Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E16698g65664029220.0
Sklu_1676.265055911191e-145
Kwal_55.2000061754510841e-140
AER391C63254810481e-134
Scas_699.386125669741e-123
YDR266C6394019681e-122
CAGL0M08668g6575579691e-122
Scas_615.126744159051e-112
CAGL0L03916g642100910.007
Scas_665.139249780.26
YOL054W40650740.78
Scas_720.8946965731.1
Kwal_47.1771963544711.9
Scas_553.3*102569693.0
KLLA0F01463g781108693.0
CAGL0C05599g103469693.3
AGL289C24148673.5
KLLA0C08756g42749674.5
AGR233W28481674.5
Scas_672.226348665.9
Scas_615.1333045665.9
Scas_705.4142874658.8
Scas_551.371240659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E16698g
         (646 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...  1130   0.0  
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            435   e-145
Kwal_55.20000                                                         422   e-140
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   408   e-134
Scas_699.38                                                           379   e-123
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   377   e-122
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   377   e-122
Scas_615.12                                                           353   e-112
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    40   0.007
Scas_665.1                                                             35   0.26 
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    33   0.78 
Scas_720.89                                                            33   1.1  
Kwal_47.17719                                                          32   1.9  
Scas_553.3*                                                            31   3.0  
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    31   3.0  
CAGL0C05599g complement(538455..541559) similar to sp|P35688 Sac...    31   3.3  
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    30   3.5  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    30   4.5  
AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH] complement(...    30   4.5  
Scas_672.2                                                             30   5.9  
Scas_615.13                                                            30   5.9  
Scas_705.41                                                            30   8.8  
Scas_551.3                                                             30   9.0  

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/640 (86%), Positives = 554/640 (86%)

Query: 1   MSSNQGISTASAPIRRAQGPSTSXXXXXXXXXXQNHHAXXXXXXXXXXXVHPDWNPVTGS 60
           MSSNQGISTASAPIRRAQGPSTS          QNHHA           VHPDWNPVTGS
Sbjct: 1   MSSNQGISTASAPIRRAQGPSTSNRGRKRGNGNQNHHATTSGSTGNSSSVHPDWNPVTGS 60

Query: 61  SNKWAGINGNEKSMXXXXXXXXXXXXXVCLICAEKLHIIALSPCNHPTCHKCCLRQRALY 120
           SNKWAGINGNEKSM             VCLICAEKLHIIALSPCNHPTCHKCCLRQRALY
Sbjct: 61  SNKWAGINGNEKSMGTGNGTDDDDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALY 120

Query: 121 EKKQCLFCRSEVEDIIFTDKIKETYEHLDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKY 180
           EKKQCLFCRSEVEDIIFTDKIKETYEHLDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKY
Sbjct: 121 EKKQCLFCRSEVEDIIFTDKIKETYEHLDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKY 180

Query: 181 VSPFGDANKDFGSFKKLNEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGD 240
           VSPFGDANKDFGSFKKLNEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGD
Sbjct: 181 VSPFGDANKDFGSFKKLNEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGD 240

Query: 241 PKDGFKGHPMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHF 300
           PKDGFKGHPMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHF
Sbjct: 241 PKDGFKGHPMCGFCSGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHF 300

Query: 301 KSAHYVCTVPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQIT 360
           KSAHYVCTVPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQIT
Sbjct: 301 KSAHYVCTVPSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQIT 360

Query: 361 TFSNPTRIIDAQNEESNSANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEIS 420
           TFSNPTRIIDAQNEESNSANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEIS
Sbjct: 361 TFSNPTRIIDAQNEESNSANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEIS 420

Query: 421 AQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPL 480
           AQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPL
Sbjct: 421 AQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPL 480

Query: 481 VADSSSSVNXXXXXXXXXXXXXXXXXXXXFTSLPAVSEPIFSSKASYTNLRKNGXXXXXX 540
           VADSSSSVN                    FTSLPAVSEPIFSSKASYTNLRKNG      
Sbjct: 481 VADSSSSVNVVYGKWGKKSSSGVGGSNVKFTSLPAVSEPIFSSKASYTNLRKNGSSSPSS 540

