Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14872g67766635860.0
Kwal_23.346466865818470.0
ADL285C64465017960.0
YGL144C (ROG1)68567716990.0
Scas_669.1469064716760.0
CAGL0E04950g67365216330.0
YDL109C64758913680.0
Scas_613.1462860812951e-171
CAGL0H10340g5925958361e-103
AER322C6366497977e-97
Kwal_47.184826236307522e-90
YDR444W6874245663e-63
KLLA0B01375g6404235563e-62
Scas_717.506584255565e-62
CAGL0M10043g6584255381e-59
Kwal_55.217034412262074e-17
KLLA0F16709g5312122095e-17
YOR059C4502221924e-15
AFR386C5042121881e-14
Kwal_27.101022582211768e-14
KLLA0F16423g4592111818e-14
Sklu_2393.45462131774e-13
Scas_698.394712591523e-10
CAGL0L10318g4572331505e-10
ADR202C4432531489e-10
Sklu_2232.44452341471e-09
CAGL0H09218g27952760.31
KLLA0B01243g627165740.92
Kwal_47.1851262557721.6
Kwal_23.4740612102711.9
Scas_641.559344702.7
CAGL0G07062g53965675.1
YHR111W (UBA4)440170658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14872g
         (666 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...  1385   0.0  
Kwal_23.3464                                                          716   0.0  
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   696   0.0  
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   659   0.0  
Scas_669.14                                                           650   0.0  
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   633   0.0  
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   531   0.0  
Scas_613.14                                                           503   e-171
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   326   e-103
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   311   7e-97
Kwal_47.18482                                                         294   2e-90
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   222   3e-63
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   218   3e-62
Scas_717.50                                                           218   5e-62
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   211   1e-59
Kwal_55.21703                                                          84   4e-17
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    85   5e-17
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    79   4e-15
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    77   1e-14
Kwal_27.10102                                                          72   8e-14
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    74   8e-14
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                73   4e-13
Scas_698.39                                                            63   3e-10
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    62   5e-10
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    62   9e-10
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            61   1e-09
CAGL0H09218g complement(904209..905048) similar to sp|P53078 Sac...    34   0.31 
KLLA0B01243g complement(97985..99868) similar to sp|Q03722 Sacch...    33   0.92 
Kwal_47.18512                                                          32   1.6  
Kwal_23.4740                                                           32   1.9  
Scas_641.5                                                             32   2.7  
CAGL0G07062g complement(671395..673014) similar to sp|Q03722 Sac...    30   5.1  
YHR111W (UBA4) [2399] chr8 (333074..334396) Ubiquitin-activating...    30   8.3  

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/666 (100%), Positives = 666/666 (100%)

Query: 1   MQSMLRYIIPSTMRQNAKHQRDQWLKMTASDHDIMYHFQSSLRIGELERYIFTYDLYMGD 60
           MQSMLRYIIPSTMRQNAKHQRDQWLKMTASDHDIMYHFQSSLRIGELERYIFTYDLYMGD
Sbjct: 1   MQSMLRYIIPSTMRQNAKHQRDQWLKMTASDHDIMYHFQSSLRIGELERYIFTYDLYMGD 60

Query: 61  EIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFES 120
           EIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFES
Sbjct: 61  EIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFES 120

Query: 121 NIQPQQDFIAELSLHNLKKRYVWIVDIASQILFTKQASINFSITVGGSKESISVDSARNI 180
           NIQPQQDFIAELSLHNLKKRYVWIVDIASQILFTKQASINFSITVGGSKESISVDSARNI
Sbjct: 121 NIQPQQDFIAELSLHNLKKRYVWIVDIASQILFTKQASINFSITVGGSKESISVDSARNI 180

Query: 181 QLGVQSSRMKVDRLTTADLWNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIE 240
           QLGVQSSRMKVDRLTTADLWNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIE
Sbjct: 181 QLGVQSSRMKVDRLTTADLWNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIE 240

Query: 241 KTQNQHEEMLVVKGFTDNVCKTEKGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLV 300
           KTQNQHEEMLVVKGFTDNVCKTEKGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLV
Sbjct: 241 KTQNQHEEMLVVKGFTDNVCKTEKGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLV 300

Query: 301 QSFAIAYISYNYPKFFEQVEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSL 360
           QSFAIAYISYNYPKFFEQVEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSL
Sbjct: 301 QSFAIAYISYNYPKFFEQVEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSL 360

Query: 361 QTYNGLKQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDK 420
           QTYNGLKQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDK
Sbjct: 361 QTYNGLKQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDK 420

Query: 421 LNMNTEDLQTDFFQRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDK 480
           LNMNTEDLQTDFFQRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDK
Sbjct: 421 LNMNTEDLQTDFFQRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDK 480

Query: 481 SYITDPKTRKDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQ 540
           SYITDPKTRKDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQ
Sbjct: 481 SYITDPKTRKDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQ 540

Query: 541 IARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWK 600
           IARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWK
Sbjct: 541 IARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWK 600

Query: 601 LDPISKDEDFDWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMTESTVPTSYSQE 660
           LDPISKDEDFDWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMTESTVPTSYSQE
Sbjct: 601 LDPISKDEDFDWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMTESTVPTSYSQE 660

Query: 661 ELFKYE 666
           ELFKYE
Sbjct: 661 ELFKYE 666

>Kwal_23.3464
          Length = 668

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/658 (53%), Positives = 467/658 (70%), Gaps = 27/658 (4%)

Query: 34  IMYHFQSSLRIGELERYIFTYDLYMGDE-IPSDLTLDSLWLKIKNIENVTLRAAYLMGPY 92
           ++YH +SS+++GE+ERYI +Y LY  DE +P+DL L+SLWLK++NIE+ T RAAYLMGPY
Sbjct: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65

Query: 93  VLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIASQIL 152
           +LY DVR  DYHH QRLF+SADQP FE  +QPQQDFI ELSLHNLKK YVW+VD+ SQI+
Sbjct: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125

Query: 153 FTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSKSVFGR 212
           FT    + F ++VG S++ ++  S  +   G   S++ V RLT+ DLWN   +  S    
Sbjct: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLP-VQLSTHTH 184

Query: 213 RKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQH-EEMLVVKGFTDNVCKTEKGIKWLGT 271
           +KEHLVILTHGLHSNV +D+FY+KEQIEK Q  + EE +VVKGF  NVCKTEKGI +LGT
Sbjct: 185 QKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGT 244

Query: 272 RLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMASPM 331
           RLAE+IV  LY++   KISFIGHSLGGLVQ+FAIAYI   YP FF+ V P+NFIT+A+P+
Sbjct: 245 RLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATPL 304

Query: 332 LGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKSCT 391
           LGIV+DN  Y+  LL+ GI GKTGQDL L   +   +PLL  L      + +L+ FK  T
Sbjct: 305 LGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPT-KTVLRMFKRRT 363

Query: 392 VYANACNDGIVPLYTSALLFLDYDDILDKLNMNTE-------DLQTDFFQRNFISPLTKA 444
           +YANA NDGIVPLY+++LLFLDY+D+L +L    E       +  +DF  RNF+SP++KA
Sbjct: 364 IYANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPISKA 423

Query: 445 MDILMPQRVSQNGT-KIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSGQD 503
           +    PQ+   +G+ KIP  S+++SA SVLIPPLP+K+YI +P +R+++++HDK+Y  Q+
Sbjct: 424 ISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYCDQE 483

Query: 504 IPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAH 563
           +P  +S S+ E++ S+N LLK F  + G   ++LEE+IAR WH+ + WRKV++ LKPDAH
Sbjct: 484 VPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAH 543

Query: 564 NNIITRRRFSNAYGWPVVDHLTETHFLN-DDKSS----------RSWKLDPISKDEDFDW 612
           NNII RRRFSNAYGWPVVDHLT+ HF + DD+S           +S +  P    ED  W
Sbjct: 544 NNIIVRRRFSNAYGWPVVDHLTQNHFNSMDDESEEMDSMVTNSVKSDQTSPEDHKEDRSW 603

Query: 613 IVKPTVDSVFDVGPTGMICTFGEMLENLKTSTL----EGMTESTVPTSYSQEELFKYE 666
           +     +++FDVGPTGMI T GE+L+++  ++          ST   S+ Q+ LF+YE
Sbjct: 604 MFDNGKETMFDVGPTGMISTVGEILDSMAKNSFMIHRSNGAPSTQGPSFEQDNLFRYE 661

