
Sbjct: 26  DTTICSICHDYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 261 YMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293
           Y   P+   CGH F   CI +WT E   CP+CR
Sbjct: 132 YKHSPTQLKCGHRFGRMCIYQWTKEHNSCPICR 164

>Kwal_56.23900
          Length = 589

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%)

Query: 246 PFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCR 293
           P   E+S      + Y   P   PC H+F  +CI +WT     CP+CR
Sbjct: 203 PKDNENSGDDQGKVTYKHSPVQLPCSHVFGRECIRQWTNLHNTCPICR 250

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 251 DSRKCVLCLNYMLDPSATPCGHLFCWDCI------MEWTLERQECPLCRQ 294
           DS  C +C +YM  P  T CGH +C++C+          +    CP CR 
Sbjct: 26  DSTVCTICHDYMFVPVMTSCGHNYCYECLNNWLNNNRSNVSELTCPQCRN 75

>YLR323C (CWC24) [3710] chr12 complement(778173..778952) Protein
           containing a CCCH-type zinc finger domain, which bind
           DNA or RNA, and a C3HC4 type (RING) zinc finger, which
           may mediate protein-protein interactions, has low
           similarity to uncharacterized zinc finger protein 183
           (human ZNF183) [780 bp, 259 aa]
          Length = 259

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 241 DLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQ 294
           DLE +PF      KC LC      P  T CGH FC  C  +   +  +C +C +
Sbjct: 191 DLEKIPF------KCTLCKEDYKSPVVTNCGHYFCGSCFAKDMKKGTKCFICHK 238

>Kwal_47.17771
          Length = 972

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 11/58 (18%)

Query: 254 KCVLCLNYMLDPSA----TPCGHLFCWDCIMEW---TLERQE---CPLCRQRC-PRQL 300
           +C +C +  +DP      T CGH FC  CI+E+     ERQ+   CP CR    P++L
Sbjct: 718 ECSICTSEPIDPVTQVIFTECGHAFCELCILEYIRFQTERQQDIKCPNCRHEINPKRL 775

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 24/57 (42%), Gaps = 13/57 (22%)

Query: 250 EDSRKCVLCLNYMLD-------------PSATPCGHLFCWDCIMEWTLERQECPLCR 293
            D   C++C++ ++              P   PCGH+    C+  W    Q CP+CR
Sbjct: 344 NDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400

>Scas_713.45
          Length = 570

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%)

Query: 261 YMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQ 294
           Y   P+  PCGH+F  +C+  W      CPLCR 
Sbjct: 226 YNHSPTKLPCGHIFGRECLYRWCKLENTCPLCRH 259

>Scas_625.4
          Length = 761

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 267 ATPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
            TPC H+F  DC+  W   + +CP+CR   P
Sbjct: 729 VTPCDHIFHTDCLENWMGYKLQCPVCRTPLP 759

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 267 ATPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
            TPCGH+F   C+  W   + +CP+CR   P
Sbjct: 719 VTPCGHIFHTQCLESWMSYKLQCPVCRAPLP 749

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 262 MLDPSATPCGHLFCWDCIMEWTLERQE----CPLCR 293
           ML P  T CGH +C+DCI  W          CP CR
Sbjct: 1   MLVPVMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>AGL191W [4121] [Homologous to ScYDR143C (SAN1) - SH]
           complement(339295..341043) [1749 bp, 582 aa]
          Length = 582

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%)

Query: 260 NYMLDPSATPCGHLFCWDCIMEWTLERQECPLCRQR 295
           +Y   P+  PCGH+F  DCI  WT E      C  R
Sbjct: 216 HYKHSPTELPCGHVFGRDCIFRWTQEHNSLSYCWAR 251

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 252 SRKCVLCLNYMLDPSAT----PCGHLFCWDCIMEW--TLERQECPLCR 293
           S+ C +CL  +   S+T    PCGH +  DCI +W    E  +CP+CR
Sbjct: 3   SKVCAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCR 50

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 12/51 (23%)

Query: 255 CVLCLNYMLD------------PSATPCGHLFCWDCIMEWTLERQECPLCR 293
           C++C++ ++             P   PCGH+    C+  W    Q CP+CR
Sbjct: 350 CIVCMDELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICR 400

>Scas_644.6
          Length = 510

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query: 248 IKEDSRKCVLCLNYMLDPSAT-------PCGHLFCWDCIMEWTLERQECPLCR 293
           +++    C++C++ +L            PCGH     C+  W    Q CP+CR
Sbjct: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398

>AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH]
           complement(775019..776950) [1932 bp, 643 aa]
          Length = 643

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLC 292
           C LC     D     CGH+FC DC  E    R ++CP C
Sbjct: 591 CSLCSKNWKDTVIKTCGHVFCADCCKERLAARMRKCPTC 629

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 267 ATPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
            TPC H+F   C+  W   + +CP+CR   P
Sbjct: 726 VTPCNHVFHTSCLENWMNYKLQCPVCRSPLP 756

>KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces
           cerevisiae YLR323c singleton, start by similarity
          Length = 229

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 17/39 (43%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           +C LC      P  T C H FC  C M+       CP+C
Sbjct: 170 RCFLCKKEYTSPVVTKCNHYFCSSCFMKQMKVSTNCPIC 208

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 268 TPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
           TPC H+F   C+  W   + +CP+CR   P
Sbjct: 726 TPCDHMFHTSCLESWMSYKLQCPVCRSPLP 755

>Kwal_27.10419
          Length = 300

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 265 PSATPCGHLFCWDCIMEWTLERQE----CPLCR 293
           P  T CGH +C+DCI  W +        CP CR
Sbjct: 4   PVMTTCGHNYCYDCISNWLVSNNANELTCPQCR 36

>Sklu_2411.2 YMR026C, Contig c2411 3617-4798
          Length = 393

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 249 KEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQ-ECPLCRQR 295
           K+ S KC +C   + +P A   G++FC+ C++ +    + +CP+  +R
Sbjct: 323 KQTSTKCEICHQIITNPCAIETGYVFCYPCVLNYLPANEGKCPVTGKR 370

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 268 TPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
           TPC H+F  +C+  W   + +CP+CR   P
Sbjct: 726 TPCSHIFHTECLENWMSYKLQCPVCRAPLP 755

>Kwal_26.8099
          Length = 750

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 268 TPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
           TPC H+F   C+  W   + +CP+CR   P
Sbjct: 719 TPCSHIFHTQCLESWMSYKLQCPVCRAPLP 748

>Kwal_26.8247
          Length = 386

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 245 LPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQ-ECPLC 292
           LP  K +   C +C   + +P+A   G++FC+ CI+E+  + +  CP+ 
Sbjct: 312 LPHEKNEDGTCRICKGPIQNPAAIGTGYVFCYPCILEYLPQHEGRCPVT 360

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 268 TPCGHLFCWDCIMEWTLERQECPLCRQRCP 297
           TPC HLF   C+  W   + +CP+CR   P
Sbjct: 722 TPCSHLFHTGCLENWMSYKLQCPVCRAPLP 751

>Kwal_23.3660
          Length = 768

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWT------LERQECPLCR 293
           C LC +   +P  + C H FC  CI E+T      LE+  CP+C 
Sbjct: 515 CQLCDDEAEEPIESKCHHRFCRLCIKEYTESFLENLEKLTCPVCH 559

>CAGL0A00935g complement(97372..98052) some similarities with
           sp|P53769 Saccharomyces cerevisiae YLR323c, hypothetical
           start
          Length = 226

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 6/56 (10%)

Query: 237 KDLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           K+ +  E +PF      KCVLC      P  T CGH FC  C +      + C +C
Sbjct: 153 KEETRKEAVPF------KCVLCKESYERPVKTNCGHYFCQKCFVNRIKIDKSCFIC 202

>CAGL0D00638g complement(80947..83028) similar to tr|Q07457
           Saccharomyces cerevisiae YDL074c BRE1, hypothetical
           start
          Length = 693

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLCRQ 294
           C LC     + +   CGH+FC DC  E    R ++CP C +
Sbjct: 641 CSLCSKNWKNMAIRTCGHVFCEDCCKERLAARMRKCPTCNK 681

>Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement
          Length = 647

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLCRQ 294
           C LC     + +   CGH+FC +C  E    R ++CP C +
Sbjct: 595 CSLCSKNWKNTAIKSCGHVFCEECCKERLAARMRKCPTCNK 635

>Scas_672.2
          Length = 263

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 14/51 (27%)

Query: 254 KCVLCLNYMLDPSAT----PCGHLFCWDCIMEWTLERQ------ECPLCRQ 294
           +C +C+    DP  T    PCGH+FC DC+ +     +       C LCR+
Sbjct: 196 RCPICM----DPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRK 242