Query: 541 XVIRSGXXXXXXXXXXXXYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQATKKK 600
            VIRSG            YAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQATKKK
Sbjct: 541 PVIRSGLTSNSSSSTSLNYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQATKKK 600

Query: 601 FVAPPVKQTTIPNPSTWGKPQXXXXXXXXXXXXXALPASG 640
           FVAPPVKQTTIPNPSTWGKPQ             ALPASG
Sbjct: 601 FVAPPVKQTTIPNPSTWGKPQNDNDSINLDSLDNALPASG 640

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  435 bits (1119), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/559 (43%), Positives = 329/559 (58%), Gaps = 46/559 (8%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147
           +C+ICA     IALS C+H TCHKC  RQRALY KK CL CR+E E +IFTDK    +  
Sbjct: 66  ICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKFDHQFAD 125

Query: 148 LDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGD-ANKDFGSFKKLNEFLRQEHN 206
              +      +E+ GI FTS+ V    + LLKY  PFGD A+KDF SFKK NE L+  HN
Sbjct: 126 FTPR-DFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHLKTSHN 184

Query: 207 KTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDDELY 266
           KTICMICA +KKAFP ELK+ T  QL+ H+SRGD   GFKGHPMCGFC+G+RFYSDDELY
Sbjct: 185 KTICMICANNKKAFPSELKIFTPNQLRNHQSRGD-SHGFKGHPMCGFCTGQRFYSDDELY 243

Query: 267 KHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFSDELDL 326
            HM+  HERCHICDQ+D + PQYFKNY+ LFEHF+++HYVCTV +CL++KFVVF D++DL
Sbjct: 244 VHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRDDIDL 303

Query: 327 RAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTFS-NPTRIIDAQN------------ 373
           +AHI+KEH  +  + +  + +     ++F+S+++TFS  P R +  ++            
Sbjct: 304 QAHILKEHRTILANDKGNIPV---AGRRFQSELSTFSATPARAVHERDTFDTPALRSSSA 360

Query: 374 ----EESNSANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQELQSKYE 429
                 +NS +S +VKR RME+RARHYL  S+P+F++FL IN+ + KN +SA+++ + Y+
Sbjct: 361 ARSANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTAYQ 420

Query: 430 DLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPLVADSS---S 486
            LF   + D+ LLIYD S ++   S KHK L AIYE   KK  +   F  L   SS   +
Sbjct: 421 KLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFPSLAPPSSVAAA 480

Query: 487 SVNXXXXXXXXXXXXXXXXXXXXFTSLPAVSEPIFSS------KASYTNLRKNGXXXXXX 540
           +V                       + PA+S+P+ S       KAS+ +L  N       
Sbjct: 481 NVIGGSWGRSSSPSSASSSKSSGRYNFPALSKPVNSQPLFTPKKASFKSLNTN---VRTA 537

Query: 541 XVIRSGXXXXXXXXXXXXYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKL-QATKK 599
            V++                  N +P        +S    ++  S +   FP L +A KK
Sbjct: 538 PVVKKASANNGT----------NYTPTYLQNKSTSSGSLSSSSASISEEKFPPLPKAQKK 587

Query: 600 KFVAPPVKQTTIPNPSTWG 618
           KF AP V +  IPNP  WG
Sbjct: 588 KFRAPLVNEPNIPNPQQWG 606

>Kwal_55.20000
          Length = 617

 Score =  422 bits (1084), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/545 (43%), Positives = 319/545 (58%), Gaps = 31/545 (5%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147
           +C+ICAEKL  + LSPCNH TC++C  RQRALY KK CL CR+E + +IF+      ++ 
Sbjct: 52  ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDD 111

Query: 148 LDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGD-ANKDFGSFKKLNEFLRQEHN 206
            D+K  +E  N  LG+ FTS++V +  + LL Y  PFGD    +  +FKK N  L+ EHN
Sbjct: 112 FDEKNLVE-TNVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHLKNEHN 170

Query: 207 KTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDDELY 266
           KT+CMICA HKKAFP EL++ T  QL+IH+S+GD  +GFKGHPMCGFCSG+RFYSDDEL 
Sbjct: 171 KTLCMICASHKKAFPSELRIYTPSQLRIHQSKGD-SEGFKGHPMCGFCSGQRFYSDDELN 229