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/650 (53%), Positives = 465/650 (71%), Gaps = 26/650 (4%)

Query: 28  TASDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAY 87
           T    +++YH++SS+RIGE+ERY+ TYDLY  +E+P  + L SLWLK+KN+ ++T RAAY
Sbjct: 3   TEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAY 62

Query: 88  LMGPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDI 147
           LMGPY+LY D+RT+DYHH Q+LF SAD PQFE  +QPQ +F+AELSLH L+KRYVW++D+
Sbjct: 63  LMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDV 122

Query: 148 ASQILFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSK 207
            SQI+FT  + + F +T+  +K ++   +    Q G  + R+ V+R TT DLWN   L +
Sbjct: 123 VSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWN---LPQ 179

Query: 208 SVFG--RRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQH-EEMLVVKGFTDNVCKTEK 264
            VF    + EHLV+LTHGLHSNVT+D+ Y+KE IE+ Q  +  E +VVKGF DNVCKTEK
Sbjct: 180 QVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEK 239

Query: 265 GIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNF 324
           GIK+LG RL E+IV  LYN+   +ISFIGHSLGGL Q+FAIAYI+ NYP FFE+V+PVNF
Sbjct: 240 GIKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNF 299

Query: 325 ITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRIL 384
           + ++SP+LGIV++N  Y+  LL+MG+ GKTGQDL LQ + G  QPLL +L   +  RRIL
Sbjct: 300 VALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTT-RRIL 358

Query: 385 KCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQT---DFFQRNFISPL 441
           + FK  T+YANA NDGIVPLYTSALL+LDYD IL +L  +T++ Q    DFF +  I+PL
Sbjct: 359 RKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQL--DTQEYQVDKQDFFTKTLINPL 416

Query: 442 TKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSG 501
            KA+++LMPQ  +Q+ + IP  SM DSA SVL+PPLP+KSY+ +P     V++HDK+YS 
Sbjct: 417 VKAINVLMPQ--TQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSE 474

Query: 502 QDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPD 561
            DIP+     +  +   S++LL   NI    +YK+LEE+IA+ WHK + WRKVI++LKPD
Sbjct: 475 ADIPEVGQPPEKNIW--SSLLL---NIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPD 529

Query: 562 AHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWKLDPISKDEDFD----WIVKPT 617
           AHNNII RRRF+NAYGWPV+DHL + HF   D      + +  + DE  +    WI +P 
Sbjct: 530 AHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKWINRPH 589

Query: 618 VDSVFDVGPTGMICTFGEMLENLKTSTLE--GMTESTVPT-SYSQEELFK 664
            ++ FDVGPTGMI + GE+LEN+K S  +      S  P+ S+  +E+F+
Sbjct: 590 NETFFDVGPTGMISSVGEILENIKNSAFQKTASASSLKPSDSFDDDEIFR 639

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/677 (48%), Positives = 461/677 (68%), Gaps = 48/677 (7%)

Query: 32  HDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGP 91
           ++I++H++SS+++GELERY+ TY LY G+EIP DL L+SLWLK++N+  ++ RAAYLMGP
Sbjct: 7   NEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGP 66

Query: 92  YVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIASQI 151
           ++LY DV+T  YHH Q++  S D P+FE N+Q QQDF+AELS+HN++++YVWI D+ SQI
Sbjct: 67  FMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIADVMSQI 126

Query: 152 LFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSKSVFG 211
           LFT   ++ + +T+G SKES+         LG  S ++ V+RLTT DLWN  L  +    
Sbjct: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWN--LPVQITTP 184

Query: 212 RRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQ-NQHEEMLVVKGFTDNVCKTEKGIKWLG 270
           ++K+HLV+LTHGLHSNV++DL YI EQI K Q N   E +VVKG+  NVC+TEKG+K+LG
Sbjct: 185 QKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLG 244

Query: 271 TRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMASP 330
           TRLAE+I+ +LY+++  KISF+GHSLGGL+Q+FAIAYI   YP FF++V P+NFIT+ASP
Sbjct: 245 TRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFITLASP 304

Query: 331 MLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKSC 390
           +LGIV+DN  YI+ LL+ G+ GKTGQDL L+    + +PLL  LS    +  IL+ FK  
Sbjct: 305 LLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKPLLYLLSGLPLI-EILRRFKRR 363

Query: 391 TVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTED-------------LQTDFFQRNF 437
           TVYANA NDGIVPLYT++LLFLDY+DIL++L    E+             +  DFF + F
Sbjct: 364 TVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFFNKTF 423

Query: 438 ISPLTKAMDILMPQRV-SQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHD 496
           ISPLTK + IL PQ+  ++NG++IP  S  +SA S+L+PPLP+++YI DP +R  V++HD
Sbjct: 424 ISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPVIIHD 483

Query: 497 KVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGG-----QYKKLEEQIARNWHKDVKW 551
           K+Y+  DIP  + + +       N+LL+ F   F G     +Y+ LEE IAR WH+ + W
Sbjct: 484 KIYNEDDIPQSEFDIEDGFFGKKNILLQAF---FAGKKERAKYRNLEETIARRWHEGMAW 540

Query: 552 RKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHF--------LNDDKSSRSWKLDP 603
           RKV++ LKPDAHNNII RR+F+NAYGWPV+DHL + HF          +D  + +  ++P
Sbjct: 541 RKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFNGDDDDDNDENDDINSTQVVEP 600

Query: 604 ISK--------------DEDFDWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMT 649
           I                 +++ W+ K   + VFD GPTGMI T GE++E L       + 
Sbjct: 601 IQSVTEGKKKYRKAENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGFSAVI 660

Query: 650 ESTVPTSYSQEELFKYE 666
           +    +    +E+ ++E
Sbjct: 661 DRRNASEDPNDEVLRFE 677

>Scas_669.14
          Length = 690

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/647 (51%), Positives = 446/647 (68%), Gaps = 33/647 (5%)

Query: 32  HDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGP 91
           +D++Y  +S+L   + +RYI TY+LY  +EIPSD+ LD L+L+IKNIE ++ RAAYLMGP
Sbjct: 2   NDLLYQNKSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGP 61

Query: 92  YVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIASQI 151
           ++LY DVR + YHH QR++ + DQPQFESN+ P QD I  LSLH ++KRYVWIVD+ SQI
Sbjct: 62  FILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQI 121

Query: 152 LFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASL-LSKSVF 210
           LFT    I + I++G +KES+   S  N +LG  S R+ V +L T DLW   + L+ S  
Sbjct: 122 LFTTNTDITYEISMGYTKESLH-HSINNERLG--SDRLVVTKLNTLDLWKLPVQLAPSDR 178

Query: 211 GRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQH-EEMLVVKGFTDNVCKTEKGIKWL 269
            RR++HLVILTHGLHSN+T D+ YI EQI K+Q+ +  E +VV G+  N+C+TE+G+K+L
Sbjct: 179 RRRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGVKYL 238

Query: 270 GTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMAS 329
           G RLA++IV+ LY+ + VKISFIGHSLGGLVQ+FAIAYI+  YP FF++V+P+NFI MAS
Sbjct: 239 GERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIAMAS 298

Query: 330 PMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKS 389
           P+LGIV+DN  Y++ LL+ G+ GKTGQDL L   +   +PLL  L      R +L  FK 
Sbjct: 299 PLLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPT-RSVLLKFKR 357

Query: 390 CTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNT-EDLQTD-----------FFQRNF 437
            T+YANA NDGIVPLYT++LLFLDYDDIL++L+ N  E+L  D            F +NF
Sbjct: 358 RTLYANAINDGIVPLYTASLLFLDYDDILEQLHKNEDEELAKDEQNVTIPENTASFNKNF 417

Query: 438 ISPLTKAMDILMPQRVSQN-GTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHD 496
           ISPLTK + I  PQ+  Q   +K+P  SML SA S+L+PPLPD+ Y+ +PK R  V++HD
Sbjct: 418 ISPLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHPVIIHD 477

Query: 497 KVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGG--QYKKLEEQIARNWHKDVKWRKV 554
           K Y+ +D+P   +  +    NS N+LL+ F     G  +Y+KLEE IAR WH+ + WRKV
Sbjct: 478 KTYTQEDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEESIARRWHEGMSWRKV 537

Query: 555 IINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDK----SSRSWKLDPISKDE-- 608
           ++ LKPDAHNNII RRRF+NAYGW V+DHL   HF  DD+     +++    P+  D+  
Sbjct: 538 VVALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDDRLEEEQTKAGLEAPLPNDQSS 597

Query: 609 ------DFDWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMT 649
                 ++ W+ K   +S+FD GPTGMI T GEMLE    + L  ++
Sbjct: 598 VIEPIDEYAWVTKAESESLFDEGPTGMISTMGEMLETFTKTHLATIS 644

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/652 (48%), Positives = 441/652 (67%), Gaps = 23/652 (3%)

Query: 30  SDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLM 89
           ++ DI+YH++SS+++GE+ERY+  Y LY  DEIP DL LDSL++++KN   ++ RA YL 
Sbjct: 6   ANKDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLA 65

Query: 90  GPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIAS 149
           GP++LY DVR+ +YHH Q +  SAD PQFE+N+Q QQ  + ELSLHN++ +YVWI+D+ S
Sbjct: 66  GPFILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVS 125

Query: 150 QILFTKQASINFSITVGGSKESISVDSARNI--QLGVQSSRMKVDRLTTADLWNASLLSK 207
           QILFT   ++ F +TVG  ++ +  ++       LG  S+ + V RLTT DLW    L +
Sbjct: 126 QILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWK---LPR 182

Query: 208 SVFGRRK-EHLVILTHGLHSNVTSDLFYIKEQIEKTQ-NQHEEMLVVKGFTDNVCKTEKG 265
            +  ++  +HLVILTHGLHSNV++DL Y+ E+I K+Q N   E+L+V G+ DNVC+TEKG
Sbjct: 183 ELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKG 242

Query: 266 IKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFI 325
           +++LGTRLA++I+ NLY+    KISF+GHSLGGLVQ+FAI  ++  YP FF++V+PVNFI
Sbjct: 243 VRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFI 302

Query: 326 TMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILK 385
           T+ASPMLGIV+DN  YI  LL+ G+ G+TG+DL+L      ++PLL +L S   +R IL+
Sbjct: 303 TIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSL-SGEFIRSILR 361

Query: 386 CFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDL------------QTDFF 433
            F+  T+YANA NDGIVPLYTS LL+LDYD IL KL    E+              T FF
Sbjct: 362 KFERRTIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFF 421

Query: 434 QRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVV 493
            +NFISPLTK + +  PQ+  ++  KIP  S   SA S+L+PPLPD ++I +PK R D++
Sbjct: 422 NKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDII 481

Query: 494 VHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFG--GQYKKLEEQIARNWHKDVKW 551
           +HDK+Y+ +DI D + +      N+ N+ L+  +       +Y++LE+ IA  WHK + W
Sbjct: 482 IHDKIYTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSW 541

Query: 552 RKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWK-LDPISKDEDF 610
           RKVI+ LKPDAHNNII RRRFSNAYGWPV+DHL   HF  ++    S K +   +  ED 
Sbjct: 542 RKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENFEMDSQKDVSITTTREDL 601

Query: 611 DWIVKPTVDSVFDVGPTGMICTFGEMLENLKTSTLEGMTESTVPTSYSQEEL 662
           +WI +P  D +F  GPTGMI T GE++E+        + ++T     S  E+
Sbjct: 602 NWIKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATASNEESLREI 653

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/589 (47%), Positives = 370/589 (62%), Gaps = 37/589 (6%)

Query: 30  SDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLM 89
           S  +++YH QSS+++GELERY+ TY+LY GD IP+D+TLDSLW+KIKN   ++ + AYL+
Sbjct: 6   SADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLL 65

Query: 90  GPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIAS 149
           GP++LY DVR KDY    ++  SAD+P F+SN+Q QQ FIAELSLH++K RYVWIVDI S
Sbjct: 66  GPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVS 125

Query: 150 QILFTKQASINFSITVGGSKESISV-----DSARNIQLGVQSSRMKVDRLTTADLWNASL 204
           QILF K+  + F I VG SK S+       DS  +    +  + + V RLTTAD+W    
Sbjct: 126 QILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWK--- 182

Query: 205 LSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQ-NQHEEMLVVKGFTDNVCKTE 263
           + + +   +K HLVILTHG  SNV++D+ Y+ E+I K Q N   E LV+KG+  N C+TE
Sbjct: 183 VPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETE 242

Query: 264 KGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVN 323
           KGIK+LG  LA +I+  LY+D+  KISFIGHSLGGL Q+FAI YI   YP FF++VEP+N
Sbjct: 243 KGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPIN 302

Query: 324 FITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRI 383
           FI++ASP+LGI +    Y++  L+MGI G TGQ+L L+  N   +PLL  LS  S +  +
Sbjct: 303 FISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEESLIS-V 361

Query: 384 LKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDFFQRNF--ISPL 441
           L  FK  T+YANA NDGIVPLY+S+LLFLDY  +L KL   T       FQ     I  L
Sbjct: 362 LARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQTTAPCDPLFQPEVSPIGEL 421

Query: 442 TKAMDIL-----------------MPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYIT 484
               D+                        +   ++  AS++ S  SVL+ P PD  + +
Sbjct: 422 PNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFFS 481

Query: 485 DPKTRKDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARN 544
           DP  R   ++HDK+Y+ +++P                  KT         K++EE IAR 
Sbjct: 482 DPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEGETRKT--------RKEMEEIIARR 533

Query: 545 WHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDD 593
           WHK + WRKV++ LKPDAHNNII RRRFSNAYGWPVVDHL   HF  DD
Sbjct: 534 WHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDD 582

>Scas_613.14
          Length = 628

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 272/608 (44%), Positives = 384/608 (63%), Gaps = 45/608 (7%)

Query: 30  SDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLM 89
           SD  ++Y   S ++IG + RYI  Y+LY GDEIP+ ++LD L L IKN    + +AAYLM
Sbjct: 6   SDDQVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLM 65

Query: 90  GPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDIAS 149
           GP+ LY DVR + YHHKQR+  S D PQF SN+QP   FIAELSLH +KK+YVWI+D+ S
Sbjct: 66  GPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVIS 125

Query: 150 QILFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNAS----LL 205
           Q +F+  +  +F +T+G         +  N   G   S ++V+ L+T  +WN      LL
Sbjct: 126 QSIFSLNSVTSFELTLG--------TTTNNYNSG---SSLEVETLSTDVIWNEKATIPLL 174

Query: 206 SKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHE-EMLVVKGFTDNVCKTEK 264
            +S   R+  HLVILTHG+HSNVT+D+ Y+ EQI  TQ+ +  E +VVKG+  NVCKTE 
Sbjct: 175 RES---RKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEM 231

Query: 265 GIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNF 324
           GIK+LG  LA++I+  LY+    KISFIGHSLGGL+QSFAI+ I+  +P FFE+V+PVNF
Sbjct: 232 GIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNF 291

Query: 325 ITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRIL 384
           IT+A+P LGIV+DN  Y++ LL+ GI GKTG DL L+ +      LL    S   ++ I+
Sbjct: 292 ITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDNILYLL----SGEPIKSIM 347

Query: 385 KCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLN-------MNTEDLQTDFFQRNF 437
           K F+  T+YANA NDGIVPLYTS LLFLDY D+L +L+       +  +  ++       
Sbjct: 348 KKFERRTLYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKI 407

Query: 438 ISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDK 497
           I+  +    +   ++  ++  K+P  S+++S  S+L PP P   YIT+P +R  V++HDK
Sbjct: 408 INTSSSWSKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDK 467

Query: 498 VYSGQDIPDHQSNSQLEVMNSSNVLLKTFNI-AFGGQYKKLEEQIARNWHKDVKWRKVII 556
           VY+  DI   +SN     + +  +L + +   + G Q ++LE +IA+ WH    WRKVI+
Sbjct: 468 VYTEDDIERIESN--FYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIV 525

Query: 557 NLKPDAHNNIITRRRFSNAYGWPVVDHLTETHF---------LNDDKSSRSWKLDPISKD 607
            L  +AHNNII RRRFSN YGW V+DHL E HF          N++++     ++P   +
Sbjct: 526 ALGSEAHNNIIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEP---N 582

Query: 608 EDFDWIVK 615
           ++F WI K
Sbjct: 583 KEFSWITK 590

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 214/595 (35%), Positives = 316/595 (53%), Gaps = 90/595 (15%)

