Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14894g66965934540.0
Sklu_1742.468566712431e-163
ADL286W67267110621e-136
Kwal_23.346067267210611e-135
Scas_669.156726878401e-103
YGL145W (TIP20)7017057406e-88
CAGL0E04972g6716766974e-82
YGR130C816142693.3
Kwal_56.2294964283684.3
KLLA0E18150g681118684.8
ACR263C224066685.2
Sklu_2297.735092665.9
AAL109W91489676.5
KLLA0C02321g1842128667.2
KLLA0B02717g204783668.3
CAGL0G02497g178038659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14894g
         (659 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14894g complement(1328372..1330381) similar to sp|P33891 S...  1335   0.0  
Sklu_1742.4 YGL145W, Contig c1742 3577-5634                           483   e-163
ADL286W [1455] [Homologous to ScYGL145W (TIP20) - SH] complement...   413   e-136
Kwal_23.3460                                                          413   e-135
Scas_669.15                                                           328   e-103
YGL145W (TIP20) [1842] chr7 (230246..232351) Cytoplasmic protein...   289   6e-88
CAGL0E04972g complement(480678..482693) similar to sp|P33891 Sac...   273   4e-82
YGR130C (YGR130C) [2087] chr7 complement(751397..753847) Protein...    31   3.3  
Kwal_56.22949                                                          31   4.3  
KLLA0E18150g complement(1609333..1611378) similar to sp|P34243 S...    31   4.8  
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    31   5.2  
Sklu_2297.7 YLR097C, Contig c2297 11729-12781                          30   5.9  
AAL109W [78] [Homologous to ScYPL174C (NIP100) - SH] complement(...    30   6.5  
KLLA0C02321g complement(196533..202061) similar to sp|P41832 Sac...    30   7.2  
KLLA0B02717g 240125..246268 highly similar to sp|P07149 Saccharo...    30   8.3  
CAGL0G02497g 223375..228717 similar to sp|Q02455 Saccharomyces c...    30   9.3  

>KLLA0E14894g complement(1328372..1330381) similar to sp|P33891
           Saccharomyces cerevisiae YGL145w TIP20 required for ER
           to Golgi transport singleton, start by similarity
          Length = 669

 Score = 1335 bits (3454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/659 (100%), Positives = 659/659 (100%)

Query: 1   MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSI 60
           MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSI
Sbjct: 1   MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSI 60

Query: 61  SNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQSVDLEHLST 120
           SNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQSVDLEHLST
Sbjct: 61  SNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQSVDLEHLST 120

Query: 121 LKQRIVSLGIESMEVITRFNSLLEAIAKELMEKFKQDLLNSKWDTDYFVSSKKIIHDIRQ 180
           LKQRIVSLGIESMEVITRFNSLLEAIAKELMEKFKQDLLNSKWDTDYFVSSKKIIHDIRQ
Sbjct: 121 LKQRIVSLGIESMEVITRFNSLLEAIAKELMEKFKQDLLNSKWDTDYFVSSKKIIHDIRQ 180

Query: 181 QSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFEDSGQQKQSIEL 240
           QSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFEDSGQQKQSIEL
Sbjct: 181 QSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFEDSGQQKQSIEL 240

Query: 241 YFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQTLLNISENQT 300
           YFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQTLLNISENQT
Sbjct: 241 YFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQTLLNISENQT 300

Query: 301 NENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELDSTLDQYEKIV 360
           NENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELDSTLDQYEKIV
Sbjct: 301 NENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELDSTLDQYEKIV 360

Query: 361 SSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVSRYNKFIISPD 420
           SSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVSRYNKFIISPD
Sbjct: 361 SSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVSRYNKFIISPD 420

Query: 421 PALSLLPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLSNSTYPSIFTES 480
           PALSLLPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLSNSTYPSIFTES
Sbjct: 421 PALSLLPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLSNSTYPSIFTES 480

Query: 481 FSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTELIGAIQKSSKL 540
           FSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTELIGAIQKSSKL
Sbjct: 481 FSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTELIGAIQKSSKL 540

Query: 541 KAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVMLDYGELKTVLQL 600
           KAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVMLDYGELKTVLQL
Sbjct: 541 KAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVMLDYGELKTVLQL 600

Query: 601 DDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEVRDALGLKYISNS 659
           DDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEVRDALGLKYISNS
Sbjct: 601 DDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEVRDALGLKYISNS 659

>Sklu_1742.4 YGL145W, Contig c1742 3577-5634
          Length = 685

 Score =  483 bits (1243), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 268/667 (40%), Positives = 420/667 (62%), Gaps = 24/667 (3%)

Query: 2   LQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSIS 61
            +S+ DL+N+D  I +V+++R+ LA +L+  K+EE+DF+    L++  L   + EIS + 
Sbjct: 16  FRSVDDLLNVDRLIGQVNNQRERLALQLRTKKNEEEDFLEHFVLMDVTLVTISEEISKVK 75

