Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14850g39639019510.0
ADL284C42236713370.0
Sklu_1484.339938013280.0
Kwal_23.346740039312871e-177
Scas_618.1340738712591e-173
YGL143C (MRF1)41337112541e-172
CAGL0E04928g40536711101e-151
YLR281C155821079e-06
AGR281C176371052e-05
Kwal_56.23313158661042e-05
Scas_590.1116401004e-05
KLLA0C04642g16840991e-04
Sklu_2044.512340961e-04
CAGL0F05027g18742964e-04
YOL114C20271710.55
CAGL0D00374g10340670.66
ADR347C41139701.1
KLLA0C07513g43943691.5
Scas_464.31211105691.7
YKL078W (DHR2)735110682.0
Kwal_14.2150169279673.2
KLLA0C02717g118623664.4
CAGL0K07480g56735638.5
Sklu_2442.201044124639.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14850g
         (390 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...   756   0.0  
ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH] (203883..20...   519   0.0  
Sklu_1484.3 YGL143C, Contig c1484 4090-5289                           516   0.0  
Kwal_23.3467                                                          500   e-177
Scas_618.13                                                           489   e-173
YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondr...   487   e-172
CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces c...   432   e-151
YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protei...    46   9e-06
AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)...    45   2e-05
Kwal_56.23313                                                          45   2e-05
Scas_590.1                                                             43   4e-05
KLLA0C04642g complement(427221..427727) some similarities with s...    43   1e-04
Sklu_2044.5 YLR281C, Contig c2044 6176-6547                            42   1e-04
CAGL0F05027g complement(512367..512930) similar to tr|Q05863 Sac...    42   4e-04
YOL114C (YOL114C) [4708] chr15 complement(103316..103924) Protei...    32   0.55 
CAGL0D00374g 45775..46086 no similarity, hypothetical start            30   0.66 
ADR347C [2088] [Homologous to NOHBY] (1317376..1318611) [1236 bp...    32   1.1  
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    31   1.5  
Scas_464.3                                                             31   1.7  
YKL078W (DHR2) [3183] chr11 (288490..290697) RNA helicase of DEA...    31   2.0  
Kwal_14.2150                                                           30   3.2  
KLLA0C02717g complement(242948..246508) weakly similar to sp|P38...    30   4.4  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...    29   8.5  
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      29   9.4  

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/390 (94%), Positives = 368/390 (94%)

Query: 1   MISKLFGRGKFFRNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSF 60
           MISKLFGRGKFFRNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSF
Sbjct: 1   MISKLFGRGKFFRNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSF 60

Query: 61  DLEKQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTG 120
           DLEKQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTG
Sbjct: 61  DLEKQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTG 120

Query: 121 DSLLNKLLPPHPFADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTE 180
           DSLLNKLLPPHPFADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTE
Sbjct: 121 DSLLNKLLPPHPFADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTE 180

Query: 181 NASGSGVLEAILNIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEE 240
           NASGSGVLEAILNIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEE
Sbjct: 181 NASGSGVLEAILNIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEE 240

Query: 241 SESDAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNK 300
           SESDAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNK
Sbjct: 241 SESDAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNK 300

Query: 301 AKAFAIXXXXXXXXXXXXXXXXXXXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLY 360
           AKAFAI                      DQVSTTDRSDKIRTYNYPQNRITDHRCGFTLY
Sbjct: 301 AKAFAILRARLAEKERLEKEEKERNARKDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLY 360

Query: 361 DIEGVMKGERLDDVIDAMDAFSSEQKAKQL 390
           DIEGVMKGERLDDVIDAMDAFSSEQKAKQL
Sbjct: 361 DIEGVMKGERLDDVIDAMDAFSSEQKAKQL 390

>ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH]
           (203883..205151) [1269 bp, 422 aa]
          Length = 422

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/367 (66%), Positives = 294/367 (80%)

Query: 24  SEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLSTIVDSYSKYRE 83
           S+A  FR LH SLI RA  Y  EL  LE LLS+G SFD+EKQK ++KLS+IVD++  Y++
Sbjct: 48  SQAEGFRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQD 107