Query: 35  MYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVL 94
           M H + +L IGE  R++         E+ S++    ++++++N    T RA YL+GP+VL
Sbjct: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51

Query: 95  YADVRTKDYHHKQRLFISADQ----PQFESNIQPQQDFIAELS---LHNLKKRYVWIVDI 147
           Y D R           I A+Q    PQF++NI+PQ  F  +L      ++  +  WI+D+
Sbjct: 52  YCDSRP---------VIPANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDV 102

Query: 148 ASQILFTKQASINFSITVG-----GSKESISVDSARNIQLGV---QSSRMKVDRLTTADL 199
            S++LF +   +++ + +        K     D   +I+  V   Q S   +        
Sbjct: 103 VSEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEV-- 160

Query: 200 WNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKT-QNQHEEMLVVKGFTDN 258
              + + KS    R +HLVI+THG+ SNV++D+ YI EQ+    ++  +E L++ G+T N
Sbjct: 161 --GAKIKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGN 218

Query: 259 VCKTEKGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQ 318
           VC+TE GIK LG RLA +IV   YN    KISFIGHSLGGLVQ+FAIAYI   +  FF+ 
Sbjct: 219 VCRTELGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDA 278

Query: 319 VEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSS 378
           V+PVNFI++A+P LG+ S    Y +RLL+ G  G+TG+DL   ++N LK   +  L S  
Sbjct: 279 VKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGD 338

Query: 379 ALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDK---LNMNTEDLQT----- 430
               IL+ F+  T+YANA NDGIVPL +SALL+LDY  IL     L   T+D+++     
Sbjct: 339 PAHSILQKFERRTLYANAINDGIVPLASSALLYLDYSKILKDSKLLKKETDDIRSIVMTW 398

Query: 431 -------DFFQRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYI 483
                  DF     ++P +K       +RVS           L +    L+ P P K+  
Sbjct: 399 KEFQDSEDFKVYKKVNPKSKIF-----RRVS-----------LTNTVGNLVLPEPPKNIT 442

Query: 484 TDPKTRKDVVVHDKVYSGQDIPDHQ---SNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQ 540
           +D K    V++HD+VY   DIPD +    +   E+M                   +L+E 
Sbjct: 443 SDMK----VLIHDQVYQYNDIPDSEYFPPDGIDEIMAMDR--------------HQLQEC 484

Query: 541 IARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKS 595
           +AR WH    WRKVI+ L+ DAHN+I  RRR+SN+ GW V+ H+   HF+   K 
Sbjct: 485 MARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKC 539

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  311 bits (797), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 207/649 (31%), Positives = 345/649 (53%), Gaps = 95/649 (14%)

Query: 21  RDQWLKMTASDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIEN 80
           R+  + + + +H ++Y+ Q  +  GE+ RYI   D     ++ +   ++ L L+IKN+E+
Sbjct: 11  RESKVLLESGNHVLLYNDQRGISQGEVFRYIIKVD---KAQLDAKTKIEELVLRIKNVES 67

Query: 81  VTLRAAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKR 140
             LR  YL GPY +YA+VR   Y++ +      D  QF S+++P + F A L L+   + 
Sbjct: 68  PLLRPIYLTGPYSVYAEVRP--YNYDENTAFQGDDLQFISDLKPDEAFSATLKLNGDSQV 125

Query: 141 -----YVWIVDIASQILFTKQASINFSITVGGSKESISVDSARNIQLGVQS-SRMKVDRL 194
                Y W  D+ SQ+ +     I   +++G ++ SI   + +     V+  S   V+  
Sbjct: 126 LESTVYSWTADVLSQMTWMVDHPILVRLSIGNTR-SIGKAAMKTPARAVEPVSGFTVEIQ 184

Query: 195 TTADLWNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEM----L 250
            T  +WN   L    F  R  HLVI+THG+ SN+  D+ Y++++++K  +  EE     +
Sbjct: 185 DTMTVWNEPPL----FPERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNV 240

Query: 251 VVKGFTDNVCKTEKGIKWLGTRLAEHI---VHNLYNDATV-KISFIGHSLGGLVQSFAIA 306
           VV+G+  N+ K+ KGI++L  R+A+++   +  + N+  + +ISFIGHSLGGLVQ+FAI 
Sbjct: 241 VVRGYHGNIGKSHKGIEYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQ 300

Query: 307 YISYNYPKFFEQ----VEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSL-- 360
           Y+    P  F      + P+NFI +ASP LG++ D  +Y    L  G  G+TG+DL+L  
Sbjct: 301 YMLERDPGIFSPQAGGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKN 360

Query: 361 ------------QTYNGLKQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSA 408
                       Q YN  ++P+L+++ S S ++ +L+ F + T+YANA +DGIVPL TSA
Sbjct: 361 DFAISELVRNPKQAYN--RRPVLESIVSGS-MKSVLQAFSNRTLYANALHDGIVPLRTSA 417

Query: 409 LLFLDY-----------DDILDKLNMNTEDLQTDFFQRNFISP-LTKAMDI---LMPQRV 453
           LL+LD+            +  +  ++  ED     +    I P L++  D    L+P+ +
Sbjct: 418 LLYLDWYSLQEVNLIGAQEGAETFDLGEEDHALKRYDTVEIPPDLSEKKDTIRWLLPRAL 477

Query: 454 SQNGTK------------------------IPVASMLDSAYSVLIPPLPDKSYITDPKTR 489
            +   K                        +  AS L SA ++L+ P P + Y  DP++R
Sbjct: 478 IKRRHKWYKRSQTVKPGIEQLWDEDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSR 537

Query: 490 KDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDV 549
            D + HDK YS +++P             +  LLK   +    +  + +E+IAR + + +
Sbjct: 538 TDYIFHDKRYSPEELP--------PAYYRNRELLKKI-LYPNDKVHRTQEKIARGYQESM 588

Query: 550 KWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRS 598
            WRKV++N++P++HNNII RRRF N++GW V++HL   HF    ++SRS
Sbjct: 589 SWRKVLVNIQPESHNNIIVRRRFVNSFGWIVIEHLVNEHF--GRRASRS 635

>Kwal_47.18482
          Length = 623

 Score =  294 bits (752), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 204/630 (32%), Positives = 329/630 (52%), Gaps = 100/630 (15%)

Query: 42  LRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVLYADVRTK 101
           L +GEL RY  T D  + D+  S +T    +L  KN E+  LR  YL GPY  Y DV+  
Sbjct: 18  LGLGELVRYNVTVDRSLLDDHLSHIT--EFYLTFKNTESAFLRPIYLTGPYSFYVDVQPC 75

Query: 102 DYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKK-----RYVWIVDIASQILFTKQ 156
           +Y  +       ++ QF  +++P +++ A L L++  +     R+VW +++ SQ+  TK 
Sbjct: 76  NYDERIPF---NEKLQFCEDVKPNEEYRAVLQLNDNSRVEESERFVWQINVMSQLSVTKI 132

Query: 157 ASINFSITVGGSKES-ISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSKSVFGRRKE 215
             + F + +   K S I      +I+  V       ++  T  LWN        F  R  
Sbjct: 133 PVLGFRLCISCGKSSEIPSSPVTSIKGFV------CEKWDTHGLWNLP----PRFPDRPL 182

Query: 216 HLVILTHGLHSNVTSDLFYIKEQIEKT-----QNQHEEMLVVKGFTDNVCKTEKGIKWLG 270
           HLV+LTHG+ SNV  DL Y+K++IE       ++     LVV+G+  N  ++ KGIK  G
Sbjct: 183 HLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGNQGRSSKGIKANG 242

Query: 271 TRLAEHI---VHNLYNDATVK-ISFIGHSLGGLVQSFAIAYISYNYPKFFEQ---VEPVN 323
            RLA+ I   V +L  +  ++ ISF+ HSLGG  Q+ AI YI    P  F+    ++P+N
Sbjct: 243 VRLAKFIIETVDDLKEEYDLQYISFVAHSLGGPSQAMAIRYICLERPDIFDPAKGLKPLN 302

Query: 324 FITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQ-----TYNGL-----------K 367
           FIT+ASP LGI  +   ++   L +G+ G+TG DL+L      + +G+           +
Sbjct: 303 FITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKDGIVRKDEKLGSYRR 362

Query: 368 QPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTED 427
           +PLL+ + S   L  +++ F++ T+YAN  +DGIVPL T+ALL+LD+  + D   +  E+
Sbjct: 363 KPLLEIIPSR-PLTELIQRFENRTIYANILHDGIVPLRTAALLYLDWKALGDVRGIRREN 421

