Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14828g31030516300.0
ADL283W30630013470.0
Scas_613.13*31230513390.0
CAGL0H10318g30729413290.0
YDL108W (KIN28)30629713230.0
Kwal_23.347126025411691e-163
KLLA0D11990g3042965673e-71
Scas_568.9*3062925579e-70
CAGL0L12474g3022935533e-69
AGL242C3032975439e-68
KLLA0B09790g2952975376e-67
ADR058C2952975263e-65
YBR160W (CDC28)2983025238e-65
CAGL0H07535g2983015221e-64
Scas_721.462962995212e-64
Kwal_26.75524613024881e-57
Scas_610.76683424937e-57
AFR205C4572994819e-57
Kwal_27.118032462494544e-55
CAGL0I08349g6673274805e-55
AFR019W3592954583e-54
ABR177C7533304774e-54
Kwal_55.219006253324583e-52
Scas_721.1105203024482e-51
YBL016W (FUS3)3533084373e-51
KLLA0D10527g6453544515e-51
Kwal_17.26873623084356e-51
Kwal_27.119192092044229e-51
KLLA0E12177g4552924382e-50
CAGL0D02002g5532924371e-49
KLLA0E10527g3713174243e-49
Scas_710.283523074181e-48
CAGL0J00539g4882934252e-48
CAGL0L12650g5672924266e-48
Kwal_27.118305753104242e-47
CAGL0J04290g3573034042e-46
KLLA0F17006g4152934064e-46
KLLA0A02497g3623013991e-45
ACL191C3652953973e-45
Scas_683.63773013941e-44
ADR253W3803003931e-44
Scas_713.384323003962e-44
Kwal_14.14163653003912e-44
KLLA0F20053g4443003952e-44
Kwal_56.238414323003943e-44
Kwal_47.178683653003903e-44
CAGL0D01694g4323083901e-43
CAGL0L06820g3662933842e-43
KLLA0B11902g4952933912e-43
YGR040W (KSS1)3683033833e-43
Kwal_23.55765043003895e-43
Kwal_27.125594143163845e-43
CAGL0M11748g4473003857e-43
Scas_688.144793003842e-42
KLLA0D11814g5932833882e-42
Scas_623.113782943773e-42
YHR030C (SLT2)4842923807e-42
Scas_680.204822953799e-42
AGR048C4533003771e-41
AER232C5693023776e-41
Scas_667.184373143701e-40
AGL249C5812843751e-40
ADL315C4343273663e-40
CAGL0K04169g3983323644e-40
KLLA0B11946g4392993577e-39
YDL079C (MRK1)5013023292e-34
Scas_22.12482273064e-33
Scas_660.286233063162e-32
CAGL0M08910g6123043128e-32
YDR477W (SNF1)6333043065e-31
Scas_678.134622883025e-31
AEL230W6083042951e-29
Kwal_26.72766462812915e-29
YJL106W (IME2)6452972881e-28
KLLA0A03806g6022942872e-28
Kwal_47.182335982972863e-28
Scas_711.157272782821e-27
CAGL0G04455g7512142811e-27
AFR076W8202902784e-27
CAGL0E01683g3753062681e-26
KLLA0F02838g7551982713e-26
Scas_635.13783092575e-25
CAGL0J11638g7462152591e-24
Kwal_55.220013632582522e-24
KLLA0E07414g3653092513e-24
Scas_673.20*7582102536e-24
KLLA0E03487g6472202492e-23
YCL024W (KCC4)10372022502e-23
ADL168C3623122415e-23
CAGL0L07326g5063072421e-22
Scas_613.55173272412e-22
Scas_493.211172982422e-22
Scas_698.373473082362e-22
YDR507C (GIN4)11422082412e-22
CAGL0K02673g9151972413e-22
YDL101C (DUN1)5133242385e-22
YJL095W (BCK1)14781962395e-22
KLLA0F14190g13381962396e-22
YAR019C (CDC15)9741982387e-22
CAGL0K05709g11032052379e-22
CAGL0C05005g10761982379e-22
KLLA0F11143g8132852361e-21
Kwal_56.224766972172352e-21
AFR092W14231952342e-21
Scas_711.2515151972343e-21
Scas_648.173402252283e-21
ACR249C6432212323e-21
CAGL0I05896g7782212323e-21
ABR014W9711972324e-21
Kwal_26.735514461952324e-21
Kwal_47.180983743362284e-21
Scas_644.157262232315e-21
ADL102C3722482276e-21
ACL006W7082482306e-21
Kwal_23.35904993332297e-21
YJL141C (YAK1)8072242281e-20
KLLA0C06138g7082132271e-20
Scas_651.37932262272e-20
AFR696C11422062272e-20
Scas_618.84272102252e-20
KLLA0F13552g12672182263e-20
Kwal_0.964272012233e-20
Scas_713.79831982253e-20
AER223C9021982253e-20
Scas_700.546983272244e-20
Kwal_55.203267502682235e-20
KLLA0C04191g7971992235e-20
Kwal_33.139846492212226e-20
KLLA0E01584g4153272206e-20
KLLA0A05819g7042212227e-20
ABL011C7012612227e-20
CAGL0K01661g4822192218e-20
Scas_668.228932022228e-20
KLLA0C01650g11122052229e-20
Kwal_26.78619551972219e-20
CAGL0G02035g3392262152e-19
ABL034W14252192192e-19
YFR014C (CMK1)4462002172e-19
KLLA0B13607g9891972173e-19
CAGL0L03520g14471952183e-19
CAGL0I05192g3733482143e-19
CAGL0K12496g3602202143e-19
CAGL0K08514g14892192174e-19
ADR174C6711992164e-19
ADR204W3392232124e-19
KLLA0F23155g4272132145e-19
AFR377C7262252156e-19
Scas_707.315981582157e-19
Kwal_26.778812672132148e-19
CAGL0F04741g4422032129e-19
Kwal_33.131125052002121e-18
Kwal_26.87098292942131e-18
KLLA0C08525g15512012141e-18
YHL007C (STE20)9391972131e-18
Scas_616.1014611592131e-18
AEL284C4792172111e-18
Scas_700.348642132121e-18
YGL179C (TOS3)5602232112e-18
Kwal_26.76356912022112e-18
Kwal_26.89416612392112e-18
KLLA0E06413g11612772122e-18
Scas_718.906472922112e-18
CAGL0B02739g6762862112e-18
AFL188C4723142092e-18
Scas_477.57033332102e-18
Kwal_26.87967962182103e-18
KLLA0F16467g3402232063e-18
AAR009W4531992074e-18
KLLA0F11319g8432922084e-18
Scas_715.3411502192094e-18
KLLA0E04136g3732592064e-18
KLLA0B12716g7162022085e-18
CAGL0C02893g6492022085e-18
KLLA0E11979g6141962076e-18
KLLA0D07348g9091932077e-18
Kwal_23.632515422152077e-18
Kwal_55.217093402232038e-18
Scas_692.247182232068e-18
KLLA0C17160g8312472069e-18
CAGL0M10153g8671982051e-17
CAGL0M02233g7672082051e-17
Kwal_55.215458651962041e-17
Kwal_33.138317001682041e-17
CAGL0M09361g11443032042e-17
YBL105C (PKC1)11512192042e-17
Kwal_33.144347592082023e-17
Kwal_27.1058111542212033e-17
Kwal_33.141925772242013e-17
CAGL0M02299g8932122014e-17
KLLA0B13112g7302502014e-17
ABL028W7222022005e-17
ACR191C11492832015e-17
Scas_640.14*7282142005e-17
Scas_704.503693371976e-17
CAGL0E05720g3582071966e-17
CAGL0K12562g16821811998e-17
AEL118C6831471989e-17
ACR142W8372051981e-16
ACR119W9312101981e-16
AER264C14832581981e-16
CAGL0K10604g4461991961e-16
YIL035C (CKA1)3722631951e-16
Kwal_27.97638682031971e-16
YGL180W (ATG1)8972531971e-16
ADR313W5782881961e-16
CAGL0J03828g4672041951e-16
YDL025C6202081961e-16
Kwal_0.3074901961961e-16
Scas_690.133542031932e-16
Kwal_47.183076212321952e-16
KLLA0A06820g7721701943e-16
YFL033C (RIM15)17701671953e-16
CAGL0L07810g5961961943e-16
Kwal_26.87518483001943e-16
AFR335C10332171943e-16
KLLA0F08877g3211431903e-16
Scas_700.354392161924e-16
Kwal_56.240593532031904e-16
KLLA0A07403g8792191934e-16
YFL029C (CAK1)3682311905e-16
CAGL0I09504g5282061925e-16
KLLA0D03190g3722031905e-16
CAGL0G09020g3612031905e-16
Scas_598.67902161926e-16
YCR073C (SSK22)13312561926e-16
YHR102W (KIC1)10801961926e-16
Kwal_14.115915211571926e-16
Scas_201.1*2741901868e-16
Scas_720.9416833181918e-16
Scas_700.288961871918e-16
Scas_685.245152071909e-16
Kwal_14.12493442631889e-16
AER195C5041941891e-15
YCR008W (SAT4)6031991891e-15
CAGL0K07458g7042011891e-15
Scas_628.96211951881e-15
KLLA0F24618g5562351882e-15
Scas_651.198011451882e-15
Scas_660.209572231882e-15
KLLA0B02332g3612211852e-15
Kwal_27.97734062421862e-15
CAGL0L06006g9422751882e-15
CAGL0B01925g9441611872e-15
CAGL0L11550g10721971872e-15
CAGL0J03872g6612121872e-15
CAGL0F03707g6082281863e-15
KLLA0F09020g9281621873e-15
Scas_580.610151961873e-15
Scas_619.5*5102161853e-15
KLLA0C07535g6242521863e-15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14828g
         (305 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...   632   0.0  
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...   523   0.0  
Scas_613.13*                                                          520   0.0  
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...   516   0.0  
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...   514   0.0  
Kwal_23.3471                                                          454   e-163
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...   223   3e-71
Scas_568.9*                                                           219   9e-70
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...   217   3e-69
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...   213   9e-68
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...   211   6e-67
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...   207   3e-65
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...   206   8e-65
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...   205   1e-64
Scas_721.46                                                           205   2e-64
Kwal_26.7552                                                          192   1e-57
Scas_610.7                                                            194   7e-57
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...   189   9e-57
Kwal_27.11803                                                         179   4e-55
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...   189   5e-55
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...   181   3e-54
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...   188   4e-54
Kwal_55.21900                                                         181   3e-52
Scas_721.110                                                          177   2e-51
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...   172   3e-51
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...   178   5e-51
Kwal_17.2687                                                          172   6e-51
Kwal_27.11919                                                         167   9e-51
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...   173   2e-50
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...   172   1e-49
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...   167   3e-49
Scas_710.28                                                           165   1e-48
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   168   2e-48
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...   168   6e-48
Kwal_27.11830                                                         167   2e-47
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...   160   2e-46
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...   160   4e-46
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...   158   1e-45
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...   157   3e-45
Scas_683.6                                                            156   1e-44
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...   155   1e-44
Scas_713.38                                                           157   2e-44
Kwal_14.1416                                                          155   2e-44
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...   156   2e-44
Kwal_56.23841                                                         156   3e-44
Kwal_47.17868                                                         154   3e-44
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...   154   1e-43
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...   152   2e-43
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...   155   2e-43
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...   152   3e-43
Kwal_23.5576                                                          154   5e-43
Kwal_27.12559                                                         152   5e-43
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...   152   7e-43
Scas_688.14                                                           152   2e-42
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...   154   2e-42
Scas_623.11                                                           149   3e-42
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...   150   7e-42
Scas_680.20                                                           150   9e-42
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...   149   1e-41
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...   149   6e-41
Scas_667.18                                                           147   1e-40
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...   149   1e-40
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...   145   3e-40
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...   144   4e-40
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...   142   7e-39
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...   131   2e-34
Scas_22.1                                                             122   4e-33
Scas_660.28                                                           126   2e-32
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   124   8e-32
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   122   5e-31
Scas_678.13                                                           120   5e-31
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   118   1e-29
Kwal_26.7276                                                          116   5e-29
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...   115   1e-28
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   115   2e-28
Kwal_47.18233                                                         114   3e-28
Scas_711.15                                                           113   1e-27
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...   112   1e-27
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...   111   4e-27
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...   107   1e-26
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...   108   3e-26
Scas_635.1                                                            103   5e-25
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   104   1e-24
Kwal_55.22001                                                         101   2e-24
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...   101   3e-24
Scas_673.20*                                                          102   6e-24
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   100   2e-23
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   100   2e-23
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    97   5e-23
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    98   1e-22
Scas_613.5                                                             97   2e-22
Scas_493.2                                                             98   2e-22
Scas_698.37                                                            96   2e-22
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    97   2e-22
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    97   3e-22
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    96   5e-22
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    97   5e-22
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    97   6e-22
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    96   7e-22
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    96   9e-22
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    96   9e-22
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    96   1e-21
Kwal_56.22476                                                          95   2e-21
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    95   2e-21
Scas_711.25                                                            95   3e-21
Scas_648.17                                                            92   3e-21
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    94   3e-21
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    94   3e-21
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    94   4e-21
Kwal_26.7355                                                           94   4e-21
Kwal_47.18098                                                          92   4e-21
Scas_644.15                                                            94   5e-21
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    92   6e-21
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    93   6e-21
Kwal_23.3590                                                           93   7e-21
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    92   1e-20
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    92   1e-20
Scas_651.3                                                             92   2e-20
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    92   2e-20
Scas_618.8                                                             91   2e-20
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    92   3e-20
Kwal_0.96                                                              91   3e-20
Scas_713.7                                                             91   3e-20
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    91   3e-20
Scas_700.54                                                            91   4e-20
Kwal_55.20326                                                          91   5e-20
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    91   5e-20
Kwal_33.13984                                                          90   6e-20
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    89   6e-20
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    90   7e-20
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    90   7e-20
CAGL0K01661g complement(146952..148400) some similarities with t...    90   8e-20
Scas_668.22                                                            90   8e-20
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    90   9e-20
Kwal_26.7861                                                           90   9e-20
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    87   2e-19
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    89   2e-19
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    88   2e-19
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    88   3e-19
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    89   3e-19
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    87   3e-19
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    87   3e-19
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    88   4e-19
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    88   4e-19
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    86   4e-19
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    87   5e-19
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    87   6e-19
Scas_707.3                                                             87   7e-19
Kwal_26.7788                                                           87   8e-19
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    86   9e-19
Kwal_33.13112                                                          86   1e-18
Kwal_26.8709                                                           87   1e-18
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    87   1e-18
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    87   1e-18
Scas_616.10                                                            87   1e-18
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    86   1e-18
Scas_700.34                                                            86   1e-18
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    86   2e-18
Kwal_26.7635                                                           86   2e-18
Kwal_26.8941                                                           86   2e-18
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    86   2e-18
Scas_718.90                                                            86   2e-18
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    86   2e-18
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    85   2e-18
Scas_477.5                                                             86   2e-18
Kwal_26.8796                                                           86   3e-18
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    84   3e-18
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    84   4e-18
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    85   4e-18
Scas_715.34                                                            85   4e-18
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    84   4e-18
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    85   5e-18
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    85   5e-18
KLLA0E11979g complement(1060048..1061892) some similarities with...    84   6e-18
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    84   7e-18
Kwal_23.6325                                                           84   7e-18
Kwal_55.21709                                                          83   8e-18
Scas_692.24                                                            84   8e-18
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    84   9e-18
CAGL0M10153g complement(1010688..1013291) some similarities with...    84   1e-17
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    84   1e-17
Kwal_55.21545                                                          83   1e-17
Kwal_33.13831                                                          83   1e-17
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    83   2e-17
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    83   2e-17
Kwal_33.14434                                                          82   3e-17
Kwal_27.10581                                                          83   3e-17
Kwal_33.14192                                                          82   3e-17
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    82   4e-17
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    82   4e-17
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    82   5e-17
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    82   5e-17
Scas_640.14*                                                           82   5e-17
Scas_704.50                                                            80   6e-17
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    80   6e-17
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    81   8e-17
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    81   9e-17
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    81   1e-16
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    81   1e-16
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    81   1e-16
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    80   1e-16
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    80   1e-16
Kwal_27.9763                                                           80   1e-16
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    80   1e-16
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    80   1e-16
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    80   1e-16
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    80   1e-16
Kwal_0.307                                                             80   1e-16
Scas_690.13                                                            79   2e-16
Kwal_47.18307                                                          80   2e-16
KLLA0A06820g complement(615686..618004) some similarities with s...    79   3e-16
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    80   3e-16
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    79   3e-16
Kwal_26.8751                                                           79   3e-16
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    79   3e-16
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    78   3e-16
Scas_700.35                                                            79   4e-16
Kwal_56.24059                                                          78   4e-16
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    79   4e-16
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    78   5e-16
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    79   5e-16
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    78   5e-16
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    78   5e-16
Scas_598.6                                                             79   6e-16
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    79   6e-16
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    79   6e-16
Kwal_14.1159                                                           79   6e-16
Scas_201.1*                                                            76   8e-16
Scas_720.94                                                            78   8e-16
Scas_700.28                                                            78   8e-16
Scas_685.24                                                            78   9e-16
Kwal_14.1249                                                           77   9e-16
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    77   1e-15
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    77   1e-15
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    77   1e-15
Scas_628.9                                                             77   1e-15
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    77   2e-15
Scas_651.19                                                            77   2e-15
Scas_660.20                                                            77   2e-15
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    76   2e-15
Kwal_27.9773                                                           76   2e-15
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    77   2e-15
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    77   2e-15
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    77   2e-15
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    77   2e-15
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    76   3e-15
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    77   3e-15
Scas_580.6                                                             77   3e-15
Scas_619.5*                                                            76   3e-15
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    76   3e-15
Kwal_56.22788                                                          76   3e-15
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    76   3e-15
Scas_653.25                                                            76   4e-15
Scas_707.7                                                             75   4e-15
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    76   5e-15
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    75   5e-15
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    75   5e-15
Scas_721.124                                                           75   6e-15
Scas_689.25*                                                           75   6e-15
Kwal_56.24091                                                          74   7e-15
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    75   8e-15
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    75   8e-15
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    75   1e-14
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    74   1e-14
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    75   1e-14
Scas_703.5                                                             74   1e-14
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    74   1e-14
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    74   2e-14
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    73   2e-14
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    74   2e-14
Kwal_47.16761                                                          74   2e-14
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    74   3e-14
Scas_593.14d                                                           73   3e-14
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    74   3e-14
Scas_717.69                                                            73   3e-14
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    73   4e-14
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    72   4e-14
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    72   4e-14
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    73   4e-14
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    73   4e-14
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    73   5e-14
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    72   5e-14
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    72   5e-14
Scas_693.17                                                            73   5e-14
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    73   5e-14
Kwal_56.22693                                                          73   5e-14
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    73   5e-14
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    72   6e-14
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    72   7e-14
Scas_640.16                                                            72   7e-14
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    72   7e-14
KLLA0C03938g complement(358851..360632) some similarities with s...    72   1e-13
Scas_683.12                                                            71   1e-13
Kwal_47.17252                                                          72   1e-13
Kwal_33.13222                                                          67   1e-13
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    71   1e-13
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    71   1e-13
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    72   1e-13
Kwal_33.13846                                                          70   1e-13
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    71   2e-13
Kwal_23.5290                                                           71   2e-13
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    71   2e-13
Kwal_26.8703                                                           70   2e-13
Scas_675.2                                                             70   2e-13
CAGL0M08360g complement(833220..835520) some similarities with s...    71   2e-13
CAGL0M08404g complement(836791..838179) some similarities with s...    70   2e-13
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    70   3e-13
Kwal_14.1273                                                           70   3e-13
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    69   3e-13
Kwal_14.2497                                                           70   3e-13
Scas_689.24                                                            70   4e-13
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    70   4e-13
Scas_564.7                                                             70   4e-13
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    70   5e-13
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    70   5e-13
Scas_502.2                                                             70   5e-13
Kwal_56.24584                                                          69   5e-13
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    69   6e-13
Scas_627.7                                                             69   6e-13
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    69   6e-13
Scas_655.2                                                             69   6e-13
Scas_651.18                                                            68   8e-13
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    69   1e-12
Scas_678.24                                                            69   1e-12
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    69   1e-12
KLLA0B07205g complement(624606..625973) some similarities with s...    68   1e-12
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    68   2e-12
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    67   2e-12
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    68   3e-12
Scas_633.29                                                            67   3e-12
Kwal_23.5668                                                           67   4e-12
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    67   4e-12
Scas_582.1                                                             67   4e-12
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    67   5e-12
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    66   5e-12
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    67   5e-12
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    67   6e-12
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    66   7e-12
Scas_716.33                                                            66   7e-12
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    65   7e-12
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    65   8e-12
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    66   8e-12
KLLA0D12100g complement(1031728..1033161) some similarities with...    65   9e-12
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    65   1e-11
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    65   1e-11
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    65   1e-11
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    65   1e-11
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    65   1e-11
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    65   2e-11
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    65   2e-11
Scas_677.18                                                            65   2e-11
Kwal_56.23717                                                          65   2e-11
Scas_634.5                                                             65   2e-11
Scas_544.6                                                             64   2e-11
Scas_705.23                                                            64   2e-11
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    64   3e-11
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    63   3e-11
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    64   3e-11
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    64   4e-11
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    64   4e-11
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    64   4e-11
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    64   5e-11
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    64   5e-11
Kwal_23.3992                                                           63   6e-11
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    64   6e-11
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    63   7e-11
Scas_584.11                                                            63   7e-11
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    63   8e-11
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    63   8e-11
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    63   8e-11
Scas_568.13                                                            62   9e-11
Scas_336.1                                                             62   1e-10
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    62   1e-10
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    62   1e-10
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    62   1e-10
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    62   1e-10
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    62   1e-10
Scas_716.73                                                            62   2e-10
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    62   2e-10
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    62   2e-10
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    62   2e-10
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    62   2e-10
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    61   3e-10
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    61   3e-10
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    61   4e-10
Kwal_26.7682                                                           61   4e-10
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    60   4e-10
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    60   4e-10
Kwal_23.6458                                                           61   5e-10
Kwal_27.11777                                                          60   5e-10
KLLA0C16577g complement(1451181..1452695) some similarities with...    60   5e-10
Scas_721.61                                                            60   6e-10
Scas_643.20                                                            60   6e-10
Kwal_0.155                                                             60   6e-10
Scas_548.6                                                             60   7e-10
Kwal_55.20221                                                          60   8e-10
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    60   9e-10
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    59   9e-10
Kwal_33.14167                                                          60   1e-09
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    59   1e-09
Kwal_33.14554                                                          59   1e-09
Scas_707.34                                                            59   1e-09
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    59   1e-09
Kwal_26.7154                                                           59   2e-09
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    59   2e-09
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    59   2e-09
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    59   2e-09
Scas_713.21                                                            59   2e-09
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    59   2e-09
Scas_629.16                                                            59   2e-09
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    59   2e-09
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    59   2e-09
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    58   3e-09
Scas_721.132                                                           58   3e-09
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    58   4e-09
Kwal_23.4276                                                           57   4e-09
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    58   4e-09
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    57   4e-09
Kwal_33.14081                                                          57   6e-09
Kwal_33.13681                                                          57   7e-09
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    57   7e-09
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    57   8e-09
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    56   1e-08
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    56   1e-08
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    56   1e-08
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    56   2e-08
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    56   2e-08
Kwal_55.20189                                                          55   2e-08
Scas_584.8                                                             55   2e-08
Kwal_47.17263                                                          55   2e-08
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    55   2e-08
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    55   2e-08
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    55   2e-08
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    55   2e-08
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    55   3e-08
KLLA0D09328g complement(788565..791705) some similarities with s...    55   3e-08
Scas_654.12                                                            55   3e-08
Scas_602.11                                                            55   4e-08
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    54   7e-08
Scas_695.33                                                            54   7e-08
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    54   8e-08
Scas_707.36                                                            54   9e-08
Scas_618.15                                                            53   1e-07
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    53   1e-07
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    53   1e-07
Scas_720.103                                                           53   1e-07
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    53   2e-07
Scas_673.34*                                                           53   2e-07
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    52   2e-07
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    52   2e-07
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    52   2e-07
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    52   2e-07
Scas_703.47                                                            52   3e-07
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    51   4e-07
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    51   4e-07
Scas_601.6                                                             50   9e-07
Scas_671.16                                                            50   1e-06
Kwal_47.17345                                                          50   1e-06
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    50   1e-06
Scas_697.12                                                            49   2e-06
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    49   2e-06
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    49   3e-06
Scas_573.10                                                            49   3e-06
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    49   4e-06
Scas_718.72                                                            48   4e-06
Kwal_27.10004                                                          48   5e-06
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    48   6e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    48   8e-06
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    47   8e-06
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    47   1e-05
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    47   1e-05
KLLA0F22297g complement(2083448..2085547) some similarities with...    47   1e-05
Kwal_27.9804                                                           47   1e-05
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    47   1e-05
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    47   1e-05
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    47   1e-05
Scas_684.28                                                            47   2e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    46   2e-05
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    46   2e-05
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    46   3e-05
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    45   5e-05
Kwal_33.14596                                                          45   6e-05
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...    44   7e-05
Kwal_56.24064                                                          44   8e-05
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    45   8e-05
Scas_654.17                                                            44   9e-05
Scas_649.30                                                            44   1e-04
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    44   1e-04
Scas_720.24                                                            44   1e-04
Kwal_56.24274                                                          44   1e-04
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    44   1e-04
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...    44   1e-04
Scas_690.12                                                            43   2e-04
Scas_661.27                                                            44   2e-04
Kwal_27.10945                                                          43   2e-04
Kwal_26.9032                                                           43   2e-04
Scas_653.33                                                            42   3e-04
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    42   3e-04
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    42   4e-04
KLLA0C07216g 626227..628278 similar to sp|Q03656 Saccharomyces c...    42   4e-04