>Kwal_27.10723
          Length = 229

 Score = 34.7 bits (78), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQ------ECPLCRQ 294
           KC +C         TPCGH+FC +C+ +     +       C LCR+
Sbjct: 163 KCPICFEPPEAALVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCRR 209

>Kwal_23.4139
          Length = 668

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLC 292
           C LC     + +   CGH+FC +C  E    R ++CP C
Sbjct: 616 CSLCSKNWKNTAIKNCGHVFCEECCKERLAARMRKCPTC 654

>YDL074C (BRE1) [794] chr4 complement(324047..326149) Ubiquitin
           ligase (E3), may be required for Rad6p function in
           chromatin modification, plays a role in gene silencing
           [2103 bp, 700 aa]
          Length = 700

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLCRQ 294
           C LC     + +   CGH+FC +C  E    R ++CP C +
Sbjct: 648 CSLCSKNWKNMAIKTCGHVFCENCCKERLAARMRKCPTCNK 688

>Scas_551.3
          Length = 712

 Score = 34.7 bits (78), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLC 292
           C LC     + +   CGH+FC +C  E    R ++CP C
Sbjct: 660 CSLCSKNWKNMAIKTCGHVFCEECCKERLAARMRKCPTC 698

>Scas_674.12d
          Length = 1323

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 251  DSRKCVLCLNYMLDPSATP----CGHLFCWDCIMEWTLERQECPLCR 293
            DS  CV CL   L+P +T     CGHL C  CI  +  E+   P  +
Sbjct: 1030 DSATCVWCLE-QLEPESTSILTSCGHLLCDACIDPFYSEQSTLPTAK 1075

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 249  KEDSRKCVLCLNYM--LDPSATPCGHLFCWDCIMEWTLE--RQECP 290
            K+ +  CVLC   +  L     PCGH   + CI EW L+   QECP
Sbjct: 1287 KKKNTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECP 1332

>Scas_705.41
          Length = 428

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 255 CVLCLNYMLDPSA-----TPCGHLFCWDCIMEWT--LERQECPLCR 293
           C +C + + D         PC H + +DCI  W    +  +CPLCR
Sbjct: 12  CPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 8/49 (16%)

Query: 255 CVLCLNYMLDPSAT-----PCGHLFCWDCIMEWTLERQECPLCRQRCPR 298
           C +CL  M D   T     PC H F   C+ +W   R  CP+CR    R
Sbjct: 240 CPVCLERM-DSETTGLVTIPCQHTFHCQCLNKWKNSR--CPVCRHSSLR 285

>Kwal_47.17638
          Length = 248

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 235 TSKDLSDLEVLPFIKEDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQECPLC 292
           + +D   L  +PF      KC++C      P  T C H FC  C +    +  +C +C
Sbjct: 174 SKEDTEKLRSIPF------KCLICKGDYKKPVVTKCQHYFCSSCFLAKARKTTKCVVC 225

>CAGL0J04796g 453697..455496 similar to tr|Q06436 Saccharomyces
           cerevisiae YLR427w, hypothetical start
          Length = 599

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 17/57 (29%)

Query: 253 RKCVLCLNYM-LDPSATPCGHLFCWDCIME-WTLER---------------QECPLC 292
           + C +CLN + + P    CGH+FC  C+   + +E                +ECPLC
Sbjct: 150 QNCPICLNEIPVAPRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLC 206

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQE------CPLCRQ 294
           KC +C         TPCGH+FC +C+ +     +       C LCR+
Sbjct: 145 KCPICFEPPDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRK 191

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 11/58 (18%)

Query: 254 KCVLCLNYMLDPSA----TPCGHLFCWDCIMEW----TLERQE--CPLCRQRC-PRQL 300
           +C +C +  ++P      T C H FC  C++E+    T ++ E  CP CR+   P++L
Sbjct: 873 ECSICTSEPIEPITQVIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRL 930

>YLR427W (MAG2) [3803] chr12 (988424..990436) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.6916p [2013 bp, 670 aa]
          Length = 670

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 17/67 (25%)

Query: 243 EVLPFIKEDSRKCVLCLNYM-LDPSATPCGHLFCWDCIME-WTLER-------------- 286
           ++L  I    + C +CL+   + P    CGH+FC  C++  +++E               
Sbjct: 183 KILRVIVPKGQNCSICLSEEPVAPRMVTCGHIFCLSCLLNFFSIEETVKNKETGYSKKKK 242