Query: 84  EVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHPFADKPSILELR 143
            V+ Y+ELQ+++  D SLR EA+A++  L P L ++ D+LL+KLLPPHPFA+KP I+ELR
Sbjct: 108 NVHMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELR 167

Query: 144 PGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAILNIDEPGSYDKL 203
           PGVGG EAMIFTQDLLNMYI YA +H+WKW++ S TEN +G+G+ EAIL+IDEPGSYD++
Sbjct: 168 PGVGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRV 227

Query: 204 KFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESESDAYERTFKPDEIRIDVMRAS 263
           KFE+GVHRVQR+PATESKGRTHTSTAAV+VLPKM EE+ESDAYERTFKP EIRIDVMRAS
Sbjct: 228 KFESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRAS 287

Query: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAIXXXXXXXXXXXXXXXXX 323
           GKGGQHVNTTDSAVR+TH+PSGI I MQEERSQHRNKAKAF I                 
Sbjct: 288 GKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARE 347

Query: 324 XXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGERLDDVIDAMDAFSS 383
                DQVS+TDRSDKIRTYN+PQNR+TDHRC  +L+ +  V+ GERLD++ID+M  + S
Sbjct: 348 RSARKDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDS 407

Query: 384 EQKAKQL 390
           EQKAK L
Sbjct: 408 EQKAKLL 414

>Sklu_1484.3 YGL143C, Contig c1484 4090-5289
          Length = 399

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 313/380 (82%), Gaps = 2/380 (0%)

Query: 13  RNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLS 72
           R++   +RF ++EA+EF+ LH  LI RAE +V+EL +LE LLS+G SFD+E+QK FA+LS
Sbjct: 12  RSLWTSLRFQTTEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELS 71

Query: 73  TIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHP 132
           +IVD++  Y++ ++ YK+L+++++ DPSL +EA  ++  ++P L K+  SLLNKLLPPHP
Sbjct: 72  SIVDTFQNYKDGLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIKSSSSLLNKLLPPHP 131

Query: 133 FADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAIL 192
           FADKP ILELRPGVGG+EAMIF QDLL+MYINYA+  +WK+++ SK+EN SGSG+L+AIL
Sbjct: 132 FADKPCILELRPGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAIL 191

Query: 193 NIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEES--ESDAYERTF 250
           +IDEPGSY+KL+FEAGVHRVQR+PATE+KGRTHTSTAAVIVLP+MGEES  E+DAYERTF
Sbjct: 192 SIDEPGSYNKLRFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTF 251

Query: 251 KPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAIXXXX 310
           KPDEIRIDVMRA GKGGQHVNTTDSAVRLTH+PSGIVISMQ ERSQH+NKAKAFAI    
Sbjct: 252 KPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILRAK 311

Query: 311 XXXXXXXXXXXXXXXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGER 370
                              QV+TTDRSDKIRTYN+PQNRITDHRCGF L++I+GVM GER
Sbjct: 312 LAERERKEKEESARAARKGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGER 371

Query: 371 LDDVIDAMDAFSSEQKAKQL 390
           LDDVI+AM+ +    K+K+L
Sbjct: 372 LDDVIEAMERYEGATKSKEL 391

>Kwal_23.3467
          Length = 400

 Score =  500 bits (1287), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 246/393 (62%), Positives = 311/393 (79%), Gaps = 4/393 (1%)

Query: 1   MISKLFGRGKFFRNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGG-S 59
           M+ ++   G+F R   L +R  S+   EF+ LH  L+ RAE YV EL++LE+ +++GG S
Sbjct: 1   MLPRIAKSGRF-RLPKLSLRCYSNTDTEFKELHPLLLKRAEKYVEELQKLEEWMAKGGGS 59

Query: 60  FDLEKQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKT 119
           FD+E+QK F+KLS +VDS+  Y  EV+ +KELQ++++ DPSLR+EAE ++  + P L KT
Sbjct: 60  FDVERQKKFSKLSAVVDSFRIYSREVSTFKELQDMVKDDPSLRDEAELELVQIKPQLEKT 119

Query: 120 GDSLLNKLLPPHPFADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKT 179
             SLL +LLPPHPFAD+P ILE+RPGVGG EAMIF QDLLNMYIN+A+  +WK++LIS +
Sbjct: 120 ASSLLTQLLPPHPFADRPCILEIRPGVGGIEAMIFAQDLLNMYINFAHIKRWKYHLISSS 179

Query: 180 ENASGSGVLEAILNIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGE 239
           EN SGSG+++AIL+IDEPGSY+ L+FE+GVHRVQR+PATE+KGRTHTSTAAV+VLP+M E
Sbjct: 180 ENESGSGIVDAILSIDEPGSYEMLRFESGVHRVQRIPATETKGRTHTSTAAVVVLPQMAE 239

Query: 240 ES--ESDAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQH 297
           +S  E+D+YERTFKPDEIRIDVMRA GKGGQHVNTTDSAVRLTHYPSGIVI+MQ ERSQH
Sbjct: 240 DSEKEADSYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHYPSGIVINMQNERSQH 299

Query: 298 RNKAKAFAIXXXXXXXXXXXXXXXXXXXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGF 357
           +NKAKAFAI                       QV+TTDRSDKIRTYN+PQNR+TDHRCGF
Sbjct: 300 KNKAKAFAILRARLAEAERKEKEEKARALRKGQVTTTDRSDKIRTYNFPQNRVTDHRCGF 359

Query: 358 TLYDIEGVMKGERLDDVIDAMDAFSSEQKAKQL 390
            L+D+EG+M GERL+DVI AM  + S+ +AK+L
Sbjct: 360 NLHDMEGIMAGERLEDVISAMSVYDSDSRAKEL 392

>Scas_618.13
          Length = 407

 Score =  489 bits (1259), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/387 (59%), Positives = 298/387 (77%), Gaps = 7/387 (1%)

Query: 4   KLFGRGKFFRNVALQVRFNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLE 63
           ++F RG  F++       N    VE +P   +LIS+A  Y+ EL EL   LSQG +FD+ 
Sbjct: 23  QIFPRGNRFQSTIPSTASNGH--VELQP---ALISKATEYMKELAELNKQLSQGETFDVA 77

Query: 64  KQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSL 123
           +QK FA L++I D++  Y+ +++ YK LQE+ + DPSL+EEA+ ++  L+P L++T + L
Sbjct: 78  QQKRFAHLASIEDAFQTYQTQLSNYKSLQELAQSDPSLKEEAQLELTELVPQLSQTMNEL 137

Query: 124 LNKLLPPHPFADKPSILELRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENAS 183
            ++L+PPHPFADK  ILELRPGVGG+EAMIFTQDLLNMYI YA+ HKWK+ ++++ EN S
Sbjct: 138 QSRLIPPHPFADKACILELRPGVGGTEAMIFTQDLLNMYIGYAHSHKWKYRILAQDENES 197

Query: 184 GSGVLEAILNIDEPGSYDKLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESES 243
           G G+++AILNIDEPGSYDKL+FE+GVHRVQR+PATE+KGRTHTSTAAV+VLP+MG++S+ 
Sbjct: 198 GDGLVDAILNIDEPGSYDKLRFESGVHRVQRIPATETKGRTHTSTAAVVVLPQMGDDSDR 257

Query: 244 --DAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKA 301
             +AYERTFKPDEIRIDVMRA GKGGQHVNTTDSAVRLTH+P+GIV+SMQ+ERSQ +NKA
Sbjct: 258 AINAYERTFKPDEIRIDVMRARGKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKA 317

Query: 302 KAFAIXXXXXXXXXXXXXXXXXXXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYD 361
           KAF I                      +QV+TTDRSDKIRTYNYPQNR+TDHRCG TLY 
Sbjct: 318 KAFTILRARLAEREQKLKEEKERDARKEQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYA 377

Query: 362 IEGVMKGERLDDVIDAMDAFSSEQKAK 388
           ++ +MKGERL +VIDAM  F   ++A+
Sbjct: 378 LDAIMKGERLGEVIDAMRQFDDRERAR 404

>YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondrial
           peptide chain release factor, directs termination of
           translation in response to termination codons UAA and
           UAG [1242 bp, 413 aa]
          Length = 413

 Score =  487 bits (1254), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 232/371 (62%), Positives = 290/371 (78%), Gaps = 2/371 (0%)