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKF 60
           MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKF
Sbjct: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKF 60

Query: 61  LQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           LQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV
Sbjct: 61  LQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
           HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF
Sbjct: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
           GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN
Sbjct: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
           YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT
Sbjct: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300

Query: 301 LPQDL 305
           LPQDL
Sbjct: 301 LPQDL 305

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/300 (80%), Positives = 274/300 (91%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK 65
           T  +YTKEKK GEGTYAVVYLG +++ GR IA+KEIKTSQFKDGLDMSA+REVK+LQE++
Sbjct: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61

Query: 66  HVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
           H NVIELVD+FMA +NLNLVLEFLPADLE++IKD+S++F+ ADIKSW+LMTLRGVHHCHR
Sbjct: 62  HANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121

Query: 126 NFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHY 185
           +FILHRDLKPNNLLLAPDGQLKIADFGLAR +A+P E +TSNVVTRWYRAPELLFGA+HY
Sbjct: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181

Query: 186 TSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQ 245
           T+AVD+WSVGVIFAELMLRIPYLPG+DDVDQI+VTFRALGTPTD DWPEVSSFS YNKIQ
Sbjct: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQ 241

Query: 246 IYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPTLPQDL 305
           +YPPPSR ELR RFIAATENAL+L+ GM+ M+P KRWD  +CL SQYF ELPE T P +L
Sbjct: 242 VYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTEL 301

>Scas_613.13*
          Length = 312

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/305 (77%), Positives = 279/305 (91%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKF 60
           +T   T  +YTK KK GEGTYAVVYLGTK+STGR IAVKEIKTS+FKDGLDMSA+REVK+
Sbjct: 5   ITTPITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKY 64