Query: 62  NIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQSVDLEHLST- 120
           ++  I+ LR K+G LQ+LD+I  L + KE    E   ++E++++  E L  VD +H  T 
Sbjct: 76  SVEDIKKLREKHGNLQILDRIAALLQLKEKKLSEKHDLDELQQICRE-LDEVD-DHQDTE 133

Query: 121 ----LKQRIVSLGIESME----VITRFNSLLEAIAKELMEKFKQDLLNSKWDTDYFVSSK 172
                + RI SL  +       V  +FN LLE   K L   F+ +LL+SKWDT++F+ ++
Sbjct: 134 MYEKFQTRITSLACDDTSALGIVYAKFNKLLEDQGKTLSAAFEHNLLHSKWDTNHFLFAE 193

Query: 173 KIIHDIRQQSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFEDSG 232
           K I ++RQQS+ L+ L  L L   + ++     WNF  I++NF IKF+YHF++     S 
Sbjct: 194 KSIKELRQQSTKLYRLNMLLLPQPNLND----LWNFHSIANNFKIKFIYHFNSK----SQ 245

Query: 233 QQKQSIELYFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQTL 292
            + QS+E+YF+FLD+YLE  LFRCI+IF DE +G+T+E +H QFINH L+PIR+KI  +L
Sbjct: 246 NELQSVEMYFEFLDKYLEQNLFRCIEIFYDEHAGVTQELIHRQFINHILDPIRHKINSSL 305

Query: 293 LNISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELDST 352
           + ISE  + ENL+ M+VLISQIFINDNAL+KKHYY G+GL SL+P  VLE WL FE DST
Sbjct: 306 IKISETPSQENLKMMMVLISQIFINDNALVKKHYYDGVGLASLIPDTVLETWLNFETDST 365

Query: 353 LDQYEKIVSSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVSRY 412
             QY+K+ S++L  NG D   LL+++Y YFEP +NI+Y    +YK++I ++IF+EL   Y
Sbjct: 366 KRQYDKLTSASLKKNGTDFRTLLQNLYSYFEPFYNIEYERFLNYKIKITNQIFMELPDSY 425

Query: 413 NKFIISPDPALSLL--PEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLSN 470
            +++++ +     +   EE +LE    KL N++ + + +     K  FI+LT   N L++
Sbjct: 426 RRYVLNFNEERGSVSKSEEAKLEENLWKLQNLITINKTLMVFENKVNFIDLTSKLNHLTD 485

Query: 471 STYPSIFTESFSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTEL 530
           S+Y ++F E     E+ + T R+SI+HR K+ L + L  YF+L+ W  +++ P QCS+EL
Sbjct: 486 SSYRTLFQEVQQRYEQAITTARDSIVHRIKRKLSSLLRVYFKLNNWSSVTSSPEQCSSEL 545

Query: 531 IGAIQKSSKLKAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVMLD 590
           +GAI   +K+ A   L +L  ++   I   +L   I ++ DYVVK+N FSE GLKQ+++D
Sbjct: 546 VGAINAMNKIVASIQLHELSGDVVYYIKIEVLNVIIHFILDYVVKLNKFSEMGLKQLIMD 605

Query: 591 YGELKTVLQLDDV--PQCVQEEEFEEFMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEVR 648
           Y  LK  L+L+ V  P   +E    E +++L LKY    +   F+++ Y+ +  D+ + +
Sbjct: 606 YESLKGTLKLEMVGFPTNAEEGALLETVEILKLKYQHDKRHENFINRAYIDRG-DFRDFK 664

Query: 649 DALGLKY 655
             + ++Y
Sbjct: 665 KLMKIRY 671

>ADL286W [1455] [Homologous to ScYGL145W (TIP20) - SH]
           complement(199673..201691) [2019 bp, 672 aa]
          Length = 672

 Score =  413 bits (1062), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 238/671 (35%), Positives = 393/671 (58%), Gaps = 24/671 (3%)

Query: 2   LQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSIS 61
           + S++DL+ +   I  +  +RD++A +++ +   E + ++  + +  +L     EIS   
Sbjct: 1   MNSVEDLLQLQPKIDALEKERDDIARKVQAVARTEGEQVDDFEALNSKLAGIAEEISGAR 60

Query: 62  NIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETE-------VIEEIEKVSTEQLQSVD 114
            +  ++ LR  YG L +LD+ E L R++E      +       V E++ + +  +L   D
Sbjct: 61  TLEDVQRLRDNYGELAILDRAETLLREREAGERRAQNACTLAAVTEKLGRAA--ELDYCD 118

Query: 115 LEHLSTLKQRIVSLGIESMEVITRFNSLLEAIAKELMEKFKQDLLNSKWDTDYFVSSKKI 174
           LE L   +   ++   ++   + +FN LL   A+      + +LL  + DT+ FVS+   
Sbjct: 119 LEALHA-ELEPLARSADAAPQVEQFNELLTERARVPRRDLEHELLERRCDTELFVSTDDS 177