Query: 267 KHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFSDELDL 326
            HM+  HE+CHICDQ + + PQYFK+Y+ LFEHFK  HYVC V SCLD+KFVVF D+LDL
Sbjct: 230 VHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDL 289

Query: 327 RAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTFSNPTR-------IIDAQNEESNSA 379
           +AHI+KEH  +  +    +++     +K++SQ++TFS P         + D   + ++S 
Sbjct: 290 QAHILKEHGGILRNGNNNLSM--KGGRKYQSQLSTFSRPPSRSSSTQDVRDNTAKNNSSE 347

Query: 380 NSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQELQSKYEDLFKQHADDI 439
           NS +VKR RME+RARHYL  S  DF+ FL IN  +    I+AQ++ S YE LFK     +
Sbjct: 348 NSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPEAQV 407

Query: 440 QLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPLVADSSSSV--NXXXXXXXX 497
            LL+YD SEL+  +S  H+ LR IY+ + KK+     F  L A + + +  +        
Sbjct: 408 GLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGSWGR 467

Query: 498 XXXXXXXXXXXXFTSL--PAVSE-PIFSSKASYTNLRKNGXXXXXXXVIRSGXXXXXXXX 554
                       F SL  PA  + PI + K S T +           V R          
Sbjct: 468 STGSNKAARQYNFPSLKKPASPQPPIITKKPSSTKVNNVQPKAKAVPVTRKPSSNESSFK 527

Query: 555 XXXXYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQATKKKFVAPPVKQTTIPNP 614
                 K+  +         +S P +   K P     PK QA  +KF AP V + +IPNP
Sbjct: 528 PTYLDGKQKSA---------SSSPALDREKFP---PLPKSQA--RKFRAPLVNEASIPNP 573

Query: 615 STWGK 619
           S WGK
Sbjct: 574 SQWGK 578

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  408 bits (1048), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 223/548 (40%), Positives = 314/548 (57%), Gaps = 39/548 (7%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147
            CLICA+ L  +ALSPCNH TCHKC  RQRALYEKK CL CR+E E +IFTD+IK  +  
Sbjct: 66  TCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEHAR 125

Query: 148 LDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANK-DFGSFKKLNEFLRQEHN 206
              +  +   +++ GI+FTS N  +  ++LLKY  P+GD  + D  SFK  NE L+ EH 
Sbjct: 126 FGPRDIVAV-DDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLKNEHK 184

Query: 207 KTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDDELY 266
           ++IC ICA H+K FP E+K +T  QLKIH + GD K GF GHP+CGFCSGKRFYSDDELY
Sbjct: 185 RSICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSK-GFTGHPLCGFCSGKRFYSDDELY 243

Query: 267 KHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFSDELDL 326
            HM+  HE+CHICDQ+D +QPQYFK+Y+ LFEHFK +HY+C V SCLD+KFVVF+D+LDL
Sbjct: 244 IHMRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDLDL 303

Query: 327 RAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTFSNPTRIIDAQNEESNS-------- 378
           +AH++KEHP++ G+     T+     +++RS++++   P  +  A +E S+S        
Sbjct: 304 QAHMLKEHPNIMGNKS---TISLTAGRRYRSELSSGFTPN-VSRAVHETSSSNALALGPS 359

Query: 379 ------ANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQELQSKYEDLF 432
                 A S ++KR+R+E+RARHYL  S+ + + F  IN+ +N N ISA  +Q +Y+ LF
Sbjct: 360 VSPVATAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLF 419

Query: 433 KQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPLVADSSSSVNXXX 492
           +    D  LL+ + ++ +   S K+K L AIY+   +K+E   KF  L  +   S     
Sbjct: 420 RNPEADTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLSTNPWYSAPVVG 479

Query: 493 XXXXXXXXXXXXXXXXXFTSLPAVSEPIFSSKASYTNLRKNGXXXXXXXVIRSGXXXXXX 552
                              + P++S  +  S  + T   K          + S       
Sbjct: 480 AAWGKNGGKSSSSR-----NFPSLSSALTDSYQNVTPQPKKPVPYRPTSPVASSSTQVQN 534