Query: 61  LQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           LQE++H NVIELVD+FMA DNLNLVLEFLP+DLE+IIKD SI+F+PADIKSW+LMTLRGV
Sbjct: 65  LQEIQHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGV 124

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
           HHCHRNFILHRDLKPNNLLL+PDG +K+ADFGLAR + SP E+LTSNVVTRWYRAPELLF
Sbjct: 125 HHCHRNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLF 184

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
           GAKHYTSA+DIWSVGVIFAELMLRIPYLPG++D+DQ+ VTFRALGTPTD +WPEVSSF +
Sbjct: 185 GAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGS 244

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
           YNK+QIYPPPS +ELR+RFIAA+ENAL  + GM+ MNPKKRW+A++CL+S+YF+E+P P+
Sbjct: 245 YNKLQIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPS 304

Query: 301 LPQDL 305
            P ++
Sbjct: 305 DPSEI 309

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/294 (77%), Positives = 274/294 (93%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           +YTKEKK GEGTYAVVY+GTK+STGR IAVKEIKTS+FKDGLDMSA+REVK+LQE++HVN
Sbjct: 5   EYTKEKKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKDGLDMSAIREVKYLQEMQHVN 64

Query: 69  VIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           VIELVD+FM+  NLNLVLE+LP DLE++IKD SI+F+PADIKSW+LM++RGVHHCHRNFI
Sbjct: 65  VIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCHRNFI 124

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           LHRDLKPNNLL+APDGQ+K+ADFGLAR + SP E+LTSNVVTRWYRAPELLFGAKHYTSA
Sbjct: 125 LHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVLTSNVVTRWYRAPELLFGAKHYTSA 184

Query: 189 VDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYP 248
           +D+WS+GVIFAELMLRIPYLPG++D++Q+ VTFRALGTPTD DWPEVSSF++YNK+Q+YP
Sbjct: 185 IDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFRALGTPTDKDWPEVSSFNSYNKLQMYP 244

Query: 249 PPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPTLP 302
           PPSR+ELR+RFIAATENAL  ++GMM +NP KRW   +CL+S+YF+ELP P+ P
Sbjct: 245 PPSRDELRKRFIAATENALNFMNGMMCLNPAKRWSTAQCLESEYFKELPRPSDP 298

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 232/297 (78%), Positives = 271/297 (91%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           +YTKEKK GEGTYAVVYLG + STGR IA+KEIKTS+FKDGLDMSA+REVK+LQE++H N
Sbjct: 6   EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPN 65

Query: 69  VIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           VIEL+D+FMA DNLNLVLEFLP DLE++IKD SI+F+PADIK+W+LMTLRGV+HCHRNFI
Sbjct: 66  VIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFI 125

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           LHRDLKPNNLL +PDGQ+K+ADFGLAR + +P EILTSNVVTRWYRAPELLFGAKHYTSA
Sbjct: 126 LHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSA 185

Query: 189 VDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYP 248
           +DIWSVGVIFAELMLRIPYLPG++DVDQ+ VTFRALGTPTD DWPEVSSF  YNK+QIYP
Sbjct: 186 IDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYP 245

Query: 249 PPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPTLPQDL 305
           PPSR+ELR+RFIAA+E AL+ + GM+ MNP+KRW AV+CL+S YF+ELP P+ P  +
Sbjct: 246 PPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPSSI 302

>Kwal_23.3471
          Length = 260

 Score =  454 bits (1169), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 233/254 (91%)

Query: 52  MSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKS 111
           MSA+REVK+LQE++HVNVIEL+DV+MA  NLNLVLEFLPADLE+IIKD SI+F+ ADIKS
Sbjct: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60

Query: 112 WILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR 171
           W+LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLK+ADFGLAR M SPQ++LTSNVVTR
Sbjct: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120

Query: 172 WYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDAD 231
           WYRAPELLFGAKHYT A+D+WSVGVIFAELMLRIPYLPGKDD+DQI+VTFRALGTPTD D
Sbjct: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180

Query: 232 WPEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQ 291
           WPE+S+F  YNKIQ YPPPSREE+RRRFIAATENAL L+ GM+ MNP KRWD ++CL S+
Sbjct: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240

Query: 292 YFQELPEPTLPQDL 305
           YF ELP PT P +L
Sbjct: 241 YFVELPVPTTPSEL 254

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score =  223 bits (567), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 173/296 (58%), Gaps = 13/296 (4%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           + + +K G GTYA VY G  K+TG  +A+KE+K    ++G   +A+RE+  ++ELKH N+
Sbjct: 7   FKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKELKHDNI 65

Query: 70  IELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPAD-----IKSWILMTLRGVHHCH 124
           + L DV    + L LV EF+  DL+  + + +   S        +K +    L+GV  CH
Sbjct: 66  VRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAFCH 125

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
            N ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRAP++L G+++
Sbjct: 126 ENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRN 185

Query: 185 YTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKI 244
           Y +++DIWS G I AE+++  P  PG +D +Q+ + F  +GTP +  WP+V+  + YN  
Sbjct: 186 YCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTMGTPVEQTWPQVTQLAKYNP- 244

Query: 245 QIYPPPSREELRRRFIAATE-----NALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
            + PP    +L++     TE     N ++L+ G++ +NP  R  A   L   +F E
Sbjct: 245 -LLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDARLSAKDALNHPWFAE 299

>Scas_568.9*
          Length = 306

 Score =  219 bits (557), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 169/292 (57%), Gaps = 13/292 (4%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           +K G GTYA VY G  K+TG  +A+KE+K    ++G   +A+RE+  ++ELKH N++ L 
Sbjct: 6   EKLGNGTYATVYKGLNKTTGAYVALKEVKLDS-EEGTPSTAIREISLMKELKHENIVRLY 64

Query: 74  DVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPAD-----IKSWILMTLRGVHHCHRNFI 128
           DV    + L LV E++  DL+  +   ++  SP       +K +    L G+  CH N I
Sbjct: 65  DVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLAFCHENKI 124

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           LHRDLKP NLL+   G LK+ DFGLAR    P    +S VVT WYRAP++L G++ Y+++
Sbjct: 125 LHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTS 184

Query: 189 VDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYP 248
           +DIWS G I AE++   P  PG +D +Q+ + F  +GTPT+A WP VS+   YN    +P
Sbjct: 185 IDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTPTEATWPGVSALPKYNP--NFP 242

Query: 249 PPSREELRRRFIAAT-----ENALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
               ++LR            +N ++L+ G++ +NP  R  A + L   +F E
Sbjct: 243 QRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRLSAKQALHHPWFAE 294

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score =  217 bits (553), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 169/293 (57%), Gaps = 9/293 (3%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           +K G GTYA VY G  KSTG  +A+KE+K    ++G   +A+RE+  ++ELKH N++ L 
Sbjct: 10  EKLGNGTYATVYKGLNKSTGVYVALKEVKLDS-EEGTPSTAIREISLMKELKHDNIVRLY 68

Query: 74  DVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPAD-----IKSWILMTLRGVHHCHRNFI 128
           DV    + L LV E++  DL+  +   ++  +P       +K +    L G+  CH N I
Sbjct: 69  DVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAFCHENKI 128

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           LHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRAP++L G++ Y+++
Sbjct: 129 LHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTS 188

Query: 189 VDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNK--IQI 246
           +DIWS G I AE++   P  PG +D +Q+ + F  +GTP +  WP V+S   YN    Q 
Sbjct: 189 IDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDKMGTPNETTWPGVTSLPKYNPNFQQR 248

Query: 247 YPPPSREELRRRFIAA-TENALELISGMMIMNPKKRWDAVKCLQSQYFQELPE 298
            P   + EL+        +N ++L+ G++ +NP  R  A + L   +F E  E
Sbjct: 249 LPKDLKAELQPYVKEPLDDNVIDLLHGLLQLNPDMRLSAKQALLHPWFSEYYE 301

>AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH]
           (246896..247790,247838..247854) [912 bp, 303 aa]
          Length = 303

 Score =  213 bits (543), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 172/297 (57%), Gaps = 15/297 (5%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           + + ++ G GTYA VY G  K+TG  +A+KE+K    ++G   +A+RE+  ++ELKH N+
Sbjct: 9   FKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDS-EEGTPSTAIREISLMKELKHENI 67

Query: 70  IELVDVFMANDNLNLVLEFLPADLEIII-----KDTSIMFSPADIKSWILMTLRGVHHCH 124
           + L DV    + L LV EF+  DL+  +     ++       + +K +    L+GV  CH
Sbjct: 68  VRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLLQGVAFCH 127

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
            N ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRAP++L G++ 
Sbjct: 128 ENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRT 187

Query: 185 YTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYN-K 243
           Y +++DIWS G I AE+++     PG +D +Q+ + F  +GTPT+  W  VS    YN +
Sbjct: 188 YCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTPTEQTWVGVSQLPKYNPQ 247

Query: 244 IQIYPPPSREELRRRFIAATENALE-----LISGMMIMNPKKRWDAVKCLQSQYFQE 295
           I +YP    +++++   A T+  +      LI G++ +NP  R  A + L    F+E
Sbjct: 248 IPLYP---NKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLSAQQALSHPLFEE 301

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score =  211 bits (537), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 170/297 (57%), Gaps = 10/297 (3%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTK-KSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQE 63
           S + +Y + +K GEGTY VVY     +   R +A+K+I+     +G+  +A+RE+  L+E
Sbjct: 2   SELTNYKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKE 61

Query: 64  LKHVNVIELVDVFMANDN-LNLVLEFLPADL----EIIIKDTSIMFSPADIKSWILMTLR 118
           LK  N++ L D+  ++ + L LV EFL  DL    E I KD  +      IK +++   +
Sbjct: 62  LKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPL--GGNIIKKFMMQLCK 119

Query: 119 GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
           G+ +CH + I+HRDLKP NLL+  DG LK+ DFGLAR    P    T  +VT WYRAPE+
Sbjct: 120 GIAYCHAHRIIHRDLKPQNLLINRDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEV 179

Query: 179 LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSF 238
           L G K Y++ VD+WS+G IFAE+  R P   G  ++DQI   FR LGTP +  WP++   
Sbjct: 180 LLGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRVLGTPNERTWPDIIYL 239

Query: 239 SNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
            ++     +P  +R  L     +   N ++L+  ++  +P  R  A + +Q  YF+E
Sbjct: 240 PDFK--TTFPKWNRRNLSEVIPSLDANGIDLLDKLITYDPIHRISAKRAVQHPYFKE 294

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score =  207 bits (526), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 172/297 (57%), Gaps = 10/297 (3%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTG-RSIAVKEIKTSQFKDGLDMSALREVKFLQE 63
           S + +Y + +K GEGTY VVY       G R +A+K+I+     +G+  +A+RE+  L+E
Sbjct: 2   SDLTNYKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKE 61

Query: 64  LKHVNVIELVDVFMANDN-LNLVLEFLPADL----EIIIKDTSIMFSPADIKSWILMTLR 118
           LK  N++ L D+  ++ + L LV EFL  DL    E + KD  +      IK +++   +
Sbjct: 62  LKDDNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPL--GDKIIKKFMMQLCK 119

Query: 119 GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
           G+ +CH + I+HRDLKP NLL+  +G LK+ DFGLAR    P    T  +VT WYRAPE+
Sbjct: 120 GIAYCHAHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEV 179

Query: 179 LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSF 238
           L G K Y++ VD+WS+G IFAE+  R P   G  ++DQI   FR LGTP ++ WP++   
Sbjct: 180 LLGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRLLGTPNESVWPDIVYL 239

Query: 239 SNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
            ++     +P   R +L +   +  E+ L+L+  ++  +P  R  A + +   YF++
Sbjct: 240 PDFK--PTFPKWQRRDLAQVVPSLNEHGLDLLDKLVTYDPIHRISAKRAVTHPYFKD 294

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score =  206 bits (523), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 173/302 (57%), Gaps = 14/302 (4%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVY--LGTKKSTG-RSIAVKEIKTSQFKDGLDMSALREVK 59
           +   + +Y + +K GEGTY VVY  L  +   G R +A+K+I+     +G+  +A+RE+ 
Sbjct: 1   MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS 60

Query: 60  FLQELKHVNVIELVDVFMANDN-LNLVLEFLPADL----EIIIKDTSIMFSPADI-KSWI 113
            L+ELK  N++ L D+  ++ + L LV EFL  DL    E I KD  +    ADI K ++
Sbjct: 61  LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPL---GADIVKKFM 117

Query: 114 LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWY 173
           +   +G+ +CH + ILHRDLKP NLL+  DG LK+ DFGLAR    P    T  +VT WY
Sbjct: 118 MQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWY 177

Query: 174 RAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWP 233
           RAPE+L G K Y++ VD WS+G IFAE+  R P   G  ++DQI   FR LGTP +A WP
Sbjct: 178 RAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWP 237

Query: 234 EVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
           ++    ++     +P   R++L +   +     ++L+  ++  +P  R  A +     YF
Sbjct: 238 DIVYLPDFKP--SFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYF 295

Query: 294 QE 295
           QE
Sbjct: 296 QE 297

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score =  205 bits (522), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 174/301 (57%), Gaps = 12/301 (3%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVY--LGTKKSTG-RSIAVKEIKTSQFKDGLDMSALREVK 59
           + S + +Y + +K GEGTY VVY  L  +   G R +A+K+I+     +G+  +A+RE+ 
Sbjct: 1   MSSELANYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREIS 60

Query: 60  FLQELKHVNVIELVDVFMANDN-LNLVLEFLPADL----EIIIKDTSIMFSPADIKSWIL 114
            L+ELK  N++ L D+  ++ + L LVLEFL  DL    E I KD  +  +   IK +++
Sbjct: 61  LLKELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNI--IKKFMV 118