Query: 175 IHDIRQQSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFEDSGQQ 234
           +H++R+++  LF L  L L +   D    Q WNF  +++NF IKF+YHF++P  E    +
Sbjct: 178 VHELREKAGLLFQLSQLLLPEPRAD----QLWNFVCMANNFRIKFIYHFTSPSAE---SE 230

Query: 235 KQSIELYFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQTLLN 294
           +QSIE YFKFLD+YL   L++ +DIF DE  G+T+  +H+QFINH L P+R K+  T+  
Sbjct: 231 QQSIENYFKFLDKYLSENLYKYMDIFEDESKGITRTLIHKQFINHILEPVREKVNVTMTK 290

Query: 295 ISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELDSTLD 354
           I+ + +  +++ +++LIS+IFI DNAL K HYY G+GLVSL+    LE W  FE++S + 
Sbjct: 291 IAASNSASDVKMLVLLISEIFITDNALKKSHYYDGVGLVSLIDEAALEVWQNFEVESAVS 350

Query: 355 QYEKIVS--SALLT--NGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVS 410
           Q+EK+ +  ++L++  NGAD  KLLE+MY+Y EP F+IDY +L S K Q+V  IF++L  
Sbjct: 351 QFEKLTTPGASLMSPKNGADFGKLLENMYRYLEPFFSIDYRNLFSVKYQLVDEIFIQLPL 410

Query: 411 RYNKFIISPDPALSLLPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLSN 470
           +Y  F++S +   + L  E+Q E T +KLH+++L+   +        FIE+T   NK+++
Sbjct: 411 KYRSFLLSKNILQNELTAEQQFENTCVKLHSLLLISNILVRFSHDFTFIEMTQQINKITD 470

Query: 471 STYPSIFTESFSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTEL 530
           S Y  IF E + + +E V+ +R+SI+HRW K L +SL  YF+ ++W  I+  P QCS EL
Sbjct: 471 SDYEYIFDEVWESYDEAVIVLRDSIVHRWVKGLSSSLRNYFKYNEWDSIATAPEQCSAEL 530

Query: 531 IGAIQKSSKLKAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVMLD 590
           +GA+    K+   F     P +I   I   LL   I ++ +YVVK+N FSENGL+Q+  D
Sbjct: 531 VGALAWMKKMTDIFDKYWYPQHIIAQIKVALLENIIKFMLNYVVKLNKFSENGLRQLTFD 590

Query: 591 YGELKTVLQLDDVPQCVQEE-EFEEFMKVLSLKYNGKSQVLPFLSKGYMS--QSQDYLEV 647
           Y  L+  L L      V EE    E+  +LS+KY        FL   Y+S   ++++ E+
Sbjct: 591 YEALRATLGLPLEHSSVAEELALFEYFNILSMKYTNNKITSKFLDAEYVSSHHTRNFREL 650

Query: 648 RDALGLKYISN 658
           R++L + ++++
Sbjct: 651 RESLQVSHLTS 661

>Kwal_23.3460
          Length = 672

 Score =  413 bits (1061), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 243/672 (36%), Positives = 397/672 (59%), Gaps = 23/672 (3%)

Query: 1   MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSI 60
           ML SI+DL  I   + ++  +R+ LAE L+    E +    Q+D    ++  A  EI   
Sbjct: 1   MLASIEDLKKIPDLMSDLERQREALAETLRSKTGEVNQSKVQVDDRSVQITKAADEILQA 60

Query: 61  SNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQS-------V 113
            +   ++ L+ +YG L +L+ + +LF +KE    E + ++ +  +    ++        +
Sbjct: 61  RSTLDVDDLKKEYGALDILNDLSSLFSKKEANEAEEKALQRVSTIHASMMEQKEANVAQL 120

Query: 114 DLEHLSTLKQRIVSLGIESM--EVITRFNSLLEAIAKELMEKFKQDLLNSKWD-TDYFVS 170
           +L H   +K  +  L  + +   +  RF  LL   A  L++  ++ LL S WD T + V 
Sbjct: 121 ELWH-EEIKSAVAPLKSDRIVENLYGRFMVLLRQEADILIQALEKKLLESTWDGTSFDVG 179

Query: 171 SKKIIHDIRQQSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFED 230
           + + + D+R  S  L++L TL L   +D+N     WNFQ I++NF IKF+YHF+    + 
Sbjct: 180 NGEAVLDLRNLSQRLYHLWTLQLP-KADEN---HIWNFQCIANNFKIKFVYHFN----QQ 231

Query: 231 SGQQKQSIELYFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFINHTLNPIRNKITQ 290
           + QQ QS+E+YFKFLD+YL+   F+C++IF D  +GL +  VH+QF+NH L PIR K++ 
Sbjct: 232 AMQQLQSVEMYFKFLDKYLDQNSFKCVEIFSDASAGLPQTMVHQQFVNHVLTPIREKVSS 291