Query: 287 -QECPLC 292
            +ECPLC
Sbjct: 243 YKECPLC 249

>AER113W [2618] [Homologous to ScYLR427W - SH]
           complement(848584..850581) [1998 bp, 665 aa]
          Length = 665

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 23/67 (34%)

Query: 253 RKCVLCL-NYMLDPSATPCGHLFCWDCIMEWTLER-----------------QECPLC-- 292
           + C +CL   ++ P   PCGH+ C  C++++                     +ECPLC  
Sbjct: 227 QACPICLAEEVVAPRMAPCGHILCMTCMLQFFAAETGREVARAPGAYVRRPPKECPLCGS 286

Query: 293 ---RQRC 296
              ++RC
Sbjct: 287 IVRKERC 293

>Scas_719.51
          Length = 647

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 17/57 (29%)

Query: 253 RKCVLCLNYM-LDPSATPCGHLFCWDCI-----MEWTLER-----------QECPLC 292
           + C +CL+   + P    CGH+FC  C+     +E T++            +ECPLC
Sbjct: 175 QNCPICLSEEPIAPRMITCGHIFCMSCLINFFSIEETIKNPETGYVKKKKYKECPLC 231

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
           Saccharomyces cerevisiae YLR032w RAD5 DNA helicase,
           start by similarity
          Length = 1114

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 10/52 (19%)

Query: 252 SRKCVLCLNYMLDP----SATPCGHLFCWDCIMEWTLERQ------ECPLCR 293
           S +C +C    ++P    S T C H FC  C+ E+   +Q       CP CR
Sbjct: 855 SFECAICTTECIEPLSAVSITECLHTFCEPCLAEYIEFQQNKKLSINCPYCR 906

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 31.2 bits (69), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 248 IKEDSRKCVLCLNYMLDP-----SATPCGHLFCWDCIMEWTLERQECPLCR 293
           +K D    + C N++ D          CGH F ++C+  W  +   CP+CR
Sbjct: 37  LKSDDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTTCPMCR 87

>KLLA0B02981g complement(267798..269789) similar to sgd|S0002232
           Saccharomyces cerevisiae YDL074c BRE1, start by
           similarity
          Length = 663

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLER-QECPLCRQ 294
           C LC     + +   CGH+FC  C  E    R ++CP C +
Sbjct: 611 CSLCSKNWKNTALKTCGHVFCDVCCKERLAARMRKCPTCNK 651

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 8/44 (18%)

Query: 255 CVLCLNYMLDPSAT-----PCGHLFCWDCIMEWTLERQECPLCR 293
           C +CL  M D   T     PC H F   C+ +W  +  +CP+CR
Sbjct: 247 CPVCLERM-DSETTGLITIPCQHTFHCQCLDKW--KNSKCPVCR 287

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 251  DSRKCVLCLNYMLDPSA---TPCGHLFCWDCI 279
            DS  C+ CL  +   SA   + CGHL C DCI
Sbjct: 1115 DSMTCLWCLEQIEPESAFVLSGCGHLICNDCI 1146

>Scas_591.10
          Length = 772

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQE-------CPLCR 293
           C LC +   +P A+ C H FC  CI E+     E       CP+C 
Sbjct: 518 CQLCDDVAEEPIASKCHHKFCRMCIKEYIESFMENNDSKLTCPVCH 563

>Scas_534.2
          Length = 265

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 255 CVLCLNYMLDPSATPCGH-LFCWDCIMEWTLERQECPLCRQ 294
           C  C N+  +P    C H  +C+ C ++  L+R ECP+C++
Sbjct: 216 CHECQNFPCNPYRISCCHNYYCYICSLK-VLKRGECPVCKE 255

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
           cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 11/51 (21%)

Query: 254 KCVLCLNYMLDPSA---TPCGHLFCWDCIMEW-------TLERQECPLCRQ 294
           +C +C    ++ S+   T C H+FC +C+ E+       +L+ Q+CP CR+
Sbjct: 896 ECSICTAEPIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQ-QKCPNCRR 945

>Kwal_47.17099
          Length = 605

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 18/58 (31%)

Query: 253 RKCVLCLNY-MLDPSATPCGHLFCWDCIMEW---TLERQ--------------ECPLC 292
           + C +CL+  ++ P    CGHLFC  C++ +     + Q              ECPLC
Sbjct: 164 QSCPICLSQEIIAPRMVSCGHLFCQTCLLSFFAAGAQEQDKGAGINYKKKRYMECPLC 221