Query: 428 LQTDFF------QRNFISPLTK-------AMDILMPQRV--------------------- 453
            + D        +++ I  + +       A+  LMPQ                       
Sbjct: 422 GKDDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALRRKYKKYTRTQILSQESGNE 481

Query: 454 ---SQNGTK----IPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSGQDIPD 506
              S+  T+     P A+ L SA ++++ PLP + Y+ +PK R+D +VHDK+Y   ++P 
Sbjct: 482 NSYSEESTEPISPPPSANPLVSAANIIVAPLPTQKYLQNPKEREDKIVHDKIYYPDELPP 541

Query: 507 HQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAHNNI 566
                +       +VL K   I    +  +++E+IAR W + + WRKV+++++PD+HNNI
Sbjct: 542 AHYRKR-------DVLKKI--IYPNDRIYRVQERIARQWQETMNWRKVLVSIEPDSHNNI 592

Query: 567 ITRRRFSNAYGWPVVDHLTETHFLNDDKSS 596
           + RR+F NA+GW VVDHL + HF  +  S+
Sbjct: 593 VVRRKFVNAFGWVVVDHLVKEHFGKESCST 622

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  222 bits (566), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 225/424 (53%), Gaps = 43/424 (10%)

Query: 25  LKMTASDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLR 84
           L++  +   ++   +  LRIGEL RY F+ +  +  E    L +  L+L+IKN E+  LR
Sbjct: 12  LEINETGGTLLVDERKRLRIGELYRYKFSVNKDVIKE--QGLDVSHLFLRIKNEESALLR 69

Query: 85  AAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKK----- 139
             YL GPY  Y DVR  +Y+ + R F   +   F  N++P + F  ++ L+   +     
Sbjct: 70  PLYLTGPYSFYIDVRPHNYN-ENRKFPGKEIIPFVENLKPDERFKVKILLNENSRVGDTS 128

Query: 140 RYVWIVDIASQILFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADL 199
            Y W +DI SQ+  T    + FS  +G +++ +   +     L      + ++   T  L
Sbjct: 129 LYSWTIDIISQLAVTTIPKLEFSFRIGTTRKVVKKSNG----LFKSIEGVSLEMWDTETL 184

Query: 200 WNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEML----VVKGF 255
           W+        F  +  HLVI+THG+ SN+  D+ Y+K++IE+     +E +    +V+GF
Sbjct: 185 WDLP----PKFPEKPVHLVIMTHGIFSNIGCDMLYMKDKIEEMTFPMDESINPNIIVRGF 240

Query: 256 TDNVCKTEKGIKWLGTRLAEHI---VHNLYNDATV-KISFIGHSLGGLVQSFAIAYISYN 311
             NV K+  GI  LG R+ +++   V  L     V +ISFIGHSLGG  QS A+ YIS  
Sbjct: 241 MGNVGKSGHGIHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIK 300

Query: 312 YPKFFEQVE---PVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSL-------- 360
            P FF+ V+   PVNFIT+ASP +G++ D   Y+   L MG  G TG+DL+L        
Sbjct: 301 RPDFFDAVKGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSK 360

Query: 361 -------QTYNGLKQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLD 413
                  + Y    + +L+ L  + A +++ + FK  T+YAN  +DGIVPL T+ALL+LD
Sbjct: 361 DGLYADDEVYPEHSKYILEILPQAPA-KKVFESFKRRTIYANVMDDGIVPLRTAALLYLD 419

Query: 414 YDDI 417
           +  I
Sbjct: 420 WRSI 423

 Score =  103 bits (257), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 78/128 (60%), Gaps = 11/128 (8%)

Query: 463 ASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSGQDIPD-HQSNSQLEVMNSSNV 521
           A+ + SA SVL   +PD+ YI +P  RKD V+HDK+Y  +++P  H  N  +        
Sbjct: 526 ANTVLSALSVLTAAIPDQEYIKNPAVRKDEVIHDKLYHPEELPPPHYENRPI-------- 577

Query: 522 LLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVV 581
            +K   I       +++E+IAR W + + WRKV++ ++PD+HNNI+ RRRF N YG+  V
Sbjct: 578 -VKKL-IYPNESVNRIQERIAREWQETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAV 635

Query: 582 DHLTETHF 589
           +H+ E HF
Sbjct: 636 EHMVEHHF 643

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  218 bits (556), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 141/423 (33%), Positives = 233/423 (55%), Gaps = 45/423 (10%)

Query: 40  SSLRIGELERY--IFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVLYAD 97
            SL IG++ RY  I   +  + D I  + T D+L+L+ KN E+  LR  ++ GPY +Y +
Sbjct: 25  GSLGIGDVNRYKIIVDKNKLLSDGI--ECTDDTLYLEFKNQESALLRPLWITGPYSIYVE 82

Query: 98  VRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKR-----YVWIVDIASQIL 152
           +   +Y  +++     D  +F S+++P ++F A+L L++  +      Y W +D+ +Q  
Sbjct: 83  ITPNNYDERKQFI--GDGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWKIDLIAQFT 140

Query: 153 FTKQASINFSITVGGS-KESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSKSVFG 211
                 + F  T+  + K +      +NI++  Q+  +K+ +L T  LWN        F 
Sbjct: 141 VVTIVRLPFVFTLATTYKTAKHSQKDKNIEVQ-QTDGLKISKLDTEQLWNLP----PPFP 195

Query: 212 RRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQN----QHEEMLVVKGFTDNVCKTEKGIK 267
            +  HLVI+THG+ S++  D+  +K+ IE+  N     +   LV++G+  NV K+ KGI+
Sbjct: 196 DKPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNVGKSHKGIR 255

Query: 268 WLGTRLAEHIVHNL----YNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQ---VE 320
            LG +LAE+I+  +          +ISF+GHSLGG VQ+ AI YIS   P  F++   + 
Sbjct: 256 HLGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDIFDKTTGLT 315

Query: 321 PVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQ---------------TYNG 365
           PVNF+  ASP LG++ D   YI  +L +G  G+TG+DL+L+               +++ 
Sbjct: 316 PVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIVNNDGSHDR 375

Query: 366 LK-QPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMN 424
           +K +P+L+ L    AL  + + FK  TVYAN   DGIVPL T+ALL+LD+  + D   + 
Sbjct: 376 IKSKPILELLPKHPAL-EVFQRFKCRTVYANVAFDGIVPLRTAALLYLDWRGLSDVQQVR 434

Query: 425 TED 427
           +E+
Sbjct: 435 SEN 437

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 82/128 (64%), Gaps = 11/128 (8%)

Query: 463 ASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSGQDIPD-HQSNSQLEVMNSSNV 521
           A+ L +A S +  PLP  SY+ DP +R D ++HDKVY+ +++PD H  + +L       +
Sbjct: 516 ANTLQAAASTISAPLPGMSYLVDPSSRTDRIIHDKVYTPEELPDKHYKHKKL----VKKI 571

Query: 522 LLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVV 581
           +   ++I         EE+IAR W + + WRKVI+ L+PD+HNNII RRRF N++GW VV
Sbjct: 572 IYPNYSIHMK------EERIARYWQETMDWRKVIVELQPDSHNNIIVRRRFVNSFGWIVV 625

Query: 582 DHLTETHF 589
           +H+ + HF
Sbjct: 626 NHIADEHF 633

>Scas_717.50
          Length = 658

 Score =  218 bits (556), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 147/425 (34%), Positives = 230/425 (54%), Gaps = 50/425 (11%)

Query: 30  SDHD-----IMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLR 84
           S+HD     ++ +    L IG+L RYI + D    ++  S + ++ L+L+IKN E+  LR
Sbjct: 9   SNHDDTKGILLLNETKKLGIGDLSRYIISVDKKKLED--SGICIEELFLRIKNEESPLLR 66

Query: 85  AAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKK----- 139
             YL GPY  Y DVR  +YH  + +F   +   F  +++P   F  ++ L+   +     
Sbjct: 67  PVYLTGPYTFYVDVRPHNYHEDE-IFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANTN 125

Query: 140 RYVWIVDIASQILFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRM---KVDRLTT 196
            Y W VDI SQ+      ++ +S  +  +K+       +N   G +  +M   +V  L T
Sbjct: 126 TYSWTVDILSQLCVIPTPTLKYSFRIATTKKE-----TKNGSKGKKPVKMDGFEVKLLDT 180