Query: 291 TLLNISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAWLEFELD 350
           TL  IS + +++ L+T+IVL+SQIFI DNAL+KKH Y G GL+ ++P  +L+ W  FE++
Sbjct: 292 TLTKISNDTSSQALKTLIVLLSQIFIMDNALLKKHLYYGDGLIVMVPKSILDTWQNFEIE 351

Query: 351 STLDQYEKIVSSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVS 410
           +++ Q++K+ S++L  +G D  KLL ++Y YFEP F I    L  YK++I +RIF++L +
Sbjct: 352 TSVSQFQKLTSTSLEKSGNDFAKLLRNLYTYFEPFFQIQNERLMDYKIKITNRIFMDLPN 411

Query: 411 RYNKFIISPDPALSL-LPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLS 469
           RY + +++      +   +E+Q E T  KLHN+  ++  + E   K  FI+LT   N  +
Sbjct: 412 RYREALLTIKGGKGVSYTDEEQFEKTLWKLHNLENIQSLLKEFETKLTFIQLTNYVNTAT 471

Query: 470 NSTYPSIFTESFSALEETVVTVRESIIHRWKKILKASLSPYFRLSKWQEISNPPAQCSTE 529
           +S+Y +I ++     +E ++ VR+SIIHR+KK+L  +L  YF+L++W  IS+ P QCS E
Sbjct: 472 SSSYDTILSDILERYDEALIAVRDSIIHRFKKMLSTALRNYFKLNEWASISSSPQQCSAE 531

Query: 530 LIGAIQKSSKLKAEFALLKLPTNISISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVML 589
           L+  ++ SS+L A      L  ++S+ I + +L   I +L DYVV +N FSE GL+Q+ L
Sbjct: 532 LVIPLKVSSRLIAMVDKFDLKPHVSLYIRNEVLNIIIHFLFDYVVNLNKFSEAGLQQLRL 591

Query: 590 DYGELKTVLQL--DDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEV 647
           D+  LK  L       PQ  +E  F E + VL L+++       FLS  Y+ + +D+  V
Sbjct: 592 DFDALKNSLNFPYSHTPQNAEEGAFLETISVLQLRHSHIDSSQRFLSGSYI-KGKDFSAV 650

Query: 648 RDALGLKYISNS 659
           RD L L+Y ++S
Sbjct: 651 RDFLKLRYSTDS 662

>Scas_669.15
          Length = 672

 Score =  328 bits (840), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 225/687 (32%), Positives = 381/687 (55%), Gaps = 58/687 (8%)

Query: 1   MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDD-----ATA 55
           ML  I DL+ IDS I+++  +R +LA  L+  +       N + LI+ +L D     A  
Sbjct: 1   MLNDINDLLAIDSKIEDIKDQRTQLATLLQNAQQ------NNISLIKPQLRDRSENIAAD 54

Query: 56  EISSISNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIE----EIEKVSTEQLQ 111
            IS   +++ ++ L+ +YG L VLD++E L+ ++E   +    +E    EI+K+    + 
Sbjct: 55  IISRAHSLSGVQELKKQYGSLDVLDELEQLYEKQETLNNAKIDLEHLKTEIKKLGNLDIL 114

Query: 112 SVDLEHLSTLKQRIVSLGIESME-----------VITRFN-SLLEAIAKELMEKFKQDLL 159
            +  E +  L  +I +  IE +E           V + FN +++   A  +   FKQ LL
Sbjct: 115 ELSWETVLELHDKIKA-TIELVEKDPTEKLSIDQVTSNFNDNVITRWANSISNDFKQLLL 173

Query: 160 NSKWDTDYFVSSK-KIIHDIRQQSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNFLIK 218
            SKWD +   + +  +I  +R+ SS L+ +  L+L+ ++D N     WNFQ I++NF I+
Sbjct: 174 ESKWDANQCTTPEHDLIDKLRETSSLLYKISLLYLN-TADSN----LWNFQCIANNFKIR 228

Query: 219 FMYHFSNPKFEDSGQQKQSIELYFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQFIN 278
           F+YHF         +    IE+YFKFL+ YL   L++CI+IF DE +G+T++ +HE+FIN
Sbjct: 229 FLYHFH--------ESSAMIEIYFKFLNDYLTENLYKCINIFHDEANGITEQKIHEEFIN 280

Query: 279 HTLNPIRNKITQTLLNISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPT 338
           + L PIR+K+  TL   S+N    +L+T+I+LISQI   D  L    +YTG GLVSLLP 
Sbjct: 281 YVLQPIRDKVQSTL---SQN----DLKTLIILISQIIFTDKNLSTSFHYTGKGLVSLLPD 333

Query: 339 KVLEAWLEFELDSTLDQYEKIVSSA--LLTNGADLVKLLESMYQYFEPCFNIDYYHLNSY 396
           +  + WL +E+++T  Q+E I  +   L  +  D  K+L+  Y+Y EP + ++Y  L +Y
Sbjct: 334 ESWDKWLTYEIEATTKQFETITQNPVDLSKSADDFNKILKKTYEYLEPFYQLEYEPLETY 393