Query: 115 MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYR 174
              +G+ +CH + ILHRDLKP NLL+  +G LK+ DFGLAR    P    T  +VT WYR
Sbjct: 119 QLCKGIAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYR 178

Query: 175 APELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPE 234
           APE+L G K Y++ VD WS+G IFAE+  R P   G  ++DQI   FR LGTP++A WP+
Sbjct: 179 APEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTPSEAVWPD 238

Query: 235 VSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
           +    ++     +P   R++L     +   + ++L+  ++  +P  R  A +     YF 
Sbjct: 239 IVYLPDFKP--SFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPINRISARRAANHPYFH 296

Query: 295 E 295
           E
Sbjct: 297 E 297

>Scas_721.46
          Length = 296

 Score =  205 bits (521), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 171/299 (57%), Gaps = 10/299 (3%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTG-RSIAVKEIKTSQFKDGLDMSALREVKFL 61
           +   + +Y + +K GEGTY VVY       G R +A+K+I+     +G+  +A+RE+  L
Sbjct: 1   MSGELANYKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLL 60

Query: 62  QELKHVNVIELVDVFMANDN-LNLVLEFLPADL----EIIIKDTSIMFSPADIKSWILMT 116
           +ELK  N++ L D+  ++ + L LV EFL  DL    E I KD S+      IK ++   
Sbjct: 61  KELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSL--GSDIIKKFMRQL 118

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAP 176
            +G+ +CH + ILHRDLKP NLL+  +G LK+ DFGLAR    P    T  +VT WYRAP
Sbjct: 119 CKGIAYCHAHRILHRDLKPQNLLINKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP 178

Query: 177 ELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS 236
           E+L G K Y++ VD WS+G IFAE+  R P   G  ++DQI   FR LGTP ++ WP++ 
Sbjct: 179 EVLLGGKQYSTGVDTWSIGCIFAEMCNRSPIFSGDSEIDQIFKIFRILGTPNESVWPDIV 238

Query: 237 SFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
              ++     +P   R++L++   +     ++L+  ++  +P  R  A + +   YFQ+
Sbjct: 239 YLPDFKP--NFPQWRRKDLKQVVPSLDPQGIDLLDKLLAYDPINRISARRAVVHPYFQQ 295

>Kwal_26.7552
          Length = 461

 Score =  192 bits (488), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/302 (34%), Positives = 169/302 (55%), Gaps = 10/302 (3%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y + ++ GEGTY  VY      TG+ +A+K ++    ++G  ++++RE+K LQ   H N+
Sbjct: 131 YERIQQVGEGTYGKVYKARNTVTGQLVALKRLRLEGEREGFPITSIREIKLLQSFDHRNI 190

Query: 70  IELVDVFM-ANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
             L ++ + +   + ++ E+   DL  ++ +  I  S A+ K      L G+H+ H N I
Sbjct: 191 STLSEIMVESQKTVYMIFEYADNDLSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGI 250

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           LHRD+K +N+L+   GQLKI DFGLAR M    +  T+ V+T WYR PELL G+ +Y +A
Sbjct: 251 LHRDIKGSNILIDNKGQLKITDFGLARKMRDDSD-YTNRVITLWYRPPELLMGSTNYGTA 309

Query: 189 VDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYP 248
           VD+W  G +  EL  +     G ++V+Q+N  F  +GTPT   WP +     +    + P
Sbjct: 310 VDMWGCGCLLVELFKKTAIFQGTNEVEQLNAIFSIMGTPTVEQWPNLFEMPWF--FMMIP 367

Query: 249 PPSRE---ELRRRF--IAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPTLPQ 303
             +R+   +   +F  I  +  A +L  G+++ + K+R+ A   L+ QYF+E PEP  P 
Sbjct: 368 QQTRKHESKFDEKFGPILPSSAAADLAKGLLLYDEKRRFSASDALKHQYFREEPEPQ-PM 426

Query: 304 DL 305
           DL
Sbjct: 427 DL 428

>Scas_610.7
          Length = 668

 Score =  194 bits (493), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 183/342 (53%), Gaps = 60/342 (17%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
            ++Y ++KK G+GT+  VY G   +T R IA+K+I  +  KD   ++A RE+  L+ L H
Sbjct: 69  ANNYREDKKLGQGTFGEVYKGVHLATQRQIAMKKILVNVEKDLFPITAQREIVILKRLNH 128

Query: 67  VNVIELVDVFM--------------------------ANDNLNLVLEFLPADLEIIIKDT 100
            N+I+L+++                             + +  ++L ++ ADL  I+ + 
Sbjct: 129 KNIIKLIEMVYDYAPDSSSSRAAEVKSLSTAAGPPASPSKHFYMILPYMVADLSGILHNP 188

Query: 101 SIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR-LMAS 159
            I     DIK+ +L  L GV++ H    +HRD+K  N+L+  +G LK+ADFGLAR    S
Sbjct: 189 RITLEMPDIKNIMLQVLEGVNYIHCQKFMHRDIKAANILIDHNGILKLADFGLARTYYGS 248

Query: 160 PQEI-----------LTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYL 208
           P  +            TS VVTRWYRAPEL+ G KHYT+AVDIW VG +FAEL  + P L
Sbjct: 249 PPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAVDIWGVGCVFAELFEKKPIL 308

Query: 209 PGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAAT----- 263
            G  D+DQ ++ F+ +GTPT+ +W          K+  Y P S  EL R    +T     
Sbjct: 309 QGSSDIDQGHIIFKLMGTPTEEEW----------KLAHYLPGS--ELTRTNYKSTIDERF 356

Query: 264 -----ENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
                ++ L+ + G++ ++P KR  A+  ++ ++F+E P P+
Sbjct: 357 GKWLDKSGLDFLKGLLALDPYKRLTAMSAVKHEFFKEEPLPS 398

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score =  189 bits (481), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 164/299 (54%), Gaps = 5/299 (1%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL 64
           S    Y +  + GEGTY  VY      T + +A+K+++    +DG  ++++RE+K LQ  
Sbjct: 117 SVESSYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERDGFPITSIREIKLLQHC 176

Query: 65  KHVNVIELVDVFM-ANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           +H NV  + ++   A   + ++ E+   DL  ++ +  I FS A+ K      L+G+ + 
Sbjct: 177 QHENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANCKHLFRQLLKGMEYL 236

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           H   ILHRD+K +N+L+   G LKI DFGLAR M    +  T+ V+T WYR PELL G  
Sbjct: 237 HECRILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPD-YTNRVITLWYRPPELLLGTT 295

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNK 243
            Y + VD+W  G +  EL L+  +  G ++++Q+   F+ LGTPT   WP +     +  
Sbjct: 296 RYGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPTIEQWPGLFDMPWWFM 355

Query: 244 I---QIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP 299
           +   Q    PSR + +   +  T++  +L  G+++ + KKR+ A + L+S YF ELP P
Sbjct: 356 MIPQQKENYPSRFDEKVSGVLPTQSCRDLARGLLLYDQKKRFSASEALKSAYFYELPRP 414

>Kwal_27.11803
          Length = 246

 Score =  179 bits (454), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 140/249 (56%), Gaps = 20/249 (8%)

Query: 61  LQELKHVNVIELVDVFMANDNLNLVLEFLPADLEI-----IIKDTSIMFSPADIKSWILM 115
           ++ELKH N++ L DV    + L LV EF+  DL+      I+ +T   F  + +K +   
Sbjct: 1   MKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQ 60

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRA 175
            L+GV  CH N ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRA
Sbjct: 61  LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRA 120

Query: 176 PELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEV 235
           P++L G++ Y++++DIWS G I AE++   P  PG +D +Q+ + F  +GTPT+  WP V
Sbjct: 121 PDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMGTPTERTWPGV 180

Query: 236 SSFSNYNKIQIYPPPSREELRRRFIAATENA---------LELISGMMIMNPKKRWDAVK 286
           S+   YN      P   + L +   A  ++          ++L+ G++  NP +R  A +
Sbjct: 181 STLPKYN------PQLPQHLPKDLGALLQSQTREKMDLTLIDLLYGLLQPNPDRRLSAKQ 234

Query: 287 CLQSQYFQE 295
            L   +F E
Sbjct: 235 ALNHPWFAE 243

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score =  189 bits (480), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 176/327 (53%), Gaps = 41/327 (12%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           +Y +E+K G+GT+  VY G    T R +A+K I  +Q  D   ++A RE+  L+ L H N
Sbjct: 59  NYKEEEKLGQGTFGEVYKGLHLQTQRKVAMKRIIVNQENDLFPITAQREITILKRLNHKN 118

Query: 69  VIELVDV---------------FMANDNLN----------LVLEFLPADLEIIIKDTSIM 103
           +I+L+++               F  N++ N          ++L ++ ADL  I+ +  I 
Sbjct: 119 IIKLLEMVYDFPPESNNKDYAQFNQNNSANPPAVPKKFFYMILPYMVADLSGILHNPRIE 178

Query: 104 FSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR-LMASPQE 162
              ADIK+ +   L GV+  H +  +HRD+K  NLL+  +G LK+ADFGLAR    SP  
Sbjct: 179 LKMADIKNMMKQILEGVNFIHCSKFMHRDIKTANLLIDHNGVLKLADFGLARQYYGSPPN 238

Query: 163 I-----------LTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGK 211
           I            TS VVTRWYRAPEL+ G K+YT+AVDIW VG +FAE   + P L GK
Sbjct: 239 IKFPGSAGSGAKYTSVVVTRWYRAPELVLGDKYYTTAVDIWGVGCVFAEFFEKKPILQGK 298

Query: 212 DDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAA-TENALELI 270
            D+DQ +V F+ +GTP +  W E++ +      ++     +  +  RF    T   L  +
Sbjct: 299 TDIDQGHVIFKLMGTPDERTW-ELAKY--LPGAELTKTEYKSTIDERFGKHLTPTGLSFL 355

Query: 271 SGMMIMNPKKRWDAVKCLQSQYFQELP 297
            G++ ++P KR  A+  ++  +FQE P
Sbjct: 356 KGLLALDPYKRLTAMSAMKHPFFQEEP 382

>AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH]
           complement(471481..472560) [1080 bp, 359 aa]
          Length = 359

 Score =  181 bits (458), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 153/295 (51%), Gaps = 15/295 (5%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDV- 75
           GEG Y +V     K +G  +A+K+I+  + +    +  LRE+K L+  +H N+I + D+ 
Sbjct: 20  GEGAYGIVCSAVHKPSGEVVAIKKIEPFE-RTLFSLRTLREIKILKHFQHENIISIYDIQ 78

Query: 76  ----FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHR 131
               F   + + ++ E +  DL  +I    +  S   I+ +I  TLRG+   H + I+HR
Sbjct: 79  KPASFDTFNEVYIIQELMQTDLHRVIATQPL--SDDHIQYFIYQTLRGLKALHGSGIIHR 136

Query: 132 DLKPNNLLLAPDGQLKIADFGLARL-------MASPQEILTSNVVTRWYRAPELLFGAKH 184
           DLKP+NLLL  +  LKI DFGLAR+       +  PQ  +T  V TRWYRAPE++  A  
Sbjct: 137 DLKPSNLLLNANCDLKICDFGLARIEHGGAADLEHPQAGMTEYVATRWYRAPEVMLTAAQ 196

Query: 185 YTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKI 244
           YT A+DIWS G I AEL ++ P   GKD   Q+ + F  LGTP   D   V S      I
Sbjct: 197 YTKAIDIWSSGCILAELFMKRPLFAGKDYKHQLMLIFELLGTPQGDDLAAVKSRRAREYI 256

Query: 245 QIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP 299
              P   R  LR     A    L+L+  M++ +P++R  A   L+  Y     +P
Sbjct: 257 ATLPRYRRASLRAVIPHANPLGLDLLQRMLVFDPRRRITAADALRHPYLATYHDP 311

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score =  188 bits (477), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 180/330 (54%), Gaps = 37/330 (11%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           + +Y +EKK G+GT+  VY G   +T R +A+K+I      D   ++A RE+  L+ L H
Sbjct: 53  LGNYKEEKKLGQGTFGEVYRGVHLATQRQVAMKKILVKTENDLFPITAQREITILKRLNH 112

Query: 67  VNVIELVDVF--------------------MANDNLN---LVLEFLPADLEIIIKDTSIM 103
            NV++L+++                      + D +    ++L ++ ADL  I+ +  + 
Sbjct: 113 RNVVQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLSGILHNPRVT 172

Query: 104 FSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR-LMASPQE 162
              ADIK+ +L  L G+++ H    +HRD+K  N+LL   G LKIADFGLAR    +P  
Sbjct: 173 LEMADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKIADFGLARNYYGAPPN 232

Query: 163 I-----------LTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGK 211
           +            TS VVTRWYRAPEL+ G K+YT+AVDIW +G +FAE   + P L GK
Sbjct: 233 LKYPGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGCVFAEFFEKRPILQGK 292

Query: 212 DDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELIS 271
            D+DQ +V F+ +GTP+D+DW            +    P+ +E   +++  TE  L+L+S
Sbjct: 293 TDIDQGHVIFKLMGTPSDSDWQLARYLPGAELTRTSYEPTYKERFGKYL--TEKGLDLLS 350

Query: 272 GMMIMNPKKRWDAVKCLQSQYFQELPEPTL 301
            ++ ++P KR  A+  +Q  +F E P P L
Sbjct: 351 TLLSLDPYKRLTAMAAMQHPFFSEDPLPKL 380

>Kwal_55.21900
          Length = 625

 Score =  181 bits (458), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 180/332 (54%), Gaps = 46/332 (13%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y ++KK G+GT+  VY G    T R +A+K       KD   ++A RE+  L++L H NV
Sbjct: 57  YKEDKKLGQGTFGEVYRGVHLETQRQVAMKRTIVKAEKDLFPITAQREITILRKLNHKNV 116