Query: 197 ADLWNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEE----MLVV 252
           + LW  S   K  +  +  HLVI+THG+ SN+  D+ Y+K++IE+T N   E     +VV
Sbjct: 181 SSLW--SFPPK--YPNKPVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVV 236

Query: 253 KGFTDNVCKTEKGIKWLGTRLAEHIVHN---LYNDATV-KISFIGHSLGGLVQSFAIAYI 308
           +G   N+ K+  G+ +LG R+AE+I+     L     V KISFIGHSLGG  Q  A+ YI
Sbjct: 237 RGCMKNMGKSAHGVHYLGKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYI 296

Query: 309 SYNYPKFF---EQVEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQ---- 361
           S   P  F   + ++PVNFIT+ASP +G++ D  +Y+   L  G  G TG+DL+L+    
Sbjct: 297 SVKRPDIFHPTKGIKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPL 356

Query: 362 -TYNGL--------KQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFL 412
            + +GL         + +L+ +    AL  I + F   T+YAN  +DGIVPL T+ALL+L
Sbjct: 357 TSKDGLTTDGNAAKTKLILEIIPQPPAL-AIFERFVHRTLYANVVHDGIVPLRTAALLYL 415

Query: 413 DYDDI 417
           D++ +
Sbjct: 416 DWNSL 420

 Score =  102 bits (253), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 78/133 (58%), Gaps = 10/133 (7%)

Query: 458 TKIPVASMLDSAYSVLIPPLPDKSYITDPKTRK-DVVVHDKVYSGQDIPDHQSNSQLEVM 516
           T  P AS + +A SVL  PLP + YI +P+ R  D +VHDK+Y+ ++IP     ++  + 
Sbjct: 523 TAPPEASTMLAALSVLTAPLPSQEYIKNPEVRHHDAIVHDKIYTPKEIPRAHYANRPAI- 581

Query: 517 NSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAY 576
               V+    ++       + +E+IAR W   + WRKV++ +KPD+HNNI+ RRRF N Y
Sbjct: 582 --KKVIYPNESV------NRTQERIARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLY 633

Query: 577 GWPVVDHLTETHF 589
           G   V H+ E HF
Sbjct: 634 GDVAVSHMVEEHF 646

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  211 bits (538), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 149/425 (35%), Positives = 220/425 (51%), Gaps = 62/425 (14%)

Query: 34  IMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYV 93
           ++ H ++SL IG + RYI   D     E    +    L+L+ KN+E+  LR  YL GPY 
Sbjct: 8   LLVHEKNSLGIGGMCRYILQVDHKKLKE--DGIDTQELYLRFKNLESPLLRPVYLTGPYA 65

Query: 94  LYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKR----------YVW 143
            Y DVR  +Y  + + +I ++   F S+++P + F A+L   N   R          Y W
Sbjct: 66  FYIDVRPCNYD-EDKTYIGSEDVAFCSDLKPDEKFKAKLYF-NANSRLQTKNARDEIYSW 123

Query: 144 IVDIASQILFTKQASINFSITVG------GSKESISVDSARNIQLGVQSSRMKVDRLTTA 197
            +DI SQ+       + +S  VG         +   V S R + L +   +         
Sbjct: 124 TIDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKVTSVRGLSLKMWDEK--------- 174

Query: 198 DLWNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEM----LVVK 253
            LWN        +  +  HLVILTHG+ SNV  D+ Y+K++IE+T    EE     +VV+
Sbjct: 175 SLWNLP----PKYPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNPNVVVR 230

Query: 254 GFTDNVCKTEKGIKWLGTRLAEHIVHN---LYNDATV-KISFIGHSLGGLVQSFAIAYIS 309
           G  DN+ K+  GI +LG RLA+ +V     L  +  V KISFIGHSLGG  QS AI YIS
Sbjct: 231 GCMDNMGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYIS 290

Query: 310 YNYPKFFEQV---EPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSL------ 360
             YP FF  V   +P++FI +ASP +G++ D  +Y+   L MG  G TG+DL+L      
Sbjct: 291 VMYPDFFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLT 350

Query: 361 -----------QTYNGLKQPLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSAL 409
                      Q  + L + +L+ +    A +++ + F + T+YAN  +DGIVPL T+AL
Sbjct: 351 SNEGLSALTLAQENSHLPKNILEIIPQPPA-QQVFQLFMNRTLYANIVHDGIVPLRTAAL 409

Query: 410 LFLDY 414
           L+LD+
Sbjct: 410 LYLDW 414

 Score =  107 bits (266), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 75/127 (59%), Gaps = 9/127 (7%)

Query: 463 ASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSGQDIPDHQSNSQLEVMNSSNVL 522
           AS   SA S L  P+P + YI +PK RKD VVHD+VY  QD+P+      L+      V+
Sbjct: 521 ASTFMSALSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQH---YLKRSTMKRVV 577

Query: 523 LKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVD 582
               ++       +++E+IAR W  ++ WRKV++ ++PD+HNNI+ RRRF N YG   V 
Sbjct: 578 YPNESV------NRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVS 631

Query: 583 HLTETHF 589
           H+   HF
Sbjct: 632 HMVREHF 638

>Kwal_55.21703
          Length = 441

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 105/226 (46%), Gaps = 28/226 (12%)

Query: 215 EHLVILTHGL-----HSNVTSDLFYIKEQIEKTQNQHEEMLVVKGFTDNVCKTEKGIKWL 269
           +HL +L HGL     H N   D+F       +T + HE  L      +   KT  GI+ +
Sbjct: 4   KHLFVLVHGLWGNYKHMNAIRDVF------AETFHDHENTLFFSPRQNGYFKTFDGIEIM 57

Query: 270 GTR-LAE--HIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFIT 326
           G R L E    +         KISF+G+S+GGL+  F I  +     + F+ +EP  FIT
Sbjct: 58  GYRTLLELCRFIEQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLFIT 117

Query: 327 MASPMLGI--------VSDNAVYIQRLLAMG--IAGKTGQDLSLQTYNGLKQPLLQTLSS 376
            A+P LG+         S     ++ L A+G  I G+TG+ L +Q  +  +Q +L  LSS
Sbjct: 118 FATPHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQD-SLPEQSILVQLSS 176

Query: 377 SSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLN 422
              L  + + FK     AN  ND  V  YTS +   D D  LD  N
Sbjct: 177 GEYLHGLAR-FKHRLCVANVKNDRTVAFYTSFI--TDCDPFLDSEN 219

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 111/212 (52%), Gaps = 20/212 (9%)

Query: 214 KEHLVILTHGLHSN------VTSDLFYIKEQIEKTQNQHEEMLVVKGFTDNVCKTEKGIK 267
           K HLV+L HGL  N      + + L  + +     ++ +E ++V +   +   KT  GI 
Sbjct: 14  KIHLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGID 73

Query: 268 WLGTRLAEHI---VHNLYNDATVKISFIGHSLGGLVQSFAIA--YISYNYPKFFEQVEPV 322
             G R+++ I   +++  +D  VK S IG+SLGGL+  +A+   Y +  + K    +E V
Sbjct: 74  VCGIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKK--NDIELV 131

Query: 323 NFITMASPMLGIVSDN---AVYIQRLLAMGIAGKTGQDLSLQ-TYNGLKQPLLQTLSS-S 377
           NFIT  +P +G+++     AV +  ++   + G +G+ + L+  YNG   PLL  +SS S
Sbjct: 132 NFITFCTPHVGVLAPGNNVAVNLFNIIVPLVLGNSGKQMFLKDKYNGY--PLLYVMSSPS 189

Query: 378 SALRRILKCFKSCTVYANACNDGIVPLYTSAL 409
           S   + LK FK   +YAN  ND     +TS +
Sbjct: 190 SVFYKALKQFKYRALYANIINDKRTAWWTSGI 221

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 105/222 (47%), Gaps = 22/222 (9%)

Query: 215 EHLVILTHGLHSNVT--SDLFYIKEQIEKTQNQHEEMLVVKGFTDNVCKTEKGIKWLGTR 272
           +HL +L HGL  N T    +  I     K ++ +++M+      + + KT  GI+ +G R
Sbjct: 5   KHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNAMFKTFDGIEIIGYR 64

Query: 273 LAEHIVHNL--YNDATV-KISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMAS 329
               +   +  Y D  + K+S +G+S GGLV  F I  +   + + FE +EP  FITMA+
Sbjct: 65  TLIEVCEFIRDYKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQLFITMAT 124