Query: 397 KLQIVSRIFLELVSRYNKFIISPDPALSLLPEEKQLEITFLKLHNIVLLEQCVSELRFKP 456
           KL+  S+IF++L S Y  ++++ D       +EK+L  T +KL  + ++ + + EL   P
Sbjct: 394 KLKTCSQIFMKLSSSYLDYVLTTDSLGEKRTKEKELYQTIIKLQCLNIVYRKIYELSENP 453

Query: 457 AFIELTYIFNKLSNSTYPSIFTESFSALEETVV-TVRESIIHRWKKILKASLSPYFRLSK 515
            FI LT + N++  S Y S+F    +  +  +V  ++ SIIHR KK++K SL  YF+L  
Sbjct: 454 VFIRLTNMVNEIEGSNYFSVFQNILNDYQTDMVDDIQNSIIHRVKKLIKESLQNYFKLKT 513

Query: 516 WQEISNPPAQ---CSTELIGAIQKSSKLKAEFALLKLPTNISISIFHGLLTQWIFYLKDY 572
           W  + NP       S+EL+  I   +++        +P+ I ++I + LL   + Y  + 
Sbjct: 514 WSNLENPSENMESASSELVNTINLLNRVINSVDSRDIPSPIILNIKNELLNIIVNYFVES 573

Query: 573 VVKVNNFSENGLKQVMLDYGELKTVLQLDDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPF 632
           ++K+N F++ GL Q  +D+  L+  L L       +E    E +KVL+++Y+ K +   F
Sbjct: 574 ILKLNKFNQQGLSQFNIDFCSLRDTLNLPTNIINAKESNLLELLKVLTIRYDQKGET--F 631

Query: 633 LSKGYMSQSQDYLEVRDALGLKYISNS 659
           LSK Y++    + ++R  L L+++ +S
Sbjct: 632 LSKTYINAGA-FDDLRKRLSLQHLDDS 657

>YGL145W (TIP20) [1842] chr7 (230246..232351) Cytoplasmic protein
           required for ER to Golgi transport, interacts physically
           with Sec20p [2106 bp, 701 aa]
          Length = 701

 Score =  289 bits (740), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 208/705 (29%), Positives = 368/705 (52%), Gaps = 66/705 (9%)

Query: 2   LQSIQDLINIDSHIKEVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSIS 61
           +  I DL+NI+  IK+V ++R+ELA +L+ LK        ++ L E    D    I   +
Sbjct: 1   MNGIDDLLNINDRIKQVQNERNELASKLQNLKQSLASNDTEVALSEVIAQDI---IEVGA 57

Query: 62  NIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEK----VSTEQLQSVDLEH 117
           ++  +E LR KYG LQ+L+++E +  Q+   +   + ++  E+    ++ +      L+ 
Sbjct: 58  SVEGLEQLRAKYGDLQILNKLEKVAVQQTQMQAGVDKLDSFERQLDELAEQPPDQFTLDD 117

Query: 118 LSTLKQRIVSL--------GIESM---------EVITRFNS-LLEAIAKELMEKFKQDLL 159
           +  L  ++ S+         I+S          +V  ++N  +++ +A      F Q LL
Sbjct: 118 VKALHSKLTSVFATVPQINNIDSQYAAYNKLKSKVTGKYNDVIIQRLATNWSNTFDQKLL 177

Query: 160 NSKWDTDYFVS-SKKIIHDIRQQSSTLFNLQTLWL--------DDS------SDDNENRQ 204
            ++WDT  F S S  ++  +R+ S+ L+ L  L+L         DS      S++N+   
Sbjct: 178 EAQWDTQKFASTSVGLVKCLRENSTKLYQLSLLYLPLEEETQNGDSERPLSRSNNNQEPV 237

Query: 205 YWNFQGISHNFLIKFMYHFSNPKFEDSGQQKQSIELYFKFLDRYLETKLFRCIDIFCDEK 264
            WNF+ +++NF ++F YHF       +      IE YF+FL+ YL   L++CI+IF D+ 
Sbjct: 238 LWNFKSLANNFNVRFTYHFH------ATSSSSKIETYFQFLNDYLAENLYKCINIFHDDC 291

Query: 265 SGLTKEFVHEQFINHTLNPIRNKITQTLLNISENQTNENLRTMIVLISQIFINDNALIKK 324
           +GLTK  +HEQFIN+ L PIR+K+  TL          +L+T+IVLISQI   D  L+  
Sbjct: 292 NGLTKPVIHEQFINYVLQPIRDKVRSTLF-------QNDLKTLIVLISQILATDKNLLNS 344