Query: 22  NSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLSTIVDSYSKY 81
           N S   ++  L   L+ +AE Y  EL++L+  LS G  FD+ KQK++AKLS + D++ +Y
Sbjct: 39  NGSIPTQYTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEY 98

Query: 82  REEVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHPFADKPSILE 141
           +E++N+ K LQE++  DPSLR EAE + A L+P    T   L+NKLLPPHPFADKPS+LE
Sbjct: 99  KEKLNELKSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLE 158

Query: 142 LRPGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAILNIDEPGSYD 201
           LRPGVGG EAMIFTQ+LL+MYI YANY KWK+ +ISK EN SGSG+++AIL+I+E GSYD
Sbjct: 159 LRPGVGGIEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYD 218

Query: 202 KLKFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESES--DAYERTFKPDEIRIDV 259
           +L+FEAGVHRVQR+P+TE+KGRTHTSTAAV+VLP++G+ES    DAYERTFKP EIR+D+
Sbjct: 219 RLRFEAGVHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDI 278

Query: 260 MRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAIXXXXXXXXXXXXX 319
           MRASGKGGQHVNTTDSAVRLTH PSGIV+SMQ+ERSQH+NKAKAF I             
Sbjct: 279 MRASGKGGQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTILRARLAEKERLEK 338

Query: 320 XXXXXXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGERLDDVIDAMD 379
                     QVS+T+RSDKIRTYN+PQNRITDHRCGFTL D+ GV+ GERLD+VI+AM 
Sbjct: 339 EEKERKARKSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMS 398

Query: 380 AFSSEQKAKQL 390
            + S ++AK+L
Sbjct: 399 KYDSTERAKEL 409

>CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces
           cerevisiae YGL143c MRF1 peptide chain release factor,
           hypothetical start
          Length = 405

 Score =  432 bits (1110), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 212/367 (57%), Positives = 280/367 (76%), Gaps = 3/367 (0%)

Query: 25  EAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLSTIVDSYSKYREE 84
           EA+EF+ L+  L+ R      EL ELE  +S G  +D + Q+ +  L ++ D Y +Y+E+
Sbjct: 35  EALEFQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRKYNSLMSLQDVYDRYKEQ 92

Query: 85  VNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHPFADKPSILELRP 144
           +  Y+EL+E++++D SL EEA A++  L+P+L KT   LL++L+PPHPFA+K  +LELRP
Sbjct: 93  LGNYRELKEMIDVDKSLAEEAAAELHELVPNLKKTTQDLLHRLIPPHPFAEKACMLELRP 152

Query: 145 GVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAILNIDEPGSYDKLK 204
           GVGGSEAMIF +DLLNMYI YA+  KWK +++S  EN +GSG+++A+L IDEPG+Y+ LK
Sbjct: 153 GVGGSEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILK 212

Query: 205 FEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESES-DAYERTFKPDEIRIDVMRAS 263
           +EAGVHRVQR+PATESKGRTHTSTAAV+VLP++G+E +  DA+ER+FKP+EIRIDV RAS
Sbjct: 213 YEAGVHRVQRIPATESKGRTHTSTAAVVVLPQLGDEGKDLDAFERSFKPEEIRIDVKRAS 272

Query: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAIXXXXXXXXXXXXXXXXX 323
           GKGGQHVNTT+SAVRLTH P+GI+I MQ+ERSQHRNKAKAF+I                 
Sbjct: 273 GKGGQHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSKLAELEQQQKAEKE 332

Query: 324 XXXXXDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGERLDDVIDAMDAFSS 383
                +QV+T DRSDKIRTYN+ QNRITDHRCG  LYD+EGV+ GERLDDVI+A+ +F  
Sbjct: 333 RQVRKEQVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDD 392

Query: 384 EQKAKQL 390
             +A+ +
Sbjct: 393 NIQAESI 399

>YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protein
           containing a peptidyl-tRNA hydrolase domain, which
           contain peptidyl-tRNA hydrolase activity [468 bp, 155
           aa]
          Length = 155

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 17/82 (20%)

Query: 227 STAAVIVL--------PKMGEESESDAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVR 278
           S+AAV+++        PK   E E+   E+               G GGQ +N  +S V+
Sbjct: 11  SSAAVLLIKKNKLPPRPKFTPEMEAQCTEKFLHG---------GRGPGGQKINKCNSKVQ 61