>KLLA0D02552g complement(215290..217149) similar to sgd|S0004419
           Saccharomyces cerevisiae YLR427w, start by similarity
          Length = 619

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 20/60 (33%)

Query: 253 RKCVLCLNY-MLDPSATPCGHLFCWDCIM-------------EWTLER------QECPLC 292
           + C +CL+  ++ P    CGH+FC  C++             E T  R      +ECPLC
Sbjct: 174 QTCPICLSEDLISPRMVVCGHVFCQTCLLQLFTNDPMVGKNDESTYARMKRKDLRECPLC 233

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 31.6 bits (70), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 254 KCVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQ------ECPLCRQ 294
           KC +C +       TPCGH++C  C+ +     +      +C LCR+
Sbjct: 172 KCPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRK 218

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 250 EDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTL--ERQECPLCR 293
           +D+  C++C   ++  S +PC H  C  C        E++ C +CR
Sbjct: 72  DDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICR 117

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
           DNA-dependent ATPase of the Snf2p family of DNA
           helicases, member of the RAD6 epistasis group, involved
           in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query: 252 SRKCVLCLNYMLDPSA---TPCGHLFCWDCIMEWTLERQ-------ECPLCRQR 295
           S +C +C    +D      T CGH FC  C+ E+ +E Q       +CP CR +
Sbjct: 911 SLECSICTTEPMDLDKALFTECGHSFCEKCLFEY-IEFQNSKNLGLKCPNCRNQ 963

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 255 CVLC-LNYMLDP----SATP-CGHLFCWDCIMEWTLERQECPLCR 293
           C +C  N++ DP    +  P C H F  +C+  W      CP+CR
Sbjct: 71  CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 6/45 (13%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQE------CPLCR 293
           C LC +   +P  + C H FC  CI E+     E      CP+C 
Sbjct: 537 CQLCNDEAEEPIESKCHHKFCRLCIKEYVESFMENNNKLTCPVCH 581

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 11/25 (44%)

Query: 269 PCGHLFCWDCIMEWTLERQECPLCR 293
           PC H     C+  W      CP+CR
Sbjct: 377 PCTHALHLSCLKNWIARSPTCPICR 401

>Kwal_26.8090
          Length = 520

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 8/44 (18%)

Query: 255 CVLCLNYMLDPSAT-----PCGHLFCWDCIMEWTLERQECPLCR 293
           C +CL   LD   T     PC H F   C+ +W   R  CP+CR
Sbjct: 227 CPVCLE-RLDSEVTGLATIPCQHTFHCVCLNKWGDNR--CPVCR 267

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 3/43 (6%)

Query: 255  CVLCLNYMLDPSA---TPCGHLFCWDCIMEWTLERQECPLCRQ 294
            C  C+  M   S    TPCGHL C  C+  +  + +E    R+
Sbjct: 1285 CPFCMEQMEIESLSVLTPCGHLLCDACVEPYLEDARESEYARK 1327

>Scas_721.100
          Length = 1137

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 8/35 (22%)

Query: 268 TPCGHLFCWDCIMEW-------TLERQECPLCRQR 295
           T CGH FC  CI E+        LE + CP CR++
Sbjct: 900 TECGHPFCESCIEEYFEFQAGKNLELK-CPNCREQ 933

>Scas_699.38
          Length = 612

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 250 EDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEW--TLERQECPLCR 293
           +D   CV+C N +   + +PC H  C  C        +++ C +CR
Sbjct: 39  DDENVCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICR 84

>Scas_625.11
          Length = 274

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 270 CGHLFCWDCIMEWTLERQECPLCR 293
           C H F ++CI  W  +   CPLCR
Sbjct: 231 CSHHFHFECIKLWLQKNSLCPLCR 254

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 7/45 (15%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWTLERQE-------CPLC 292
           C LC +   +P  + C H FC  CI E+     E       CP+C
Sbjct: 576 CQLCNDEAEEPIESKCHHKFCRLCIREYVESYIESSGSNLTCPVC 620

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 10/50 (20%)

Query: 254 KCVLCLNYMLDPSA----TPCGHLFCWDCIMEWTLERQE------CPLCR 293
           +C +C    + P      T CGH FC  C++E+   + +      CP CR
Sbjct: 831 ECSICTCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNKKGSETICPNCR 880