Query: 70  IELVDVFM------ANDNLN----------------LVLEFLPADLEIIIKDTSIMFSPA 107
           I+L+++        +N + N                ++L ++ ADL  I+ +  I     
Sbjct: 117 IKLIEMVYDYPPTSSNGSSNTTTLPNPNTPSTKSFYMILPYMIADLSGILHNPRIKLGME 176

Query: 108 DIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR-LMASPQEI--- 163
            IK+ +L  L G+++ H    +HRD+K  NLLL   G LKIADFGLAR    +P  +   
Sbjct: 177 GIKNILLQILEGINYIHCQKFMHRDIKAANLLLDHKGVLKIADFGLARNYYGAPPNLKYP 236

Query: 164 --------LTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVD 215
                    TS VVTRWYRAPEL+ G KHYT+AVD+W VG +F EL  + P L G+ D+D
Sbjct: 237 GGAGVDAKYTSVVVTRWYRAPELVLGDKHYTTAVDMWGVGCVFGELFEKKPILQGQTDID 296

Query: 216 QINVTFRALGTPTDADWPEVSSF---SNYNKIQIYPPPSREELRRRFIAA-TENALELIS 271
           Q +V F+ LGTP++ +WP ++ F   +   + +  P      +R RF    T+  L+L+S
Sbjct: 297 QGHVIFKLLGTPSEEEWP-LARFLPGAELTRTKYSP-----NIRERFGEYLTDTGLDLLS 350

Query: 272 GMMIMNPKKRWDAVKCLQSQYFQE--LPEPTL 301
            ++ ++P KR  A+   +  +F E  LPEP L
Sbjct: 351 QLLCLDPYKRLTAMAAKKHPFFTEEPLPEPIL 382

>Scas_721.110
          Length = 520

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 162/302 (53%), Gaps = 15/302 (4%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y +  + GEGTY  VY    + T   +A+K+++ +  KDG  ++++RE+K LQ   H N+
Sbjct: 185 YERIVQVGEGTYGKVYKARNEVTSHLVALKKLRLNNEKDGFPITSIREIKLLQTFHHPNI 244

Query: 70  IELVDVFMANDNL-NLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
             LV++ + +  +  ++ E+   DL  ++ D +++ S    K      LRGV + H + I
Sbjct: 245 ATLVEIMVESSKMVYMIFEYADNDLTGLLGDKNVVMSLGQRKHLFQQLLRGVKYLHDSLI 304

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSN-----VVTRWYRAPELLFGAK 183
           LHRD+K +N+L+   G LKI DFGLAR M    +   SN     V+T WYR PELL G  
Sbjct: 305 LHRDIKGSNILIDNKGNLKITDFGLARKMHVKSDSDGSNDYTNRVITLWYRPPELLMGTT 364

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNK 243
           +Y++ VD+W  G I  EL   +    G+++++Q+   F+ +G+P   +WP       +  
Sbjct: 365 NYSTEVDMWGCGCILMELFNNVSIFQGQNEIEQLLSIFKIMGSPNLDNWPNFFEMPWF-- 422

Query: 244 IQIYP------PPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELP 297
             I P      P   EE  +  + ++E    L  G+++ + KKR  A + L+S YF E P
Sbjct: 423 FMIIPMLTEKYPDLFEEKYKNLLPSSE-CFNLAKGLLLYDQKKRLSAEEALKSPYFTEDP 481

Query: 298 EP 299
           +P
Sbjct: 482 QP 483

>YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine protein
           kinase required for cell cycle arrest and for cell
           fusion during mating, member of the MAP kinase family of
           protein kinases [1062 bp, 353 aa]
          Length = 353

 Score =  172 bits (437), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 159/308 (51%), Gaps = 19/308 (6%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           D+  +   GEG Y VV   T K TG  +A+K+I+    K    +  LRE+K L+  KH N
Sbjct: 12  DFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFKHEN 70

Query: 69  VIELV-----DVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           +I +      D F   + + ++ E +  DL  +I  ++ M S   I+ +I  TLR V   
Sbjct: 71  IITIFNIQRPDSFENFNEVYIIQELMQTDLHRVI--STQMLSDDHIQYFIYQTLRAVKVL 128

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLM----------ASPQEILTSNVVTRWY 173
           H + ++HRDLKP+NLL+  +  LK+ DFGLAR++             Q  +T  V TRWY
Sbjct: 129 HGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWY 188

Query: 174 RAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP-TDADW 232
           RAPE++  +  Y+ A+D+WS G I AEL LR P  PG+D   Q+ + F  +GTP +D D 
Sbjct: 189 RAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDL 248

Query: 233 PEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQY 292
             + S      I+  P      L + F       ++L+  M++ +P KR  A + L+  Y
Sbjct: 249 RCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPY 308

Query: 293 FQELPEPT 300
            Q   +P 
Sbjct: 309 LQTYHDPN 316

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score =  178 bits (451), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 187/354 (52%), Gaps = 67/354 (18%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           +++Y +E+K G+GT+  V+ G    T R +A+K I     KD   ++A RE+  L+ + H
Sbjct: 52  LNNYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNH 111

Query: 67  VNVIELVDV--------------------FMANDNLN-----------LVLEFLPADLEI 95
            N+++L+++                    +  N+  N           ++L ++ +DL  
Sbjct: 112 KNIVKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTG 171

Query: 96  IIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR 155
           ++ +  + F  AD+K+ +L  L G+++ H N  LHRD+K  N+L+   G +KIADFGLAR
Sbjct: 172 LLHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDHKGVVKIADFGLAR 231

Query: 156 -LMASPQEI-----------LTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML 203
               SP  +            TS VVTRWYRAPE++ G +HYT+AVDIW +G +FAE   
Sbjct: 232 NYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTAVDIWGIGCVFAEFFE 291

Query: 204 RIPYLPGKDDVDQINVTFRALGTPTDADW--------PEVSSFSNYNKIQIYPPPSREEL 255
           + P L G+ D+DQ +V F+ +GTP+  +W         E++  +NY          +  L
Sbjct: 292 KKPILQGQTDIDQGHVIFKLMGTPSMDEWGLAYHLPGSELTK-TNY----------KSTL 340

Query: 256 RRRFIAA-TENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP----TLPQD 304
           + RF  A  E  L+L+S ++ ++P KR  A+K  +  +F E P P    TLP +
Sbjct: 341 QERFSKALNETGLDLLSKLLALDPYKRVTAMKAKKHPFFFEEPLPNAQLTLPNE 394

>Kwal_17.2687
          Length = 362

 Score =  172 bits (435), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 163/308 (52%), Gaps = 20/308 (6%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           ++  ++  GEG Y VV       TG+ +A+K+I+    +    +  LRE+K L+  +H N
Sbjct: 12  EFQLQQLLGEGAYGVVCSARHLPTGQMVAIKKIEPFD-RPLFCLRTLREIKLLRCFQHEN 70

Query: 69  VIELVDV-----FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           +I + D+     F   + + ++ E +  DL  +I   ++  S   I+ ++   LR +   
Sbjct: 71  IISIFDIQRPASFETFNEVYIIQELMDTDLHRVIATQTL--SDDHIQYFVYQILRALKCL 128

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLM-----------ASPQEILTSNVVTRW 172
           H   ++HRDLKP NLL+  +  +K+ DFGLAR             A     +T  V TRW
Sbjct: 129 HGAEVIHRDLKPANLLVNANCDVKLCDFGLARCAGMGPGASNTGKAGEAGQMTEYVATRW 188

Query: 173 YRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADW 232
           YRAPE++  A  YT A+D+WS G I AEL+LR P  PGKD   Q+ + F+ +G+PT+AD 
Sbjct: 189 YRAPEVMLTAAEYTFAMDVWSCGCILAELLLRRPLFPGKDYHHQLLLIFQVIGSPTEADL 248

Query: 233 PEVSSFSNYNKIQIYPP-PSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQ 291
             V S      +   P   +RE LR+    A+  AL+L+  M++ +P++R  A + L+  
Sbjct: 249 ECVRSRRARQYLGTLPRYAAREGLRQLLPQASAEALDLLKRMLVFDPRRRISAAQALRHP 308

Query: 292 YFQELPEP 299
           Y +   +P
Sbjct: 309 YLRAYHDP 316

>Kwal_27.11919
          Length = 209

 Score =  167 bits (422), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 126/204 (61%), Gaps = 8/204 (3%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTG-RSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV 67
           +Y + +K GEGTY VVY       G R +A+K+I+     +G+  +A+RE+  L+ELK  
Sbjct: 6   NYKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDD 65

Query: 68  NVIELVDVFMANDN-LNLVLEFLPADL----EIIIKDTSIMFSPADIKSWILMTLRGVHH 122
           N++ L D+  ++ + L LV EFL  DL    E I K+  +      IK +++   +G+ +
Sbjct: 66  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPL--GDNIIKKFMMQLCKGIAY 123

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
           CH + ILHRDLKP NLL+  DG +K+ADFGLAR    P    T  +VT WYRAPE+L G 
Sbjct: 124 CHSHRILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGG 183

Query: 183 KHYTSAVDIWSVGVIFAELMLRIP 206
           K Y++ VDIWS+G IFAE+  R P
Sbjct: 184 KQYSTGVDIWSIGCIFAEMCNRKP 207

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score =  173 bits (438), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 158/292 (54%), Gaps = 10/292 (3%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVD 74
           + GEGTY  VY      TG+ IA+K ++  Q +DG  ++++RE+K LQ+L H N+  + +
Sbjct: 134 QVGEGTYGKVYKAENVHTGKLIALKRLRLEQERDGFPITSIREIKLLQQLNHPNISLIHE 193

Query: 75  VFMANDN-LNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDL 133
           + +++ N +++  +++  DL  ++ D SI FS ++IK  +     G+ + H+  I+HRD+
Sbjct: 194 IIVSDKNTISMGFQYMENDLSGMLMDKSIQFSDSNIKHLMKQLFVGLQYLHQQQIVHRDI 253

Query: 134 KPNNLLLAPDGQLKIADFGLARLM---ASPQEILTSNVVTRWYRAPELLFGAKHYTSAVD 190
           K +NLL+   G LKI DFGLA+ +   +SP    T+ V+T WYR PELL GA  Y   VD
Sbjct: 254 KGSNLLIDNRGNLKITDFGLAKKLTDVSSPASN-TNRVITLWYRPPELLLGATDYKYEVD 312

Query: 191 IWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPP 250
            W  G +  EL       PG ++VDQ       +G+PT   WP++     +    + P  
Sbjct: 313 CWGCGCLLVELFAGAAIFPGSNEVDQFQRILSIMGSPTLEQWPKMLDMPWW--FMLVPQI 370

Query: 251 S---REELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP 299
           S   +      F    ++AL+L S ++  +   R+   + LQ  YF   P+P
Sbjct: 371 SKTYKNVFFDEFSKVPQDALDLASKLLRYDQDTRFTTTEALQHHYFTNEPKP 422

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score =  172 bits (437), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/292 (31%), Positives = 159/292 (54%), Gaps = 7/292 (2%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVD 74
           + GEGTY  VY      T   +A+K+++    ++G  ++++RE+K LQ   H NV  + +
Sbjct: 226 QVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPITSIREIKLLQSFNHENVSTIKE 285

Query: 75  VFMANDNL-NLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDL 133
           + + +  +  ++ E+   DL  ++ +  I  + A  K      L G+ + H N ILHRD+
Sbjct: 286 IMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSKHIFKQILHGIEYLHDNNILHRDI 345

Query: 134 KPNNLLLAPDGQLKIADFGLARLMASPQEIL---TSNVVTRWYRAPELLFGAKHYTSAVD 190
           K +N+L+   G LK+ DFGLAR +   ++ +   T+ V+T WYR PELL G  +Y   VD
Sbjct: 346 KGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPPELLLGTTNYGPEVD 405

Query: 191 IWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKI---QIY 247
           +W  G I  EL  ++    G ++++Q+   F+ +G+P+   WP +     +  I   Q  
Sbjct: 406 MWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWPNIFDMPWFFMIMPQQAT 465

Query: 248 PPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP 299
             P+  E + R +  T+N  +L  G++  + +KR  A + LQS+YF+E P+P
Sbjct: 466 KYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTASEALQSEYFKEDPQP 517

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score =  167 bits (424), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 162/317 (51%), Gaps = 37/317 (11%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDV- 75
           GEG Y VV     K +G  +A+K+I+  + K    +  LRE+K L+  +H N+I + DV 
Sbjct: 20  GEGAYGVVCSAKHKPSGEIVAIKKIEPFE-KPLFSIRTLREIKILKHFQHENIISIFDVQ 78

Query: 76  ----FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHR 131
               F   + + ++ E +  DL  +I   +   S   ++ ++  TLR +   H + ++HR
Sbjct: 79  KPSSFEQFNEVYIIQELMQTDLHRVI--VTQELSEDHVQYFVYQTLRALKVLHGSNVIHR 136

Query: 132 DLKPNNLLLAPDGQLKIADFGLARLMA------------------SPQEI---------- 163
           DLKP+NLLL  +  LKI DFGLAR+++                  SP             
Sbjct: 137 DLKPSNLLLNSNCDLKICDFGLARIVSERATDGDAHVDADDTDDNSPSSAANDGDPAISG 196

Query: 164 LTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRA 223
           +T  V TRWYRAPE++  A  Y+ ++D+WS G I AEL+ + P  PGKD  DQ+ + F+ 
Sbjct: 197 MTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCILAELLGKQPLFPGKDYRDQLILIFQT 256

Query: 224 LGTPTDADWPE-VSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRW 282
           LGTPT+ +  E V +      I+  P   +   RRRF  A+  AL+L+  M+  +P+ R 
Sbjct: 257 LGTPTEQELVELVENRRAREYIRSLPKHPKINWRRRFPNASAAALDLLDRMLQFDPRLRI 316