Query: 279 LTHYPSGIVISMQEERSQHRNK 300
           L H P+GIV+  QE RS+ +N+
Sbjct: 62  LRHEPTGIVVECQETRSREQNR 83

>AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)
           [531 bp, 176 aa]
          Length = 176

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNK 300
           G GGQ +N  +S V+L H PSGIVI  Q  RS+ +N+
Sbjct: 63  GPGGQKINKCNSKVQLRHVPSGIVIECQATRSREQNR 99

>Kwal_56.23313
          Length = 158

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 9/66 (13%)

Query: 235 PKMGEESESDAYERTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISMQEER 294
           PK  +E E+D  E+               G GGQ +N  +S V+L H P+GIV+  QE R
Sbjct: 29  PKFLQEMEADIEEKFLHG---------GRGPGGQKINKCNSKVQLRHLPTGIVVECQETR 79

Query: 295 SQHRNK 300
           S+ +N+
Sbjct: 80  SRDQNR 85

>Scas_590.1
          Length = 116

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKA 303
           G GGQ +N  +S V+L H P+GI++S QE RS+ +N+  A
Sbjct: 3   GAGGQKINKCNSKVQLKHVPTGIIVSCQETRSRDQNRKLA 42

>KLLA0C04642g complement(427221..427727) some similarities with
           sgd|S0004271 Saccharomyces cerevisiae YLR281c,
           hypothetical start
          Length = 168

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKA 303
           G GGQ +N  +S V+L H P+GIV+  Q  RS+ +N+  A
Sbjct: 58  GPGGQKINKCNSKVQLRHVPTGIVVDCQATRSRDQNRKIA 97

>Sklu_2044.5 YLR281C, Contig c2044 6176-6547
          Length = 123

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/40 (47%), Positives = 27/40 (67%)

Query: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKA 303
           G GGQ +N  +S V+L H P+GIV+  QE RS+ +N+  A
Sbjct: 15  GPGGQKINKCNSKVQLKHLPTGIVVECQETRSRDQNRTIA 54

>CAGL0F05027g complement(512367..512930) similar to tr|Q05863
           Saccharomyces cerevisiae YLR281c, hypothetical start
          Length = 187

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 262 ASGKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKA 303
            +G GGQ +N  +S V++ H PS IV++ Q  RS+ +N+  A
Sbjct: 59  GTGPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNRKIA 100

>YOL114C (YOL114C) [4708] chr15 complement(103316..103924) Protein
           with similarity to human DS-1 protein [609 bp, 202 aa]
          Length = 202

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 28/71 (39%), Gaps = 27/71 (38%)

Query: 261 RASGKGGQHVNTTDSAVRLT------------------------HYPSG---IVISMQEE 293
           RASG GGQ+VN  +S   LT                        +Y  G   IVI   E 
Sbjct: 75  RASGPGGQNVNKVNSKCTLTLSGLSNCAWIPQEVRNILSSGRFRYYAKGSDSIVIQSDET 134

Query: 294 RSQHRNKAKAF 304
           RS+  NK K F
Sbjct: 135 RSRETNKLKCF 145

>CAGL0D00374g 45775..46086 no similarity, hypothetical start
          Length = 103

 Score = 30.4 bits (67), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 29  FRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNF 68
           +R  H S  ++ ELY +E  +L+ +L+QG +  L ++KN 
Sbjct: 63  YRVSHHSRATQKELYSDENEKLDVILTQGRTVSLNRRKNI 102

>ADR347C [2088] [Homologous to NOHBY] (1317376..1318611) [1236 bp,
           411 aa]
          Length = 411

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 85  VNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSL 123
           VN+ +E Q I  LD SL  E  ADIAA  P++   GDSL
Sbjct: 101 VNRRREAQPIYPLDASLIVEL-ADIAADYPEMVDAGDSL 138

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 248 RTFKPDEIRIDVMRASGKGGQHVNTTDSAVRLTHYPSGIVISM 290
           ++F+P    I  +   G+      + DSA+RLTH+PSG  +SM
Sbjct: 239 KSFQPHTQWIRSLHVHGEFVL-TGSNDSAIRLTHWPSGNGLSM 280