Query: 330 PMLGIVSDNAVYIQ---------RLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSAL 380
           P LG+   N   I          R L   I GK+G+++ +   +     +L  LS    L
Sbjct: 125 PHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANSS---NNILVKLSQGEYL 181

Query: 381 RRILKCFKSCTVYANACNDGIVPLYTSALL----FLDYDDIL 418
              L  FK    +AN  ND  V  YT+ +     F+D+D+ L
Sbjct: 182 EA-LSLFKWRIAFANVKNDRTVAFYTAFITDCDPFIDFDNKL 222

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 106/212 (50%), Gaps = 23/212 (10%)

Query: 216 HLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEMLVVKGFTDNVC-KTEKGIKWLGTRLA 274
           HLV L HGL  NVT  + Y+   + + Q +  E LVV     N   +T  GI   G R+A
Sbjct: 5   HLVFLVHGLWGNVT-HMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRVA 63

Query: 275 EHIVH-----NLYNDATV--KISFIGHSLGGLVQSFAIAYISYNYPKFFEQ--VEPVNFI 325
           + I       N     TV  K S +G+S+GGL+  +A+  +  N  +FF++  ++ +NF 
Sbjct: 64  KEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSN--QFFKKQDIKLINFT 121

Query: 326 TMASPMLGIVSDN---AVYIQRLLAMGIAGKTGQDLSL----QTYNGLKQPLLQTLS-SS 377
           T  SP +G+++     AV +   +   I G +G+ + L    +  NG+  PL+  +S   
Sbjct: 122 TFCSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGM--PLIVLMSVGD 179

Query: 378 SALRRILKCFKSCTVYANACNDGIVPLYTSAL 409
           S   + L+ F+  ++YAN  ND     +TS +
Sbjct: 180 SIFYKALEQFQHRSLYANIVNDKRTAWWTSGI 211

>Kwal_27.10102
          Length = 258

 Score = 72.4 bits (176), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 114/221 (51%), Gaps = 20/221 (9%)

Query: 205 LSKSVFGRRKEHLVILTHGLHSNVTSDLFY----IKEQIEKTQN--QHEEMLVVKGFTDN 258
           L +   G++  HLV+L HGL  N  S L Y    +KE  E  ++    EE++V     + 
Sbjct: 4   LERGSTGKKPCHLVVLVHGLWGN-RSHLDYMSNALKESFESREDTCSKEELVVYTPHLNE 62

Query: 259 VCKTEKGIKWLGTRLAEHIVHNLYNDATV-KISFIGHSLGGLVQSFAIAYISYNYPKFFE 317
             KT  GI   G R+A  I   + +  +V K S  G+SLGGL+  +A+  +  +  + F+
Sbjct: 63  GYKTYDGIDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVL--HKRQLFK 120

Query: 318 Q--VEPVNFITMASPMLGIVSDN---AVYIQRLLAMGIAGKTGQDLSLQ---TYNGLKQP 369
           +  ++ VNF T  +P +G+ +     AV +   +   + G +G+ + L+    ++G + P
Sbjct: 121 KRDIQLVNFTTFCTPHVGVYAPGKNVAVRLYNAIVPLVLGSSGKQMFLKDKPKFSG-ELP 179

Query: 370 LLQTLS-SSSALRRILKCFKSCTVYANACNDGIVPLYTSAL 409
           L+ ++S  +S   + L+ F++ ++YAN  ND     +TS +
Sbjct: 180 LILSMSLENSIFYKALQEFQTKSLYANVINDKRTAWWTSGI 220

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 101/211 (47%), Gaps = 21/211 (9%)

Query: 213 RKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEMLVVKGFTDNVCKTEKGIKWLGTR 272
           +K+HL IL HGL  N    +  IKE +EKT +  +++++ K       KT  GI+ +   
Sbjct: 5   KKKHLFILVHGLWGN-HKHMNSIKEMLEKTLDDIDDIVIFKPENSGYLKTLHGIRVVSYN 63

Query: 273 LAEHIVHNLYNDATVK---ISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMAS 329
           + + I   + N    K   +S IG+S+GGLV  F I  +       F+ +EP+ F+T A+
Sbjct: 64  VLDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPMIFMTFAT 123

Query: 330 PMLGI----VSDNA-VYIQR------LLAMG--IAGKTGQDLSLQTYNGLKQPLLQTLSS 376
           P LG+     SD    Y+ R      L  +G  I G++G ++ +   +     +L  LS 
Sbjct: 124 PHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFISNKD---DRILVDLSQ 180

Query: 377 SSALRRILKCFKSCTVYANACNDGIVPLYTS 407
              L  + + F     +AN  ND  V  YTS
Sbjct: 181 GEYLYGLSR-FHHRVCFANVKNDRTVAFYTS 210

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 100/213 (46%), Gaps = 21/213 (9%)

Query: 216 HLVILTHGLHSNVTSDLFYIKEQIEKTQNQH-----------EEMLVVKGFTDNVCKTEK 264
           HLV+L HGL  N  S   YI   I+ +   H           EE++V     +   KT  
Sbjct: 10  HLVVLVHGLWGN-GSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNEGYKTYD 68

Query: 265 GIKWLGTRLAEHIVHNLYN-DATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQ-VEPV 322
           GI   G R+A+ I   +    + +K S +G+SLGGL+  +A+  I Y    F +  +E +
Sbjct: 69  GIDVCGLRVAKEIEDQIETLGSVIKFSLVGYSLGGLIARYALG-ILYKKQLFKKHDIELI 127

Query: 323 NFITMASPMLGIVSDN---AVYIQRLLAMGIAGKTGQDLSL--QTYNGLKQPLLQTLS-S 376
           NF T  +P +G+ +     AV +   +   + G +G+ + L  Q  +    PL+  +S  
Sbjct: 128 NFTTFCTPHVGVYAPGKNIAVNLFNTIVPFVLGNSGKQMFLKDQVRSAGNLPLVYLMSME 187

Query: 377 SSALRRILKCFKSCTVYANACNDGIVPLYTSAL 409
           +S   + L+ FK   +YAN  ND     +TS +
Sbjct: 188 NSVFYKALQEFKYKALYANVINDKRTAWWTSGI 220

>Scas_698.39
          Length = 471

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 119/259 (45%), Gaps = 29/259 (11%)

Query: 209 VFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEMLVVKGFT---DNVCKTEKG 265
           V  ++  HL IL HGL  N    +  +KE ++ +     + L +  F+   + + KT  G
Sbjct: 10  VSNQKDAHLFILLHGLWGNY-KHMESLKETLKNSIQDDTDRLPLVFFSPRQNAMFKTFDG 68

Query: 266 IKWLGTRLAEHIVH--NLYND-ATVKISFIGHSLGGLVQSFAIAYI-----SYNYPKFFE 317
           ++ +G R    I+    L+ +    K+S +G+S+GGL+  F I  +       +  K F+
Sbjct: 69  VEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDEDEMKVFK 128

Query: 318 QVEPVNFITMASPMLGIVSDNAVY---------IQRLLAMGIAGKTGQDLSLQTYNGLKQ 368
            +EP  FIT A+P LGI   N +          +  L+   I G +G+++ +     ++ 
Sbjct: 129 GMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFI-----MRN 183

Query: 369 PLLQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDL 428
             L  LSS   L  + K FK   V+AN  ND  V  YTS     D D  +D  N    + 
Sbjct: 184 TELVELSSGKYLDALSK-FKWRIVFANVKNDRTVAFYTS--FITDCDPFIDTGNDIKYNF 240

Query: 429 QTDFFQRNFISPLTKAMDI 447
           + +    N+ + L + +D+
Sbjct: 241 EENIPGENYTNILPRIVDL 259

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 107/233 (45%), Gaps = 24/233 (10%)

Query: 215 EHLVILTHGLHSNVTSDLFYIKEQIEKTQN-----QHEEMLVVKGFTDNVCKTEKGIKWL 269
           +HL +L HGL  N    +  +++ ++ T N     + ++ +      +   KT  GI+ +
Sbjct: 5   KHLFVLIHGLWGNY-KHMKSLEKVLDATLNGKKSGKDKDYVFFLPKQNATFKTFDGIEII 63