Query: 553 XXXXXXYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQA-TKKKFVAPPVKQTTI 611
                 Y          +   + S+    +    N   FP L +   KKF APPV +  +
Sbjct: 535 TKRNSNY----------TPTYLKSKTKGESRAQSNAALFPPLSSPDTKKFRAPPVNE--L 582

Query: 612 PNPSTWGK 619
           P+P  WGK
Sbjct: 583 PDPKQWGK 590

>Scas_699.38
          Length = 612

 Score =  379 bits (974), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/566 (38%), Positives = 311/566 (54%), Gaps = 75/566 (13%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVED--IIFTDKIK-ET 144
           VC+ICA  +   A SPCNH TCHKC  RQ AL++KK CL CR++ ++  +IFT+K+  + 
Sbjct: 43  VCVICANPIKFAAWSPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQA 102

Query: 145 YEHLDKKA-KLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDAN--------KDFGSFK 195
           YE  +    + +  N K GI+FTS +V  + +NL K++                D+ SFK
Sbjct: 103 YEDFNSNMWQTDLINTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFK 162

Query: 196 KLNEFLRQEHN-KTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFC 254
           KLNE L+ EHN KTICMICA H  +FP ELK+ T  QLK H ++G   DGFKGHPMC FC
Sbjct: 163 KLNEHLKLEHNNKTICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFC 222

Query: 255 SGKRFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLD 314
           S KRFYS DEL  HM+  HERCHICD++D + PQ+FKNY+ LF HFK++HY+CT  +CLD
Sbjct: 223 SNKRFYSQDELMSHMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLD 282

Query: 315 AKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTRIIDAQN 373
            KF+VF D+++L+AHI++EH    GD      LI    K F+S+++TF S P+R+I   N
Sbjct: 283 DKFIVFKDDMELQAHILQEH----GD------LIRGKPKFFQSELSTFISTPSRVITDDN 332

Query: 374 ----------------EESNSAN----SRDVKRRRMEQRARHYLGNSEPDFQSFLIINDL 413
                              NS N    S++VK+ R+++RA+HYL NS  DFQ+F+ +N  
Sbjct: 333 AFTSQHSFSDSSLPSLNSVNSTNANNSSQEVKQLRLDERAKHYLDNSHEDFQTFINLNKQ 392

Query: 414 FNKNEISAQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKEN 473
           +  N+++A +L + Y++LF+    D+ LLI++LSELY   S K+K L +IY    KK   
Sbjct: 393 YAANKLTAAQLLNSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEKKLSK 452

Query: 474 AGKFKPLVADSSSSVNXXXXXXXXXXXXXXXXXXXXFTSLPAVSEPIFSSKASYTNLRKN 533
             +   L  D SSS +                     T+ P ++ P  +S  S  N    
Sbjct: 453 KPQLPSLYNDPSSSSSMVNAVWGNSNNNRNVSSLRTNTNRP-LNLPSLTSTPSNLN---- 507

Query: 534 GXXXXXXXVIRSGXXXXXXXXXXXXYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPK 593
                       G               K+++   SS   +              ++ P 
Sbjct: 508 ------------GTRPLHVSHSTSSLTSKSRNDNASSNSRI--------------SNLPS 541

Query: 594 LQATKKKFVAPPVKQTTIPNPSTWGK 619
           L   K K   PPV+QT IP+P++WG+
Sbjct: 542 LPTPKPKVYIPPVRQTVIPDPNSWGR 567

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  377 bits (968), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 265/401 (66%), Gaps = 39/401 (9%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147
           +C+ICA KL  ++L+PC+H TCH C  RQRALY KK CL CR+E E+++FTD+I      
Sbjct: 63  LCVICARKLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDG---- 118

Query: 148 LDKKAKLEF--KNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANK--DFGSFKKLNEFLRQ 203
            D   K  F  KNEK GI FTS+ V  + +NLLK+  P     +  DFGSFKK NE L+ 
Sbjct: 119 -DISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKS 177

Query: 204 EHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDD 263
           EHN+ IC+ICA HK AFP EL++ T  QL+ H+++G+  +GFKGHPMC FCSGKRFYSDD
Sbjct: 178 EHNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGN-SEGFKGHPMCAFCSGKRFYSDD 236