>Scas_464.3
          Length = 1211

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 17/105 (16%)

Query: 63   EKQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEA------EADIAALLPDL 116
            E+ + F +++ I D YS+ RE+  +  E  ++  ++  + E+A      E +I  L   L
Sbjct: 1041 EEVRLFREITAITDKYSQIREQNEEAGEEDDLSSINDDVNEDAITNSAEEKEILELPGRL 1100

Query: 117  -----------NKTGDSLLNKLLPPHPFADKPSILELRPGVGGSE 150
                       N+ G S L  LLP  PF +    L  R G+G  E
Sbjct: 1101 IIVSQYFKEPQNRHGISFLFTLLPDEPFTETRKRLHERFGLGQKE 1145

>YKL078W (DHR2) [3183] chr11 (288490..290697) RNA helicase of DEAH
           box family, involved in ribosomal RNA maturation [2208
           bp, 735 aa]
          Length = 735

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 5/110 (4%)

Query: 53  LLSQGGSFDLEKQKNFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAAL 112
           L  +G  FD+++    A    IVD+  +   ++NQ +EL +IL   P  +EE +  +  +
Sbjct: 254 LFVEGRKFDVKQYYLKAPTDDIVDAVIRCCIQINQGEELGDILCFLPG-QEEIDKAVTIM 312

Query: 113 LPDLNKTGDSLLNKLLPPHP-FADKPSI---LELRPGVGGSEAMIFTQDL 158
                   D     L+ P+P +A  P++   L   P  G    ++F+ ++
Sbjct: 313 EKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVFAPIKGFKRKVVFSTNI 362

>Kwal_14.2150
          Length = 1692

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 24  SEAVEFRPLHSSLISRAEL-YVNELRELEDLLSQGGSFDLE----KQKNFAKLSTIVDSY 78
           S   EFR   S  I RA L + N  RE+E L+++G   DL     +Q+N +  STI D  
Sbjct: 456 SRMAEFRNRGS--IKRASLDHENSKREIEVLMAEGTKMDLRITELEQENHSLSSTISDLQ 513

Query: 79  SKYREEVNQYKELQEILEL 97
           +  +   ++ + LQ+ LE+
Sbjct: 514 NNVKTYKDENQALQKRLEI 532

>KLLA0C02717g complement(242948..246508) weakly similar to sp|P38717
           Saccharomyces cerevisiae YNL257c SIP3 SNF1P protein
           kinase interacting protein, start by similarity
          Length = 1186

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 18/23 (78%)

Query: 113 LPDLNKTGDSLLNKLLPPHPFAD 135
           L +LNK  DS++++LLPP P+ +
Sbjct: 63  LAELNKDEDSMIDRLLPPLPYLN 85

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score = 28.9 bits (63), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 354 RCGFTLYDIEGVMKGERLDDVIDAMDAFSSEQKAK 388
           R  FT YD EG+   E+ + V+D +D F ++ K+K
Sbjct: 429 RTFFTRYDYEGITT-EKANKVVDLLDKFVNDPKSK 462

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 28.9 bits (63), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 11  FFRNVALQVR-----FNSSEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQ 65
           FF+ +A  ++      +S EAV      S L    E Y+ +L  + ++ ++ G  D + Q
Sbjct: 50  FFKELAKAIKNKKTAASSLEAVAHIASESDLSPSVEPYIVQL--IPEICAKAGDKDKDTQ 107

Query: 66  K-------------NFAKLSTIVDSYSKYREEVNQYKELQEILELDPSLREEAEADIAAL 112
                         N A +  ++ + ++  EE N+++E   IL    +L + A+  +A  
Sbjct: 108 AVATKTLLAIVKSVNPAAVKVVLPALTQPLEETNKWQEKVSILAAISALVDAAKTQVALR 167

Query: 113 LPDL 116
           +P+L
Sbjct: 168 MPEL 171

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,764,359
Number of extensions: 489984
Number of successful extensions: 1438
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1422
Number of HSP's successfully gapped: 56
Length of query: 390
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 286
Effective length of database: 12,995,837
Effective search space: 3716809382
Effective search space used: 3716809382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)