Query: 325 HYYTGIGLVSLLPTKVLEAWLEFELDSTLDQYEKIVSSA--LLTNGADLVKLLESMYQYF 382
            +Y G+GLVSL+  +V E W+ +E++    Q+  I  +      +  + VKL+  +Y Y 
Sbjct: 345 FHYHGLGLVSLISDEVWEKWINYEVEMANRQFINITKNPEDFPKSSQNFVKLINKIYDYL 404

Query: 383 EPCFNIDYYHLNSYKLQIVSRIFLELVSRYNKFIISPDPALSLLPEEKQLEITFLKLHNI 442
           EP +++D+  L  YKL   S IF+ L S Y  +I++ D       +E++L  T  KL ++
Sbjct: 405 EPFYDLDFDLLVRYKLMTCSLIFMNLTSSYLDYILTVDSLNETRTKEQELYQTMAKLQHV 464

Query: 443 VLLEQCVSELRFKPAFIELTYIFNKLSNSTYPSIFTESFSALEETVVT-VRESIIHRWKK 501
             + + +  L     FI+LT I N   +  Y S+F    +  E+ + T ++ SI+HR +K
Sbjct: 465 NFVYRKIKSLSSNFIFIQLTDIVNSTESKKYNSLFQNVENDYEKAMSTDMQNSIVHRIQK 524

Query: 502 ILKASLSPYFRLSKWQEIS-------NPPAQCSTELIGAIQKSSKLKAEFALLKLPTNIS 554
           +LK +L  YF++S W  +         P +  S EL+ +I    +L  +   + +P  IS
Sbjct: 525 LLKETLRNYFKISTWSTLEMSVDENIGPSSVPSAELVNSINVLRRLINKLDSMDIPLAIS 584

Query: 555 ISIFHGLLTQWIFYLKDYVVKVNNFSENGLKQVMLDYGELKTVLQLDDVPQCVQEEEFEE 614
           + + + LL   + Y  + ++K+N F++NGL Q + D+  L ++L L       +     E
Sbjct: 585 LKVKNELLNVIVNYFTESILKLNKFNQNGLNQFLHDFKSLSSILSLPSHATNYKCMSLHE 644

Query: 615 FMKVLSLKYNGKSQVLPFLSKGYMSQSQDYLEVRDALGLKYISNS 659
            +K+L LKY+  +Q   FL+  Y+ ++ ++  +++A  +KY+ ++
Sbjct: 645 LVKILKLKYDPNNQ--QFLNPEYI-KTGNFTSLKEAYSIKYLKDT 686

>CAGL0E04972g complement(480678..482693) similar to sp|P33891
           Saccharomyces cerevisiae YGL145w TIP20 required for ER
           to Golgi transport, start by similarity
          Length = 671

 Score =  273 bits (697), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 201/676 (29%), Positives = 346/676 (51%), Gaps = 73/676 (10%)

Query: 1   MLQSIQDLINIDSHIKEVSSKRDELAERLKQLKD--------EEDDFINQMDLIEKRLDD 52
           ML  I DL++++ HI E+  KR+ LA  L+  ++        EE + I   DL+ +R+  
Sbjct: 1   MLNDINDLLDLEKHIDEIEQKRNTLANELETYRNGVVTRKIHEEQESI---DLLAERI-- 55

Query: 53  ATAEISSISNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQS 112
               +++  N+  IE L+ ++G L++L ++E   + +     + E ++E++K+  E  + 
Sbjct: 56  ----LAATDNLEAIEQLKTEFGELRILKELETDIKNR---NKKKETVDELQKLEPELNEV 108

Query: 113 VDLEHLSTLKQRIVSLG-----IESMEVIT----------RF-NSLLEAIAKELMEKFKQ 156
           ++    +T+   I++L      I + EVI           +F + L+  +    M + + 
Sbjct: 109 IESNDENTITDSIINLHDKISLICNDEVIHLDDYIQYFIFKFEDELVRPVISTKMNELQD 168

Query: 157 DLLNSKWDTDYFVS-SKKIIHDIRQQSSTLFNLQTLWLDDSSDDNENRQYWNFQGISHNF 215
            LL S WD     S +   I+D+R +SS LF L     ++SS+        N + I++NF
Sbjct: 169 KLLKSYWDNQKKNSLTTNQINDLRSKSSELFRLNNCLFNNSSE-----PLANMKAIANNF 223

Query: 216 LIKFMYHFSNPKFEDSGQQKQSIELYFKFLDRYLETKLFRCIDIFCDEKSGLTKEFVHEQ 275
            ++F YHF N   +        IE YFKFL  YL   L++CI IF D   GL+K  +H++
Sbjct: 224 KVRFTYHFHNSTTD--------IETYFKFLKDYLHENLYQCISIFYDPSVGLSKAIIHQE 275

Query: 276 FINHTLNPIRNKITQTLLNISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSL 335
           FIN+ LNPIR KI  TL       +  +L++ I LISQI   D  L K  +Y G GL SL
Sbjct: 276 FINNVLNPIREKIRSTL-------STNDLKSAIFLISQILATDKILSKTFHYQGSGLASL 328