Query: 283 DAVKCLQSQYFQELPEP 299
            A + L   Y     +P
Sbjct: 317 TATEALSHPYLVSYHDP 333

>Scas_710.28
          Length = 352

 Score =  165 bits (418), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 155/307 (50%), Gaps = 18/307 (5%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           D+  +   GEG Y VV     K TG  +A+K+I+    K    +  LRE+K L+  +H N
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFQHEN 70

Query: 69  VIELVDV-----FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           +I + D+     F   + + ++ E +  DL  +I   ++  +   I+ +I  TLR V   
Sbjct: 71  IISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQNL--TDDHIQYFIYQTLRAVKVL 128

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLM----------ASPQEILTSNVVTRWY 173
           H + ++HRDLKP+NLL+  +  LKI DFGLAR++          A  Q  +T  V TRWY
Sbjct: 129 HGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTEYVATRWY 188

Query: 174 RAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWP 233
           RAPE++  A  Y+ A+DIWS G I AEL ++ P  PGKD   Q+ + F  +GTP+  D  
Sbjct: 189 RAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIGTPSGRDLL 248

Query: 234 EVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
            + S      I   P        + F       ++L+  M+I +P+ R  A + L   Y 
Sbjct: 249 CIESRRAREYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIFDPRSRITAEEALAHPYL 308

Query: 294 QELPEPT 300
           +   +P 
Sbjct: 309 KTYHDPN 315

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  168 bits (425), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 155/293 (52%), Gaps = 14/293 (4%)

Query: 14  KKAGEGTYAVVYLG--TKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVI 70
           K+ G G Y +V     T+ S   ++A+K++     K  L   +LRE+K L+  + H N+ 
Sbjct: 25  KEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNIT 84

Query: 71  ELVD---VFMANDNLN---LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            L D   VF  + ++N   L  E +  D+  IIK    + + A  +S+    L G+ + H
Sbjct: 85  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQAL-TDAHYQSFTYQILCGLKYIH 143

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA-SPQE---ILTSNVVTRWYRAPELLF 180
              +LHRDLKP NLL+  D QLKI DFGLAR  + +P+E    LT  V TRWYRAPE++ 
Sbjct: 144 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIML 203

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + YT A+DIWS G I AE +   P   GKD VDQ+N   + LGTP D     V S + 
Sbjct: 204 SYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNV 263

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
            + I       +      F  A E+AL+L+ GM+  +P+KR    K L+  Y 
Sbjct: 264 QDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKRITVDKALEHPYL 316

>CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces
           cerevisiae YPL042c cyclin-dependent CTD kinase,
           hypothetical start
          Length = 567

 Score =  168 bits (426), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 158/292 (54%), Gaps = 28/292 (9%)

Query: 29  KKSTGRSIAVKEIKTSQ------FKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNL 82
           K  T    A+K+ KT +         G+  SA RE+   +EL + ++ +LV++F+   ++
Sbjct: 180 KAETTMYYAIKKFKTEKDGIEQLHYTGISQSACREMALCRELDNNHLTKLVEIFLQKKSI 239

Query: 83  NLVLEFLPADLEIIIKDTSI----MFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNL 138
            +V EF   DL  II   S     M  P  I+S +   L GV + H+N++LHRDLKP N+
Sbjct: 240 YMVYEFAEHDLLQIIHFHSHPEKRMIPPRMIRSIMWQILDGVSYLHQNWVLHRDLKPANI 299

Query: 139 LLAPDGQLKIADFGLARLMASPQEILTSN---VVTRWYRAPELLFGAKHYTSAVDIWSVG 195
           ++  DG +KI D GLAR  ++  + + +    VVT WYRAPELL GA+HYT A+D+W+VG
Sbjct: 300 MVTMDGVVKIGDLGLARKFSNMLQTMYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVG 359

Query: 196 VIFAELMLRIPYLPGKD-----------DVDQINVTFRALGTPTDADWPEVSSFSNYNKI 244
            IFAEL+   P   G++             +Q+    + LGTPT   WP +  +  Y ++
Sbjct: 360 CIFAELIGLQPIFKGEEAKMDSKKTVPFQANQLQRILKILGTPTPKSWPHLQKYPEYEQL 419

Query: 245 QIYPPPSREELRRRFIAAT---ENALELISGMMIMNPKKRWDAVKCLQSQYF 293
             + P  R+ L   F +A    ++AL L+  ++  NP +R DA+  L   YF
Sbjct: 420 SKF-PKYRDNLPGWFHSAGGRDKHALSLLYHLLNYNPIERIDAINALDHSYF 470

>Kwal_27.11830
          Length = 575

 Score =  167 bits (424), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 170/310 (54%), Gaps = 30/310 (9%)

Query: 24  VYLGTKKSTGRSI-AVKEIKTSQ------FKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           + +G+  S   S+ A+K+ KT +         G+  SA RE+   +EL++ ++  LV++F
Sbjct: 176 IIIGSPTSAPPSLFAIKKFKTEREGVEQLHYTGISQSACREMSLCRELRNKHLTHLVEIF 235

Query: 77  MANDNLNLVLEFLPADLEIIIKDTSI----MFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           + + ++ +V EF   DL  II   S     +  P  +KS I   L GV + H+N+ILHRD
Sbjct: 236 LEHKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPRMLKSIIWQILDGVSYLHQNWILHRD 295

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSN---VVTRWYRAPELLFGAKHYTSAV 189
           LKP N+++  DG +KI D GLAR   +  + L +    VVT WYRAPELL GA+HYT A+
Sbjct: 296 LKPANIMVTVDGCVKIGDLGLARKFHNMVQTLYAGDKVVVTIWYRAPELLLGARHYTPAI 355

Query: 190 DIWSVGVIFAELMLRIPYLPGKD-----------DVDQINVTFRALGTPTDADWPEVSSF 238
           D+W+VG IFAEL+   P   G++             +Q+      LG+PT+  WP +  +
Sbjct: 356 DLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQANQLQRILEVLGSPTEKSWPNIFKY 415

Query: 239 SNYNKIQIYPPPSREELRRRFIAA---TENALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
             Y +I  + P  R+ L   + +A    + AL+L+  ++  +P  R DAV  L+  YF  
Sbjct: 416 PEYEQITKF-PRYRDNLPVWYHSAGGRNKEALDLLYQLLRYDPITRIDAVDALEHPYFTN 474

Query: 296 LPEPTLPQDL 305
             EPT+ +++
Sbjct: 475 -EEPTVCENV 483

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score =  160 bits (404), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 157/303 (51%), Gaps = 23/303 (7%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           D+  +   GEG Y VV     K TG  +A+K+I     K    +  LRE+K L+  +H N
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVPFD-KPLFALRTLREIKILRRFQHEN 70

Query: 69  VIELVDV-----FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           +I + D+     F   + + ++ E +  DL  +I   ++  +   I+ +I  TLR +   
Sbjct: 71  IISIFDIQKPESFEKFNEVYIIQELMQTDLHRVIATQTL--TDDHIQYFIYQTLRAIKTL 128

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQ----EI----LTSNVVTRWYRA 175
           H + ++HRDLKP+N+L+  +  LK+ DFGLAR++ S +    E+    +T  V TRWYRA
Sbjct: 129 HGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRWYRA 188

Query: 176 PELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWP-- 233
           PE++     Y+ A+DIWS G I  EL L+ P  PGKD   Q+ + F  +GTP  +D    
Sbjct: 189 PEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDKSME 248

Query: 234 --EVSSFSNY-NKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQS 290
             E      Y   +Q YPP     L++ F       ++L+S M++ +P++R  A   L  
Sbjct: 249 CIESRRARQYIASLQKYPP--VRPLQKAFPGVNPVGVDLLSRMLVFDPRERISADDALAH 306

Query: 291 QYF 293
            Y 
Sbjct: 307 PYL 309

>KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA61157.1
           Kluyveromyces lactis protein kinase, start by similarity
          Length = 415

 Score =  160 bits (406), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 166/293 (56%), Gaps = 24/293 (8%)

Query: 16  AGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVNVIELVD 74
            G G++ VV+    K TG  + +K++ +  +FK+       RE++ ++ + H N+I+L  
Sbjct: 93  VGNGSFGVVFRTKVKETGEDVVIKKVLQDRRFKN-------RELEIMKLISHPNLIDLKY 145

Query: 75  VFMANDN----LNLVLEFLPADLEIIIKDTSIMFSPAD---IKSWILMTLRGVHHCHRNF 127
            F+   +    LNL+++++P  L   +K+   +  P D   IK ++    + +++ H+  
Sbjct: 146 YFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQPMDRYEIKIYMFQLFKSLNYLHQVV 205

Query: 128 -ILHRDLKPNNLLLAPDGQL-KIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHY 185
            + HRD+KP N+L+ PD  L KI D G A+ +  P E   S + +R+YRAPEL+FGA +Y
Sbjct: 206 NVCHRDIKPQNILVDPDTLLLKICDLGSAKQLK-PNEPNVSYICSRYYRAPELIFGATNY 264

Query: 186 TSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS-SFSNYNKI 244
           T+ +DIWS G + AEL+L  P  PG+  +DQ+    + LGTPT  +   ++ ++S +   
Sbjct: 265 TTKIDIWSAGCVMAELLLGQPIFPGESKIDQLVEIIKVLGTPTREEICSMNENYSEHKFP 324

Query: 245 QIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCL-QSQYFQEL 296
           QI P P    L R F   T+  ++L+  +M  +P  R+ A++C+  S YF ++
Sbjct: 325 QIRPIP----LNRIFKKETQETIDLLYHIMKYDPNIRYSALQCMFNSTYFTDI 373

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score =  158 bits (399), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 158/301 (52%), Gaps = 23/301 (7%)

Query: 16  AGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-ALREVKFLQEL-KHVNVIELV 73
            GEG Y  V     K T   +A+K+I+   F   + ++  LRE+K L+    H N+I ++
Sbjct: 19  VGEGAYGTVCSAIHKPTNTKVAIKKIQP--FSRSMFVTRTLRELKLLKFFHSHENIISVL 76

Query: 74  DVFMAN-----DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           D+         + + LV E +  DL+ II   ++  S   I+ ++   LR +   H   +
Sbjct: 77  DIVRPTSWHKFEAVYLVQELMETDLQKIINQQNL--SEDHIQYFVYQILRALKSLHSAQV 134

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE-------ILTSNVVTRWYRAPELLFG 181
           +HRDLKP+NLLL  +  LK+ DFGLAR +AS  +        +T  V TRWYRAPE++  
Sbjct: 135 IHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEYVATRWYRAPEIMLS 194

Query: 182 AKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNY 241
            + YT+A+DIWS G I AE+++  P  PGKD   Q+ +    LG+PT  D+ ++   S  
Sbjct: 195 FQEYTTAMDIWSCGCILAEMIMGKPLFPGKDYHHQLWIILEVLGSPTLEDFEQIK--SKR 252

Query: 242 NKIQIYPPPSREELRRRFIAATEN---ALELISGMMIMNPKKRWDAVKCLQSQYFQELPE 298
            K  I   P ++ +    +   E    A++L+S M+  NP KR  AV+ L+  Y     +
Sbjct: 253 AKEYISQLPMKKGIPWANVLNKEVNPLAIDLLSKMLTFNPDKRISAVEALEHPYLATYHD 312

Query: 299 P 299
           P
Sbjct: 313 P 313

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score =  157 bits (397), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 150/295 (50%), Gaps = 20/295 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL-KHVNVIELVDV 75
           GEG Y +V     K TG  +A+K+I+    +       LRE+K L+    H N+I ++D+
Sbjct: 20  GEGAYGIVCSAIHKPTGTKVAIKKIQPFT-RPMFVTRTLRELKLLKFFHSHENIISVLDI 78

Query: 76  -----FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
                +   + + LV E +  DL+ II   +   S   I+ +    LR +   H   ++H
Sbjct: 79  VRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIH 138

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQE-------ILTSNVVTRWYRAPELLFGAK 183
           RDLKP+NLLL     LK+ DFGL+R +AS           +T  V TRWYRAPE++   +
Sbjct: 139 RDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRAPEIMLSFQ 198

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNK 243
            YT+A+DIWS G I AE++   P  PG+D   Q+ +    LGTP+  D+ ++   S   K
Sbjct: 199 EYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWIILEILGTPSFEDFEQIK--SKRAK 256

Query: 244 IQIYPPPSREELRRRFIAATEN----ALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
             I   P R ++      +T +    A++L+  M+  NP KR  A   L+  Y +
Sbjct: 257 AYIANLPMRPKIPWNVALSTNDINPLAMDLLDKMLTFNPDKRISAADALKHPYLE 311

>Scas_683.6
          Length = 377

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 155/301 (51%), Gaps = 20/301 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-ALREVKFLQELK-HVNVIELVD 74
           GEG Y  V     K +G  +A+K+I+   F   + ++  LRE+K L     H N+I ++D
Sbjct: 20  GEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKAMFVTRTLREIKLLTYFNNHENIISILD 77

Query: 75  VF--MANDNLN---LVLEFLPADLEIIIKDTSIMFSPAD--IKSWILMTLRGVHHCHRNF 127
               ++ D      LV E +  DL+ +I + +   S  D  I+ +    LR +   H   
Sbjct: 78  KIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRALKSIHSAK 137

Query: 128 ILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE-------ILTSNVVTRWYRAPELLF 180
           ++HRDLKP+NLLL  +  LKI DFGL+R + S  +        +T  V TRWYRAPE++ 
Sbjct: 138 VIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRWYRAPEIML 197

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + YT+A+DIWSVG I AE++   P  PG+D   Q+ +    LGTP+  D+ ++ S   
Sbjct: 198 TFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLEDFEQIKSKRA 257

Query: 241 YNKIQIYP--PPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPE 298
              I   P  PP   ++         + ++L++ M++ NP KR  A + LQ  Y     +
Sbjct: 258 REYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRISAAEALQHPYLSTYHD 317

Query: 299 P 299
           P
Sbjct: 318 P 318

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score =  155 bits (393), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 171/300 (57%), Gaps = 25/300 (8%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVN 68
           Y   +  G G++ VV+    + TG  +A+K++ +  +FK+       RE++ ++ L+H N
Sbjct: 32  YPATEVVGHGSFGVVFTTVIEQTGEKVAIKKVLQDRRFKN-------RELEIMKLLQHPN 84

Query: 69  VIELVDVFMAND------NLNLVLEFLPADLEIIIKD--TSIMFSPAD-IKSWILMTLRG 119
           V++L   F  ++       LNL+LE++P  L   ++   T  +  P D IK ++    + 
Sbjct: 85  VVDLRYHFYESEPQTNEVYLNLILEYMPQSLYQRLRHFVTGRLLMPRDEIKVYMFQLFKS 144

Query: 120 VHHCHR-NFILHRDLKPNNLLL-APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPE 177
           +++ HR   + HRD+KP NLL+ A   QLK+ DFG A+ +  P E   S + +R+YRAPE
Sbjct: 145 LNYLHRVARVCHRDIKPQNLLVDAGTLQLKLCDFGSAKQL-RPTEPNVSYICSRYYRAPE 203

Query: 178 LLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS- 236
           L+FGA +YT+ +DIWS G + AEL+L  P  PG+  + Q+    + LGTPT  +   ++ 
Sbjct: 204 LIFGATNYTTQIDIWSTGCVMAELLLGQPMFPGEFVIVQLAEIIKILGTPTRQEICAMNE 263

Query: 237 SFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQEL 296
           ++S++   QI P P    L + F     + ++L+S ++  +P +R++A+  + S YF E+
Sbjct: 264 NYSDHKFPQIKPIP----LSKVFKREDAHTVQLLSDVLQYDPTRRFNALMAMCSSYFDEI 319

>Scas_713.38
          Length = 432

 Score =  157 bits (396), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 154/300 (51%), Gaps = 6/300 (2%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           T+    + YT     G G + +V   T   T + +A+K+I        L     RE+K L
Sbjct: 15  TVFEITNRYTDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLL 74

Query: 62  QELKHVNVIELVDVFMAN-DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L+H N+I L D+F++  +++  V E    DL  +++   +      ++ ++   LRG+
Sbjct: 75  KHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGL 132

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   ++HRDLKP+N+L+  +  LKI DFGLAR+   PQ  +T  V TR+YRAPE++ 
Sbjct: 133 KYVHSVGVIHRDLKPSNILINENCDLKICDFGLARIQ-DPQ--MTGYVSTRYYRAPEIML 189

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + Y   VDIWS G IFAE++   P  PGKD V Q ++    LG+P +     + S + 
Sbjct: 190 TWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENT 249

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
              +   P         RF     +A++L+  M++ +PKKR  A + L   Y     +PT
Sbjct: 250 LKFVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALAHPYLAPYHDPT 309

>Kwal_14.1416
          Length = 365

 Score =  155 bits (391), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 149/300 (49%), Gaps = 20/300 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL-KHVNVIELVDV 75
           GEG Y  V     K +G  +A+K+I+    K+      LRE+K L+    H N+I ++DV
Sbjct: 20  GEGAYGTVCSAVHKPSGTKVAIKKIQPFS-KEMFVTRTLRELKLLKLFHSHENIISVLDV 78

Query: 76  FMAND-----NLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
                      + LV E +  DL  +I       S   I+ +    LR +   H   ++H
Sbjct: 79  VRPTSMDKFQAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVIH 138

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQE-------ILTSNVVTRWYRAPELLFGAK 183
           RD+KP+NLLL  +  LK+ DFGLAR + S           +T  V TRWYRAPE++   +
Sbjct: 139 RDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVATRWYRAPEIMLTFQ 198

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNK 243
            YT A+DIWS G I AE++   P  PG+D   Q+ +   ALGTP+  D+  ++  S   K
Sbjct: 199 QYTVAMDIWSCGCILAEMITGKPLFPGRDYHHQLWLILEALGTPSYEDFENIN--SKRAK 256

Query: 244 IQIYPPPSREELRRRFIAATEN----ALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP 299
             I   P R++L  + +   ++    A++L+  M+  NP KR  A + L   Y     +P
Sbjct: 257 EYIANLPLRQKLPWQVVLQKQDINPQAVDLLDKMLTFNPDKRISAAEALAHPYLSVYHDP 316

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score =  156 bits (395), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 152/300 (50%), Gaps = 6/300 (2%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           T+    + YT     G G + +V   T   T + +A+K+I        L     RE+K L
Sbjct: 14  TVFEITNRYTNLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSVLAKRTYRELKLL 73

Query: 62  QELKHVNVIELVDVFMAN-DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L+H N+I L D+F++  +++  V E    DL  +++   +      ++ ++   LRG+
Sbjct: 74  KHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGL 131

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   ++HRDLKP+N+L+  +  LKI DFGLAR+   PQ  +T  V TR+YRAPE++ 
Sbjct: 132 KYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ-DPQ--MTGYVSTRYYRAPEIML 188

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + Y   VDIWS G IFAE++   P  PGKD V Q ++    LG+P       + S + 
Sbjct: 189 TWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENT 248

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
              +   P         RF     +A++L+  M++ +PKKR  A   L   Y     +PT
Sbjct: 249 LKFVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHPYLSPYHDPT 308

>Kwal_56.23841
          Length = 432

 Score =  156 bits (394), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 152/300 (50%), Gaps = 6/300 (2%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           T+    + YT     G G + +V       T +S+A+K+I        L     RE+K L
Sbjct: 15  TVFEITNRYTDLNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPFSTAVLAKRTYRELKLL 74

Query: 62  QELKHVNVIELVDVFMAN-DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L+H N+I L D+F++  +++  V E    DL  +++   +      ++ ++   LRG+
Sbjct: 75  KHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGL 132

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   ++HRDLKP+N+L+  +  LKI DFGLAR+   PQ  +T  V TR+YRAPE++ 
Sbjct: 133 KYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ-DPQ--MTGYVSTRYYRAPEIML 189

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + Y   VDIWS G IFAE++   P  PGKD V Q ++    LG+P +     + S + 
Sbjct: 190 TWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNT 249

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
              +   P         RF     +A++L+  M++ +P KR  A   L   Y     +PT
Sbjct: 250 LKFVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHPYLAPYHDPT 309

>Kwal_47.17868
          Length = 365

 Score =  154 bits (390), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 163/300 (54%), Gaps = 26/300 (8%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVN 68
           Y   +  G G++ VV+    + TG  +A+K++ +  +FK+       RE++ +++L+H  
Sbjct: 36  YPATEVVGHGSFGVVFTTQVRETGDRVAIKKVLQDRRFKN-------RELEIMKQLQHPQ 88

Query: 69  VIELVDVFMAND-----NLNLVLEFLPADL----EIIIKDTSIMFSPADIKSWILMTLRG 119
           V++L   F   D      LNL+LE++P  L       +   S M    +IK ++    + 
Sbjct: 89  VVDLKYYFYETDPQGEVYLNLILEYMPQSLYQRLRHFVSQRSNM-PRIEIKLYMYQLAKS 147

Query: 120 VHHCHRNF-ILHRDLKPNNLLLAPDG-QLKIADFGLARLMASPQEILTSNVVTRWYRAPE 177
           +++ H N  + HRD+KP NLL+ P    LK+ DFG A+ +  P E   S + +R+YRAPE
Sbjct: 148 LNYLHTNARVCHRDIKPQNLLVDPQTFALKLCDFGSAKQL-KPSEPNVSYICSRYYRAPE 206

Query: 178 LLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS- 236
           L+FGA +YT  +DIWS G + AEL+L  P  PG+  +DQ+    + LGTPT  +   ++ 
Sbjct: 207 LIFGASNYTVQIDIWSSGCVMAELILGQPMFPGESGIDQLVEIIKILGTPTKQEICSMNP 266

Query: 237 SFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQEL 296
           ++  +   QI P P    L + F    +  +  +  ++  +P +R+ A++CL + YF EL
Sbjct: 267 NYMEHKFPQIRPIP----LAKVFKREDDETIRFLFDVLRYDPTERYTALQCLCAPYFDEL 322

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score =  154 bits (390), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 157/308 (50%), Gaps = 26/308 (8%)

Query: 17  GEGTYAVVYLGTKKSTGR-----SIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVI 70
           G+G+Y VV     K         ++A+K+I    ++  L   A+RE+KF+   K H +++
Sbjct: 76  GKGSYGVVCSAKHKLDNEDQEQFTVAIKKITNIFYRKILLKRAIREIKFMNYFKGHKHIV 135

Query: 71  ELVDVFMAND----NLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
            L+D+ +  D     L    E +  DL  +I  +S+  S   I+ +I   L GV + H  
Sbjct: 136 NLIDIEIVQDKPYDGLYCYQELIDYDLARVIH-SSVQLSEFHIQHFIYQILCGVKYIHSA 194

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARLMAS--------PQEILTSNVVTRWYRAPEL 178
            ++HRDLKP N+L   +G LKI DFGLAR +A         P EI T+ V TRWYRAPEL
Sbjct: 195 DVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPNEI-TNYVATRWYRAPEL 253

Query: 179 LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSF 238
           +     YT +VD+WSVG I AE   R P   GKD + Q+    + LGTP+ +   +  + 
Sbjct: 254 ILSNNEYTKSVDMWSVGCILAEFYGRRPIFMGKDSIHQVYEIKKILGTPSRSLLVKYGTL 313

Query: 239 SNYNKIQIYPPPSREELRRR------FIAATENALELISGMMIMNPKKRWDAVKCLQSQY 292
             +N        + + L+        +  A+  AL+LI  ++   P+ R + ++ L+ Q+
Sbjct: 314 KAWNLFGHNSNHNLDNLKSGMPWSTVYPMASATALDLIDKLLQWEPESRLNVLQSLEHQF 373

Query: 293 FQELPEPT 300
            Q + +P 
Sbjct: 374 VQSVRKPN 381

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score =  152 bits (384), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 162/293 (55%), Gaps = 24/293 (8%)

Query: 16  AGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVNVIELVD 74
            G G++ VV+    + T   +A+K++ +  +FK+       RE++ ++ L+H N+I+L  
Sbjct: 43  VGHGSFGVVFTTVIQETNEKVAIKKVLQDKRFKN-------RELEIMKMLQHRNIIDLKY 95

Query: 75  VFMANDN-----LNLVLEFLPADLEIIIKDTSIMFSPA---DIKSWILMTLRGVHHCHRN 126
            F   D      LNL+L+++P  L   ++      +P    +IK ++    + +++ H  
Sbjct: 96  YFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKALNYLHHT 155

Query: 127 F-ILHRDLKPNNLLLAPDG-QLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
             + HRD+KP NLL+ P+   L++ DFG A+ +  P E   S + +R+YRAPEL+FGA +
Sbjct: 156 ANVCHRDIKPQNLLVDPNSWCLRLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGATN 214

Query: 185 YTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS-SFSNYNK 243
           YT+ +DIWS G + AEL+L  P  PG+  +DQ+    + LGTPT  +   ++ ++  +  
Sbjct: 215 YTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPTKQEICVMNPNYMEHKF 274

Query: 244 IQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQEL 296
            QI P P    L + F    E  ++ +S     +P +R+ +++CL + YF E+
Sbjct: 275 PQIKPIP----LAKVFKKEDEVTVDFLSNTFKYDPTQRYHSLQCLCTPYFDEI 323

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score =  155 bits (391), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 150/293 (51%), Gaps = 14/293 (4%)

Query: 14  KKAGEGTYAVVYLG--TKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVI 70
           K+ G G+Y +V     T+ +   ++A+K++     K  L   +LRE+K L+  + H N+ 
Sbjct: 29  KEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 88

Query: 71  ELVD---VFMAN---DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            L D   VF  +   + L L  E +  D+  I+K    + + A  +S+I   L G+ + H
Sbjct: 89  CLYDMDIVFQPDGMFNGLYLYEELMECDMHQIVKSGQPL-TDAHYQSFIYQILCGLKYIH 147

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP----QEILTSNVVTRWYRAPELLF 180
              +LHRDLKP NLL+  D QLKI DFGLAR  +       + LT  V TRWYRAPE++ 
Sbjct: 148 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 207

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + YT A+D+WS G I AEL+   P   GKD VDQ+N   + LGTP +     + S + 
Sbjct: 208 SYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNV 267

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
            + I       +      +  A  +AL L+ GM+  +P+ R      LQ  Y 
Sbjct: 268 QDYIHQLGYIPKIPFSTLYPNANPDALNLLEGMLSFDPQLRITVDDALQHPYL 320

>YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine
           protein kinase involved in the filamentous and invasive
           growth pathway, member of the MAP kinase family [1107
           bp, 368 aa]
          Length = 368

 Score =  152 bits (383), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 157/303 (51%), Gaps = 21/303 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-ALREVKFLQEL-KHVNVIELVD 74
           GEG Y  V     K +G  +A+K+I+   F   L ++  +RE+K L+   +H N+I ++D
Sbjct: 20  GEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKKLFVTRTIREIKLLRYFHEHENIISILD 77

Query: 75  VF--MANDNLN---LVLEFLPADLEIIIKDTSIMFSPAD---IKSWILMTLRGVHHCHRN 126
               ++ D LN   LV E +  DL+ +I + +  FS      ++ +    LR +   H  
Sbjct: 78  KVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSA 137

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE-------ILTSNVVTRWYRAPELL 179
            ++HRD+KP+NLLL  +  LK+ DFGLAR +AS  +        +T  V TRWYRAPE++
Sbjct: 138 QVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIM 197

Query: 180 FGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFS 239
              + YT+A+DIWS G I AE++   P  PG+D   Q+ +    LGTP+  D+ ++ S  
Sbjct: 198 LTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKR 257