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 8/44 (18%)

Query: 255 CVLCLNYMLDPS-----ATPCGHLFCWDCIMEWTLERQECPLCR 293
           C +CL   LD        TPC H F   C+ +W  +   CP+CR
Sbjct: 215 CPVCLE-KLDSEVTGLVTTPCQHTFHCKCLDQW--KNGNCPVCR 255

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 28.1 bits (61), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 22/57 (38%), Gaps = 18/57 (31%)

Query: 253 RKCVLCLNYMLDP------------------SATPCGHLFCWDCIMEWTLERQECPL 291
             C +C N++++P                  +   C H F   CI +W L R  CPL
Sbjct: 40  ENCAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 12/24 (50%)

Query: 270 CGHLFCWDCIMEWTLERQECPLCR 293
           CGH F   C+  W      CP+CR
Sbjct: 111 CGHTFDLQCVSVWLSRSTTCPMCR 134

>Kwal_26.8030
          Length = 660

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 5/44 (11%)

Query: 255 CVLCLNYMLDPSA-----TPCGHLFCWDCIMEWTLERQECPLCR 293
           C +C ++M          +PCGH     C  E+T    +CP C+
Sbjct: 386 CPICGDFMFTSVKPVVYMSPCGHAIHQHCFDEYTKHSYKCPSCQ 429

>Kwal_27.10546
          Length = 104

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 6/49 (12%)

Query: 251 DSRKC-VLCLNYMLDP-----SATPCGHLFCWDCIMEWTLERQECPLCR 293
           D+  C + C NY  D          C H F  +C+  W  + + CPLCR
Sbjct: 31  DAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRTCPLCR 79

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 9/47 (19%)

Query: 254 KCVLCLNYMLDPSAT----PCGHLFCWDCIMEW---TLERQECPLCR 293
           +C +C   M  PS      PCGH +   CI +W       + CP+CR
Sbjct: 17  ECSICWESM--PSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Sklu_2185.2 YNL023C, Contig c2185 1566-4490 reverse complement
          Length = 974

 Score = 29.3 bits (64), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 249 KEDSRKCVLC---LNYMLDPSATP-CGHLFCWDCIMEWTLERQECPLCRQ-RCP 297
           K DS  C++C   ++Y     A P C  ++  +CI EW L+  +  L +  +CP
Sbjct: 60  KGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLDKTWKCP 113

>Scas_615.12
          Length = 674

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 255 CVLCLNYMLDPSATPCGHLFCWDCIMEWT--LERQECPLCR 293
           C++C + ++  S +PC H  C  C  +      ++ C +CR
Sbjct: 72  CLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICR 112

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 250 EDSRKCVLCLNYMLDPSATPCGHLFCWDCIMEWTL--ERQECPLCR 293
           + S  C++C   +   + +PC H  C  C +      E+++C  CR
Sbjct: 84  DSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCR 129

>Scas_601.9
          Length = 957

 Score = 28.9 bits (63), Expect = 6.5,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 249 KEDSRKCVLC---LNYMLDPSATP-CGHLFCWDCIMEWTLERQECPLCR-QRCP 297
           K DS  C++C   ++Y     A   C  +F ++CI EW L+  E  + R  +CP
Sbjct: 62  KGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCP 115

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
           cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 27.3 bits (59), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 21/59 (35%), Gaps = 18/59 (30%)

Query: 251 DSRKCVLCLNYMLDPSAT------------------PCGHLFCWDCIMEWTLERQECPL 291
           D   C +C N++++P                      C H F   CI +W   R  CPL
Sbjct: 40  DVDNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>YMR202W (ERG2) [4158] chr13 (667536..668204) Sterol C8-C7
          isomerase (C-8 sterol isomerase), an enzyme of the
          ergosterol biosynthesis pathway [669 bp, 222 aa]
          Length = 222

 Score = 28.1 bits (61), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 14 SIVQAHQKDDTVENL-LLQKIQDVLRKVKGQQFTNRYVSE 52
          S++  H   + +    LLQ ++D L    G ++ NRYV E
Sbjct: 42 SVISKHNAAEGLSTEDLLQDVRDALASHYGDEYINRYVKE 81

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.142    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,306,387
Number of extensions: 379474
Number of successful extensions: 1397
Number of sequences better than 10.0: 130
Number of HSP's gapped: 1406
Number of HSP's successfully gapped: 130
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)