Query: 336 LPTKVLEAWLEFELDSTLDQYEKIVSSA---LLTNGADLVKLLESMYQYFEPCFNIDYYH 392
           +     E W+ +E + T  Q+  I  +    LL +  +  +L++  Y Y EP   ++Y  
Sbjct: 329 ISDDQWEKWINYEEEITKKQFSSITGNTEKELLQSANNFNELIKKTYVYLEPLLTLEYDP 388

Query: 393 LNSYKLQIVSRIFLELVSRYNKFIISPDPALSLLPEEKQLEITFLKLHNIVLLEQCVSEL 452
              +KLQ  S IFL L S Y +  ++ D       ++++L+ T +KL+N+ ++   + EL
Sbjct: 389 AQKFKLQCCSNIFLNLFSMYLEHTLAVDTLGEKRSKDEELQQTLIKLNNLCIVANKIIEL 448

Query: 453 RFKPAFIELTYIFNKLSNSTYPSIFTESFSALEETV-VTVRESIIHRWKKILKASLSPYF 511
           +    F+ LT I N+     Y S+F +  +  E+ + + ++ SI+HR +K+LK +L  YF
Sbjct: 449 QGMEPFVLLTDIVNRNEAKNYISVFQDILNDYEQNIQIDIQRSIVHRLQKLLKDTLRNYF 508

Query: 512 RLSKW------QEISNPPAQCSTELIGAIQKSSKLKAEFALLKLPTNISISIFHGLLTQW 565
           +++ W      +E++ P    S+E+I AI   +++  +   L++P +I I I + +L   
Sbjct: 509 KITGWSTDYSQEELTTP----SSEIIAAINLLTRIFIKIDTLQVPPSIVIQIKNDILNVL 564

Query: 566 IFYLKDYVVKVNNFSENGLKQVMLDYGELKTVLQLDDVPQCVQEEEFEEFMKVLSLKYNG 625
           + Y  + ++K+N F++ GL Q  LD+ +LK  L L       +E    E + +L LKY+ 
Sbjct: 565 VLYFTESILKLNKFNKRGLLQFELDFNKLKDCLSLPYDNFNFKERMLTEILHILRLKYDS 624

Query: 626 KSQVLPFLSKGYMSQS 641
                 F  K Y+ Q 
Sbjct: 625 AQS--HFYEKQYIKQG 638

>YGR130C (YGR130C) [2087] chr7 complement(751397..753847) Protein
           with similarity to Entamoeba histolytica myosin heavy
           chain PIR:L03534 [2451 bp, 816 aa]
          Length = 816

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 77/142 (54%), Gaps = 16/142 (11%)

Query: 22  RDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSISN-----IAHIEPLRLKYGRL 76
           ++E+ ++   +K E DD  N+   ++K  +D T  +S++S      I  I  + LK G++
Sbjct: 523 KNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKV 582

Query: 77  QVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQSVD----LEHLSTLKQRIVSLGIES 132
           Q  ++I+NL ++KE    +TE  +++ + + + L+SV+    L  ++ +  +I SL +  
Sbjct: 583 Q--NEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSL-LNE 639

Query: 133 MEVITRFNS----LLEAIAKEL 150
           + +I + N+     L AI K L
Sbjct: 640 VTIIKQENANEKTQLSAITKRL 661

>Kwal_56.22949
          Length = 642

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 31  QLKDE--ED-DFINQMDLIEKRLDDATAEISSISNIAHIEPLRLKYGRLQVLDQ-IENLF 86
           Q KDE  ED D+  +++ I  R  +A    + +    H +PL  +  ++Q  D+ +E   
Sbjct: 311 QDKDEAREDYDYDTEVNRILTRTSEAAQYPADLEE--HYDPLAPQITKIQTRDRRLEQRM 368

Query: 87  RQKEVFRHETEVIEEIEKVSTEQ 109
           R+ E+ R +T +  E+EK+ TE+
Sbjct: 369 REGEIQRWKTNLENELEKMGTEK 391

>KLLA0E18150g complement(1609333..1611378) similar to sp|P34243
           Saccharomyces cerevisiae YKL017c DIP1 DNA helicase A,
           start by similarity
          Length = 681

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 21/118 (17%)

Query: 354 DQYEKIVSSALLTNGADLVKLLESMYQYFEPCFNIDYYHLNSYKLQIVSRIFLELVSRYN 413
           +Q + +  ++ L   A L KL+ +          I++  L++ +  I S+++LEL     
Sbjct: 25  EQQQDVEQTSKLLASAPLPKLIAA-------GLAINHLQLDNIRTGIGSKLYLEL----- 72

Query: 414 KFIISPDPALSLLPEEKQLEITFLKLHNIVLLEQCVSELRFKPAFIELTYIFNKLSNS 471
               S DPA++     K+L     K+ +IVL++        K   + L  + +K+SN+
Sbjct: 73  ----SADPAIT-----KELNTGSFKVGDIVLVQPSAKAKSKKDETVNLDAVVSKVSNN 121