Query: 270 GTRLAEHIVHNL--YNDATV-KISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFIT 326
           G R    +   +  + D  + KISF+G+SLGGLV  F +  +       F  +E   F+T
Sbjct: 64  GYRTLLELCEFMKEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERCIFMT 123

Query: 327 MASPMLGIVSDNAV-YIQRLL------AMG--IAGKTGQDLSLQTYNGLKQPLLQTLSSS 377
           MA+P LGI   N + Y+ R L       +G  I GK+G++L +   +     +L  LS  
Sbjct: 124 MATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSS---NDILVRLSEG 180

Query: 378 SALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQT 430
             +   L+ F    ++AN  ND  V  +T      D D  L+  N    D ++
Sbjct: 181 KYI-EALEEFNHRILFANVKNDRTVAFFTG--FIADVDPFLESDNRIKFDFES 230

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 105/253 (41%), Gaps = 31/253 (12%)

Query: 214 KEHLVILTHGL---HSNVTSDLFYIKEQIEKTQNQHEEMLVVKGFTDNVCKTEKGIKWLG 270
           K+HL +L HGL   HS++ S    IK    +         V +  ++   KT  GI+ +G
Sbjct: 4   KKHLFVLVHGLWGTHSHMNS----IKTAFSEALGDDAVFYVPR--SNGYVKTLHGIELVG 57

Query: 271 TRLAEHIVHNLYNDATVK---ISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITM 327
            +    +   +      K   ISFIG+S+GGLV  F I  I       F  + PV F+T 
Sbjct: 58  YQTVVELTEFVQARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHMRPVLFMTF 117

Query: 328 ASPMLGI-------------VSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTL 374
           A+P LG+             V    + + R +     G++G+ L L   N      L  +
Sbjct: 118 ATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFLAYEN---DDTLVRM 174

Query: 375 SSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDFFQ 434
           +    L ++ + F+     AN  ND  V  YT+     D D  L+  N      +T    
Sbjct: 175 TEGVYLEQLAR-FRHRVCLANVKNDRTVAFYTA--FITDCDPFLETNNQLLYKFETALPT 231

Query: 435 RNFISPLTKAMDI 447
           ++ ++   + +D+
Sbjct: 232 QDDLAVCPRVIDL 244

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 101/234 (43%), Gaps = 24/234 (10%)

Query: 215 EHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEMLVVKGFTDNVCKTEKGIKWLGTR-- 272
           +HL +L HGL  N    +  IK    KT    E ++      +   KT  GI+ +G R  
Sbjct: 4   KHLFVLVHGLWGNY-KHMDSIKGVFSKTFGD-ENVIFFAPKQNGYFKTFDGIEIVGYRTL 61

Query: 273 --LAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNFITMASP 330
             L E I        T KISFIG+S+GGL+  F I  +     + FE +    FIT A+P
Sbjct: 62  LELCEFIRKYGVGKIT-KISFIGYSMGGLISRFIIGKMETECQELFEGINRQLFITFATP 120

Query: 331 MLGI----------VSDNAVYIQRLLAM---GIAGKTGQDLSLQTYNGLKQPLLQTLSSS 377
            LG+           + +  ++  +L+     + G++G+ L ++  +     L++ LSS 
Sbjct: 121 HLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWDSTLVK-LSSD 179

Query: 378 SALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTD 431
             L   L  FK     AN  ND  V  YTS     D D  +   N      +TD
Sbjct: 180 EYLLG-LSAFKYRICIANVKNDRTVAFYTS--FITDCDPFIQTQNQVHYSFETD 230

>CAGL0H09218g complement(904209..905048) similar to sp|P53078
           Saccharomyces cerevisiae YGL224c, hypothetical start
          Length = 279

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%)

Query: 68  LDSLWLKIKNIENVTLRAAYLMGPYVLYADVRTKDYHHKQRLFISADQPQFE 119
           +D LWL     +N  LR   L+G   L+  +   DY+H + L    D   FE
Sbjct: 154 IDKLWLFTNAYKNHALRCVRLLGIADLFDGITYCDYNHAESLICKPDPAAFE 205

>KLLA0B01243g complement(97985..99868) similar to sp|Q03722
           Saccharomyces cerevisiae YML020w hypothetical protein
           singleton, start by similarity
          Length = 627

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 65/165 (39%), Gaps = 25/165 (15%)

Query: 289 ISFIGHSLGGLVQSFAIAYISYNYPKFFEQ--VEPVNFITMASPMLGIVSDNAVYIQRLL 346
           + F+ HS G  V    +A       K  E   ++  N IT   P + I SD+   I  +L
Sbjct: 338 VYFVAHSQGCPVTIILLA-------KLIEAGIIDIDNIITSEDPPISIKSDDKKKIISIL 390

Query: 347 AM-----GIAGKTGQDLSLQTYNGLKQPLLQTLSS-----SSALRRILKCFKSCTV---- 392
           AM     G      Q   ++ Y+ ++   L+ L       S   ++ ++  + C      
Sbjct: 391 AMAGINNGPFYGADQTFFVKAYSAIESDSLKELFEFQNFYSVLSQKFIQSLRICIASNVK 450

Query: 393 --YANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDFFQR 435
             +  + ND +VPLY+S   F  + +I     ++ +     F  R
Sbjct: 451 IAFVGSINDQLVPLYSSTCQFAHHPNIFKATFVDKDSRTPAFITR 495

>Kwal_47.18512
          Length = 625

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 379 ALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDFFQR 435
           +LR I+      T +  + ND +VPLY+S  LF ++ +I     ++ +    DF  R
Sbjct: 438 SLRLIIASNVKVT-FVGSINDQLVPLYSSTCLFANHPNIFKATFIDKDSRTPDFITR 493

>Kwal_23.4740
          Length = 612

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 3/102 (2%)

Query: 331 MLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKSC 390
           M+ I+ D + Y+++     +  K        T N L Q +L+ ++     +  +K F+  
Sbjct: 1   MMFILPDRSPYVEQQALDHLTPKLNAMYGATTSNPLLQDVLRDVAQP---KNAVKAFRMY 57

Query: 391 TVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDF 432
             Y N      VP Y +  +   Y  I+D   +   D+ +D 
Sbjct: 58  NSYENPYASSAVPSYNTPQMGAGYGSIMDPGLLAANDIASDL 99

>Scas_641.5
          Length = 593

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 392 VYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQTDFFQR 435
            +  + ND +VPLY+S  LF D+ +I     ++   +   F  R
Sbjct: 418 TFVGSINDQLVPLYSSMCLFADHPNIFRTTFIDKASMTPSFIMR 461

>CAGL0G07062g complement(671395..673014) similar to sp|Q03722
           Saccharomyces cerevisiae YML020w, start by similarity
          Length = 539

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 371 LQTLSSSSALRRILKCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQT 430
           LQ+     +LR ++K     T +  + ND +VPLY+S  LF  + +I     ++      
Sbjct: 344 LQSKQFIESLRTLIKNNAKIT-FVGSINDQLVPLYSSTCLFAHHPNIFRATFVDKGSQTP 402

Query: 431 DFFQR 435
           DF  R
Sbjct: 403 DFITR 407

>YHR111W (UBA4) [2399] chr8 (333074..334396) Ubiquitin-activating
           enzyme that activates ubiquitin related protein, Urm1p
           [1323 bp, 440 aa]
          Length = 440

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 59/170 (34%), Gaps = 25/170 (14%)

Query: 281 LYNDATVKISFIGHSLGGLVQSFAIAYISYN-----YPKFFEQVEPVNFIT------MAS 329
           L +D  V +     S  GL     +  +++N     Y  F+    P N +T      +  
Sbjct: 173 LVSDVAVNLGITVVSASGLGTEGQLTILNFNNIGPCYRCFYPTPPPPNAVTSCQEGGVIG 232

Query: 330 PMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRILKCFKS 389
           P +G+V          L +GI         L  Y+G  Q  L+T        + L C K+
Sbjct: 233 PCIGLVGTMMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKMRGRQEKCLCCGKN 292

Query: 390 CTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNT----EDLQTDFFQR 435
            T+   A   G +          +Y+      N N     E +  D FQR
Sbjct: 293 RTITKEAIEKGEI----------NYELFCGARNYNVCEPDERISVDAFQR 332

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,902,809
Number of extensions: 966408
Number of successful extensions: 2942
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2906
Number of HSP's successfully gapped: 46
Length of query: 666
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 558
Effective length of database: 12,857,365
Effective search space: 7174409670
Effective search space used: 7174409670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)