Query: 264 ELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFSDE 323
           ELY HM+  HE+CHICD+++P+ PQYFK+Y  LF+HFK +HYVCTV +CLD KFVVF DE
Sbjct: 237 ELYIHMRNQHEKCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDE 296

Query: 324 LDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTRIIDAQNE-------- 374
           L+L+AHI++EH +          ++    K F+S+++TF S P+R+I  +++        
Sbjct: 297 LELQAHILQEHGN----------ILKGKPKFFQSELSTFISAPSRVIRERDDYDLPSISS 346

Query: 375 ----------ESNSANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQEL 424
                     +  SA+S +  R R+ +RA++YL NS+ DF  F   N+ ++K  +SA++L
Sbjct: 347 LPGSSSGSRTDVRSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKL 406

Query: 425 QSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYE 465
              Y+ LF +   D+ LLI++L+E +   S K+  L AIYE
Sbjct: 407 LESYKLLFTKPNADVYLLIHNLAETFPKNSSKYNNLNAIYE 447

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  377 bits (969), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/557 (39%), Positives = 303/557 (54%), Gaps = 41/557 (7%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147
           +C+ICA  L   +LSPCNH TCH C  RQRALYEKK CL CR+E + + FTD I   Y  
Sbjct: 76  LCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFTDNIDAQYSE 135

Query: 148 LDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANKDFGS--FKKLNEFLRQEH 205
           +         ++K GI FTS  V N  ++LLKY  P    N+   S  +KK NE L+  H
Sbjct: 136 I---TDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYNEHLKSAH 192

Query: 206 NKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDDEL 265
           N+ IC+ICAG+K +FP E+K+ T  QLK H SRGD  +GFKGHPMC FC+GKRFYSDDEL
Sbjct: 193 NRMICLICAGNKHSFPREMKIYTANQLKNHHSRGD-SEGFKGHPMCAFCTGKRFYSDDEL 251

Query: 266 YKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFSDELD 325
           Y HM+  HE+CHICD++D +QPQYFK+YE LFEHF+++HYVCTV SCLD KFVVF D+++
Sbjct: 252 YIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVVFKDDME 311

Query: 326 LRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTRII---DAQNEESNSANS 381
           L+AHI+KEH    GD      ++    K F+S+++TF S P+++I   D+ N +  S  S
Sbjct: 312 LQAHILKEH----GD------ILRGKPKFFQSELSTFISAPSQVIRERDSYNYDMGSVGS 361

Query: 382 R--------DVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQELQSKYEDLFK 433
                    +V R RM +RA+HYL +S   FQ F  +N+ ++ + ++A +L  +Y+ LF 
Sbjct: 362 SNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYKKLFT 421

Query: 434 QHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPLVADSSSSVNXXXX 493
               DI LL+++LS LY   S K K L  IY+   + ++       L+ D   +V     
Sbjct: 422 DTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTV-PGGA 480

Query: 494 XXXXXXXXXXXXXXXXFTSLPAVSEPIFSSKASYTNLRK----NGXXXXXXXVIRSGXXX 549
                              LP++   + SS   + N  K     G       V+ +    
Sbjct: 481 WGSSTGRSKSHSSIKNLNQLPSLGG-VSSSFDPFKNPNKAPVYKGLRQSPKPVVSATQRQ 539

Query: 550 XXXXXXXXXYAKKNQSPPGSSTVVV-----NSQPNVTAIKSPN--PTSFPKLQATKKKFV 602
                     A       G ST         SQP+  +         + P L A K K  
Sbjct: 540 TPMRISARPTASNRVEFNGGSTTKAATPSWGSQPSSNSSSKNKLADLNLPTLPAPKPKVY 599

Query: 603 APPVKQTTIPNPSTWGK 619
            PPV +  IP+P  WG+
Sbjct: 600 IPPVHEPVIPDPKKWGQ 616

>Scas_615.12
          Length = 674

 Score =  353 bits (905), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/415 (45%), Positives = 257/415 (61%), Gaps = 49/415 (11%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIKETYEH 147
           +CLICA KL   +LSPCNH TCHKC  +QR+LY KK CL CR+E + +IFT+ I   Y  
Sbjct: 71  LCLICASKLVYASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTD 130