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 30.8 bits (68), Expect = 5.2,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 573 VVKVNNFSENGLKQVMLDYGELKTVLQLDDVPQCVQEEEFEEFMKVLSLKYNGKSQVLPF 632
           + K  N +E  +++V  +YG +  V Q+D V       EF  F   L L YN     L F
Sbjct: 939 IAKFLNSNEVAIRRVRKEYGIVPFVKQIDTVAA-----EFPAFTNYLYLTYNASEHDLEF 993

Query: 633 LSKGYM 638
              G M
Sbjct: 994 NDHGVM 999

>Sklu_2297.7 YLR097C, Contig c2297 11729-12781
          Length = 350

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 189 QTLWLDDSSDDNENRQYWNFQGISHNFLIKFMYHFSNPKFEDSGQQKQSIELYFKFLDRY 248
           +TLW +D      NR Y  FQG+ +  ++ ++ + +N +   S      +  Y+++   Y
Sbjct: 179 ETLWNNDYQFMINNRPYVKFQGV-YISVVNYLRYGANAEGSSSLLNPIHMITYYRYFRFY 237

Query: 249 LETKLFRCIDIFCDEKSGLTKEFVHEQFINHT 280
            +    R +    DE S + K +  E++I H+
Sbjct: 238 PDGTCLRLLTT--DEPSTVVKTYHKEKYIKHS 267

>AAL109W [78] [Homologous to ScYPL174C (NIP100) - SH]
           complement(150547..153291) [2745 bp, 914 aa]
          Length = 914

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 37  DDFINQMDLIEKRLDDATAEISSISNIAHIEPLRLKYGRLQVLDQIENLFRQKEVFRHET 96
           ++  NQ+   +  +DD  A++ +  N++HI    L    L + +QI+ L +Q      + 
Sbjct: 317 EELKNQLSDAQSTIDDLVAQVDAEGNVSHIVE-SLTTQNLALTEQIDQLNKQLNEVSSKN 375

Query: 97  EVIEEIEKVSTEQLQSVDLEHLSTLKQRI 125
           EV  E+E+V  E  + + L+ + +L+Q++
Sbjct: 376 EVTAELEQVYKEVEREL-LQQIHSLQQKV 403

>KLLA0C02321g complement(196533..202061) similar to sp|P41832
           Saccharomyces cerevisiae YNL271c BNI1 regulator of
           budding, start by similarity
          Length = 1842

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 23/128 (17%)

Query: 294 NISENQTNENLRTMIVLISQIFINDNALIKKHYYTGIGLVSLLPTKVLEAW--------- 344
           N  EN   E L   IVLI Q+ +N N  +KK +     L S    ++L+           
Sbjct: 483 NTGENSIYEYLVDSIVLIDQLCLN-NEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLS 541

Query: 345 ---LEFELDSTLDQYEKIVSSALLTNGADL---VKLLESMYQYFEPCFNIDYYHLNSYKL 398
              L+FE D+ +D Y  ++ S   T   D+   V +L+ +   F+           SY L
Sbjct: 542 TMLLQFE-DAAIDDYNSLIDSQKFTENVDMDDPVSILQKLTSSFKGT------EAESYLL 594

Query: 399 QIVSRIFL 406
            ++  +FL
Sbjct: 595 SMLQNLFL 602

>KLLA0B02717g 240125..246268 highly similar to sp|P07149 Saccharomyces
            cerevisiae YKL182w FAS1 fatty-acyl-CoA synthase, beta
            chain singleton, start by similarity
          Length = 2047

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 53   ATAEISSISNIAHIEPLRLKYGRLQVLD--QIENLFRQKEVFRHETEVIEEIEKVSTEQL 110
            A  ++ ++  + ++    L + +LQ +D  +++     +EV  H  E+IEEI K ST + 
Sbjct: 1897 AAGDLRALDTLTNV----LNFVKLQKIDIAKLQETLSLEEVESHLNEIIEEISKKSTAKP 1952

Query: 111  QSVDLEH-LSTLKQRIVSLGIES 132
            Q ++LE   + +  R +S+   S
Sbjct: 1953 QPIELERGFACIPLRGISVPFHS 1975

>CAGL0G02497g 223375..228717 similar to sp|Q02455 Saccharomyces
            cerevisiae YKR095w MLP1, hypothetical start
          Length = 1780

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 27/38 (71%)

Query: 17   EVSSKRDELAERLKQLKDEEDDFINQMDLIEKRLDDAT 54
            E+ S +D++++  K LK E D++  Q+DL ++R+DD T
Sbjct: 1094 ELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDIT 1131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,715,872
Number of extensions: 988648
Number of successful extensions: 4846
Number of sequences better than 10.0: 160
Number of HSP's gapped: 4993
Number of HSP's successfully gapped: 187
Length of query: 659
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 551
Effective length of database: 12,857,365
Effective search space: 7084408115
Effective search space used: 7084408115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)