Query: 148 LDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGDANKD------FGSFKKLNEFL 201
                  +F NEK GI FTS+ V    +NLLKY      ANKD      FGS+KK NE L
Sbjct: 131 -SNLGHYQF-NEKYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHL 188

Query: 202 RQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYS 261
           R +HNK +C ICA +   FP EL V T  QL+ H+S+G+  +GFKGHP+C FCSG+RFY 
Sbjct: 189 RSKHNKCLCTICAQNNHIFPSELPVYTQNQLRNHQSKGN-SEGFKGHPLCAFCSGQRFYG 247

Query: 262 DDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKFVVFS 321
           DDELY HM+  HE+CHICD++D + PQYFK+Y+ LF+HFK+ HY+CTV +CLD KF+VF 
Sbjct: 248 DDELYVHMRNKHEKCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFK 307

Query: 322 DELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTF-SNPTRII---DAQNEESN 377
           DEL+L+AHI+KEH    GD      LI    K F+S+++TF S P+R++   DA N + +
Sbjct: 308 DELELQAHILKEH----GD------LIRGKPKLFQSELSTFMSGPSRVVRDRDAMNYDMD 357

Query: 378 SANSR--------------------------DVKRRRMEQRARHYLGNSEPDFQSFLIIN 411
           S  S                           ++++ R+E+RA++YL NS+  +  F+  N
Sbjct: 358 SRPSLFSSSPSSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCN 417

Query: 412 DLFNKNEISAQELQSKYEDLFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEG 466
           D ++K  ++   L   Y+++F     ++ LLI ++++LY   S K K L AIYE 
Sbjct: 418 DEYDKGYLTGLGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEA 472

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 590 SFPKLQATKKKFVAPPVKQTTIPNPSTWG 618
           + P+L   K K   PP+++TTIP+P  WG
Sbjct: 599 NLPQLPTPKPKVYIPPLRKTTIPDPKQWG 627

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 6/100 (6%)

Query: 251 CGFCSGKRFYSDDELYKHMKL-SHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTV 309
           C FC GKRF     L  H +L + ER   CD+ D +  +        F H     Y+C +
Sbjct: 510 CEFC-GKRFTQAGNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRL 568

Query: 310 PSCLDAKFVVFSDELDLRAHIIKEHPHLAGDSRRAMTLID 349
            +C    F  FS   ++++H  K HP    +  + + L+D
Sbjct: 569 DNC----FKRFSQLGNMKSHQNKYHPQTIKELTQKLALLD 604

>Scas_665.1
          Length = 392

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQ--CLFCRSEVED 134
           +C IC+E + +  ++ C H  C+ C     +   KK+  C  CRS++ D
Sbjct: 29  ICTICSEYMFVPMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD 77

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 88  VCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQ--CLFCRSEVEDI 135
           VC IC + + +  ++PC H  C+ C     A   +K+  C  CRS++  I
Sbjct: 29  VCSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDITTI 78

>Scas_720.89
          Length = 469

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDII-----FTDKIKE 143
           C IC + L +  L+PC+H  C   C+R+  L +  +C  C +E+ + +       ++I +
Sbjct: 28  CHICKDFLKVPVLTPCSHTFCS-LCIRE-YLKDNSKCPLCLNELRESMLRSEFLVNEIVQ 85

Query: 144 TYEHL 148
           +Y+ L
Sbjct: 86  SYQSL 90

>Kwal_47.17719
          Length = 635

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEV 132
           C++C   +  I L PC      + C    AL   K C+ CRSEV
Sbjct: 583 CVVCKSNIRNIVLWPCKCFAVCEDCRVSLALRGFKTCICCRSEV 626

>Scas_553.3*
          Length = 1025

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 266 YKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTV--PSCLDAKFVVFSDE 323
           Y + K +   CH+CD+  P +  Y+  + + ++     H+ CT+    C   K  +F D+
Sbjct: 89  YDYFKRNDLLCHVCDK--PLRGLYYTAFGNRYDE---EHFACTICKEPCGVKKCFMFEDQ 143

Query: 324 LDLRAHIIK 332
           L  + H +K
Sbjct: 144 LYCKYHFLK 152

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 21/108 (19%)

Query: 181 VSPFGDANKDFGSFKKLNEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQ-----LKIH 235
           +  +   NK+F S K LNE +   H   +    + +K  + G  KV   KQ     LK+H
Sbjct: 630 ICKWAGCNKEFDSAKSLNEHIENFH---VPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVH 686

Query: 236 ESRGDPKDGFKGHPMCGFCSGKRFYSDDELYKHMKL-SHER---CHIC 279
            S+  P   F+    C  C GK F + D L +H+++ S ER   CH+C
Sbjct: 687 -SKYKP---FR----CAEC-GKCFNTQDILTQHLRVHSGERPFKCHLC 725

>CAGL0C05599g complement(538455..541559) similar to sp|P35688
           Saccharomyces cerevisiae YDL240w LRG1 GTPase-activating
           protein of the rho/rac family, hypothetical start
          Length = 1034

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 7/69 (10%)

Query: 266 YKHMKLSHERCHICDQLDPSQPQYFKNYEDLF--EHFKSAHYVCTVPSCLDAKFVVFSDE 323
           Y + K +   CH+CD+  P +  YF  + + +  EHF     +C  P C   K  +  D+
Sbjct: 93  YDYFKRNGLLCHVCDE--PLRGLYFTAFGNRYDEEHFSCT--ICKTP-CGVKKCFIHDDQ 147

Query: 324 LDLRAHIIK 332
           L  R H +K
Sbjct: 148 LYCRFHFMK 156

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 4/48 (8%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQ----RALYEKKQCLFCRSEV 132
           C IC +      ++PC H  C  C  +     R      QC  CR +V
Sbjct: 173 CPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRKDV 220

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIF 137
           C IC + L    L+PC H  C  C   ++ L ++ +C  C S++ + + 
Sbjct: 32  CHICKDFLKASVLTPCGHSFCSICI--RKYLQKESKCPLCLSDLTESML 78

>AGR233W [4544] [Homologous to ScYGL221C (NIF3) - SH]
           complement(1185515..1186369) [855 bp, 284 aa]
          Length = 284

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 212 ICAGH-----KKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGKRFYSDDELY 266
           +CAG      K   PG++ +    +L  HE     + G K   +C   + +R Y  D +Y
Sbjct: 203 LCAGSGSGVFKGVSPGDVDLYYTGELSHHEILRYREAG-KAVIVCNHSNTERGYLRDVMY 261

Query: 267 KHMKLSHERCHI-CDQLDPSQ 286
           KH++     CH+    +DP Q
Sbjct: 262 KHIQELGVECHVSAADVDPLQ 282

>Scas_672.2
          Length = 263

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 4/48 (8%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQ----RALYEKKQCLFCRSEV 132
           C IC +      ++PC H  C  C  +     R   +   C  CR EV
Sbjct: 197 CPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEV 244

>Scas_615.13
          Length = 330

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVE 133
           C++C   +   + SPC H  C +C L      E+ +C  CR E +
Sbjct: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK--ERPECPLCRQECQ 322

>Scas_705.41
          Length = 428

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 5/74 (6%)

Query: 88  VCLICAEKLH---IIA--LSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFTDKIK 142
           +C IC + L+   I+   L PCNH   + C  R     +   C  CR + + +I   +  
Sbjct: 11  ICPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCRCQPKTMIVLSRNH 70

Query: 143 ETYEHLDKKAKLEF 156
              E +D     E 
Sbjct: 71  NGVETIDHTINFEI 84

>Scas_551.3
          Length = 712

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 89  CLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFC 128
           C +C++    +A+  C H  C +CC ++R     ++C  C
Sbjct: 660 CSLCSKNWKNMAIKTCGHVFCEECC-KERLAARMRKCPTC 698

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,548,384
Number of extensions: 837647
Number of successful extensions: 2988
Number of sequences better than 10.0: 57
Number of HSP's gapped: 3088
Number of HSP's successfully gapped: 67
Length of query: 646
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 538
Effective length of database: 12,857,365
Effective search space: 6917262370
Effective search space used: 6917262370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)