Query: 240 NYNKIQIYP--PPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELP 297
               I   P  PP   E          + ++L+  M+  NP KR  A + L+  Y     
Sbjct: 258 AKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYH 317

Query: 298 EPT 300
           +P+
Sbjct: 318 DPS 320

>Kwal_23.5576
          Length = 504

 Score =  154 bits (389), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 151/300 (50%), Gaps = 14/300 (4%)

Query: 14  KKAGEGTYAVVYLG--TKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVI 70
           K+ G G Y +V      + +   ++A+K++     K  L   +LRE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 86

Query: 71  ELVD---VFMANDNLN---LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            L D   VF  N+  N   L  E +  D+  IIK    + + A  +S+I   L  + + H
Sbjct: 87  CLYDMDIVFSPNNTFNGLYLYEELMECDIHQIIKSGQPL-TDAHYQSFIYQLLCALKYIH 145

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP----QEILTSNVVTRWYRAPELLF 180
              +LHRDLKP NLL+  D QLK+ DFGLAR  +       + LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 205

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + YT A+DIWS G I AEL+   P   GKD VDQ+N   + LGTP +     + S + 
Sbjct: 206 SYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLERIGSKNV 265

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
            + I       +      +  A   AL+L+  M+  +P+KR    + L+  Y     +PT
Sbjct: 266 QDYIHQLGYIPKVPFVTLYPQANVQALDLLEKMLTFDPQKRITVEEALEHPYLSIWHDPT 325

>Kwal_27.12559
          Length = 414

 Score =  152 bits (384), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 163/316 (51%), Gaps = 28/316 (8%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTG---RSIAVKEIKTSQFKDGLDMSALREVKFL 61
           ST  +Y   +  G+G+Y VV     K      R +A+K++     ++ L   A+RE+KFL
Sbjct: 61  STPGNYEIIQVLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIRELKFL 120

Query: 62  QELK-HVNVIELVDVFMAN----DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMT 116
              K H N++ LVD+ + +    D L    E +  DL  +I  T + FS   IK ++   
Sbjct: 121 NFFKGHKNIVSLVDLEIVSEKPYDGLYCYQELVDYDLARVIHST-VQFSEFHIKHFLYQI 179

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQ-------EI-LTSNV 168
           L G+ + H   ++HRDLKP N+L +  G LKI DFGLAR +A PQ       EI +TS V
Sbjct: 180 LCGLKYIHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIA-PQYFEQKSDEIHITSYV 238

Query: 169 VTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPT 228
            TRWYRAPEL+   + YT A+DIW+VG I AE   R P   G D + Q++   + LG+P 
Sbjct: 239 ATRWYRAPELILSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEILKVLGSPC 298

Query: 229 DADWPEVSSFSNYNKIQIYPPPSREELRRR-----FIAATENALELISGMMIMNPKKRWD 283
                 V+ + +    +I+    R E+++      +  +  +A  L+  ++  +P KR  
Sbjct: 299 RET---VAKYCSARSWEIF--SGRSEVKKMPWSSVYPKSCSDAQALLDMLLTWDPDKRPG 353

Query: 284 AVKCLQSQYFQELPEP 299
               L   +F+++  P
Sbjct: 354 VEVALCHPFFEDVSNP 369

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score =  152 bits (385), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 151/300 (50%), Gaps = 6/300 (2%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           T+    + Y+     G G + +V   T   T + +A+K+I        L     RE+K L
Sbjct: 15  TVFEITNRYSDLNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFATAVLAKRTYRELKLL 74

Query: 62  QELKHVNVIELVDVFMAN-DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L+H N+I L D+F++  +++  V E    DL  +++   +      ++ +    LRG+
Sbjct: 75  KHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFHYQILRGL 132

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   ++HRDLKP+N+L+  +  LKI DFGLAR+   PQ  +T  V TR+YRAPE++ 
Sbjct: 133 KYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQ-DPQ--MTGYVSTRYYRAPEIML 189

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + Y   VDIWS G IFAE++   P  PGKD V Q ++    LG+P       + S + 
Sbjct: 190 TWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENT 249

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
              +   P         RF     +A++L+  M++ +PKKR  A   L   Y     +PT
Sbjct: 250 LKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYLAPYHDPT 309

>Scas_688.14
          Length = 479

 Score =  152 bits (384), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 149/300 (49%), Gaps = 14/300 (4%)

Query: 14  KKAGEGTYAVVYLG--TKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVI 70
           K+ G G Y +V      +     ++A+K++     K  L   +LRE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLRELKLLRHFRGHKNIT 86

Query: 71  ELVD---VFMANDNLN---LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            L D   VF  +   N   L  E +  D+  IIK +S   + A  +S+I   L G+ + H
Sbjct: 87  CLYDMDIVFYPDGTFNGLYLYEELMECDMHQIIK-SSQPLTDAHYQSFIYQILCGLKYIH 145

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP----QEILTSNVVTRWYRAPELLF 180
              +LHRDLKP NLL+  D QLKI DFGLAR  +       + LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 205

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + YT A+DIWS G I AE +   P   GKD VDQ+    + LGTP D     + S + 
Sbjct: 206 SYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVLGTPPDETLRRIGSKNV 265

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
            + I       +      +  A   AL+L+  M+  +P+KR    + L+  Y     +P+
Sbjct: 266 QDYIHQLGYIPKVPFVNLYPDANPQALDLLEKMLAFDPQKRITTDEALEHPYLSIWHDPS 325

>KLLA0D11814g complement(1007240..1009021) similar to sp|P39073
           Saccharomyces cerevisiae YPL042c SSN3 cyclin-dependent
           CTD kinase, start by similarity
          Length = 593

 Score =  154 bits (388), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 152/283 (53%), Gaps = 28/283 (9%)

Query: 37  AVKEIKTS----QFKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPAD 92
           A+K+ KT     +   G+  SA RE+   +EL + ++ +LV++F+   ++ +V EF   D
Sbjct: 209 AIKKFKTEREGVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHD 268

Query: 93  LEIIIKDTSI----MFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKI 148
           L  II   S     +  P  +KS +   L GV + H+N+ILHRDLKP N+++  DG +KI
Sbjct: 269 LLQIIHFHSHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKI 328

Query: 149 ADFGLARLMASPQEILTSN---VVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRI 205
            D GLAR   +  + L +    +VT WYRAPEL+ GA+HYT A+D+W+VG IFAEL+   
Sbjct: 329 GDLGLARKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLR 388

Query: 206 PYLPGKD-----------DVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYP-PPSRE 253
           P   G++             +Q       +G+P    WP + S+  Y  +Q+   P  R+
Sbjct: 389 PIFKGEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEY--LQLAKMPKYRD 446

Query: 254 ELRRRFIAAT---ENALELISGMMIMNPKKRWDAVKCLQSQYF 293
            L   +  A    + AL+++  ++  +P KR DA+  L   YF
Sbjct: 447 NLTAWYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYF 489

>Scas_623.11
          Length = 378

 Score =  149 bits (377), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 165/294 (56%), Gaps = 28/294 (9%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVNVIELVDV 75
           G+G++ +V+  T + T   +A+K++ +  +FK+       RE++ ++ ++H NVI L   
Sbjct: 54  GKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKN-------RELEIMKLIQHPNVINLKYY 106

Query: 76  FMAND-----NLNLVLEFLPADL-----EIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
           F   D      LNL+L+++P  L       + +  S+  S  +IK ++    + +++ H 
Sbjct: 107 FYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSM--SRLEIKFYMFQLFKSLNYLHN 164

Query: 126 -NFILHRDLKPNNLLLAPDG-QLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
              + HRD+KP N+L+ P+   LK+ DFG A+ +  P E   S + +R+YRAPEL+FGA 
Sbjct: 165 AKNVCHRDIKPQNILVDPNSWNLKLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGAT 223

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS-SFSNYN 242
           +Y++ +DIWS G + AEL+L  P  PG+  +DQ+    + LGTP+  +   ++ ++  + 
Sbjct: 224 NYSNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEHK 283

Query: 243 KIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQEL 296
             QI P P    L + F    E  ++ +   +  +P +R+++++CL S YF EL
Sbjct: 284 FPQIKPIP----LAKVFKKEDELTVDFLINTLKYDPMERFNSLQCLCSTYFDEL 333

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score =  150 bits (380), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 150/292 (51%), Gaps = 14/292 (4%)

Query: 14  KKAGEGTYAVVYLG--TKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVI 70
           K+ G G Y +V      + +   ++A+K++     K  L   +LRE+K L+  + H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 86

Query: 71  ELVD---VFMANDNLN---LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            L D   VF  + ++N   L  E +  D+  IIK    + + A  +S+    L G+ + H
Sbjct: 87  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPL-TDAHYQSFTYQILCGLKYIH 145

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA-SPQE---ILTSNVVTRWYRAPELLF 180
              +LHRDLKP NLL+  D QLKI DFGLAR  + +P E    LT  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIML 205

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + YT A+D+WS G I AE +   P   GKD V+Q+N   + LGTP D     + S + 
Sbjct: 206 SYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNV 265

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQY 292
            + I       +      +  A   AL+L+  M+  +P+KR    + L+  Y
Sbjct: 266 QDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPY 317

>Scas_680.20
          Length = 482

 Score =  150 bits (379), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 102/295 (34%), Positives = 156/295 (52%), Gaps = 26/295 (8%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVNVIELVDV 75
           G G++ +V        G  +A+K+I +  +FK+       RE+  L+ L H N+I L   
Sbjct: 174 GSGSFGLVLKAKTLHNGEIVALKKIIQNKKFKN-------RELHMLRLLDHPNIISLKYF 226

Query: 76  FMA---NDN--LNLVLEFLPADLEIIIKDTSIMFSPA------DIKSWILMTLRGVHHCH 124
           F+    ND   LNL+ EF+P  L   I+  +   S        + K ++    + + + H
Sbjct: 227 FVEPIDNDESYLNLIFEFVPLSLYQRIRQVATTTSSVQPSHKLEFKCYMWQIFKALDYLH 286

Query: 125 RNF-ILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
               I HRD+KP N+L+ P D  LKI DFG A+ + +P +   S + +R+YRAPEL+ GA
Sbjct: 287 NEVNICHRDIKPQNILIDPMDWSLKICDFGSAKRL-NPHDKNVSFICSRFYRAPELILGA 345

Query: 183 KHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYN 242
             YT+++D+WS G +FAEL+L  P+  GK D DQI    R LGTPT  D   +S   NY 
Sbjct: 346 IQYTNSIDLWSTGCVFAELLLLKPFFAGKSDTDQIVEIIRILGTPTLKDI--ISMNENYK 403

Query: 243 KIQIYPPPSREELRRRFIAATE-NALELISGMMIMNPKKRWDAVKCLQSQYFQEL 296
             + +P        R F    E +A++L+  ++  +P +R D+ KCL   YF +L
Sbjct: 404 DYR-FPRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTERIDSSKCLIHPYFDDL 457

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score =  149 bits (377), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 150/300 (50%), Gaps = 6/300 (2%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           T+    + Y      G G + +V       T + +A+K+I        L     RE+K L
Sbjct: 21  TVFEITNRYADLNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFSTAVLAKRTYRELKLL 80

Query: 62  QELKHVNVIELVDVFMAN-DNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L+H N+I L D+F++  +++  V E    DL  +++   +      ++ ++   LRG+
Sbjct: 81  KHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFLQYFLYQILRGL 138

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   ++HRDLKP+N+L+  +  LKI DFGLAR+   PQ  +T  V TR+YRAPE++ 
Sbjct: 139 KYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ-DPQ--MTGYVSTRYYRAPEIML 195

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             + Y   VDIWS G IFAE++   P  PGKD V Q ++    LG+P       + S + 
Sbjct: 196 TWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENT 255

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
              +   P         RF     +A++L+  M++ +PKKR  A   L   Y     +PT
Sbjct: 256 LKFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHPYLAPYHDPT 315

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score =  149 bits (377), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 157/302 (51%), Gaps = 18/302 (5%)

Query: 14  KKAGEGTYAVV----YLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVN 68
           K+ G G Y +V    ++ + + T  ++A+K++     K  L   +LRE+K L+  + H N
Sbjct: 27  KEIGYGAYGIVCSARFMESVEDT--TVAIKKVTNVFSKALLCKRSLRELKLLRHFRGHKN 84

Query: 69  VIELVDVFM------ANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
           +  L D+ +      + + L+L  E +  D+  IIK    + + A  +S++   L G+ +
Sbjct: 85  ITCLYDMDIVLLPDGSFNGLDLYEELMEWDMHQIIKSGQPL-TDAHYQSFVYQILCGLKY 143

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP----QEILTSNVVTRWYRAPEL 178
            H   +LHRDLKP NLL+  D QLKI DFGLAR  +       + LT  V TRWYRAPE+
Sbjct: 144 IHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEYVATRWYRAPEI 203

Query: 179 LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSF 238
           +   + YT A+D+WS G + AEL+   P   GKD VDQ+N   + LGTP +     + S 
Sbjct: 204 MLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSK 263

Query: 239 SNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPE 298
           +  + I       +    R +  A  +A +L+  M+ ++PK R    + L+  Y     +
Sbjct: 264 NVQDYIHQLGYIPKVPFERLYPNANPDAADLLERMLALDPKTRITVDEALEHPYLSIWHD 323

Query: 299 PT 300
           P+
Sbjct: 324 PS 325

>Scas_667.18
          Length = 437

 Score =  147 bits (370), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 159/314 (50%), Gaps = 32/314 (10%)

Query: 14  KKAGEGTYAVVYLGTKK---STGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNV 69
           K  G+G+Y VV         +    +A+K++     K+ L   A+RE+KF+   + H N+
Sbjct: 82  KVLGKGSYGVVCSAMDNKNPANAYPVAIKKVTNIFQKEILLKRAIRELKFMNFFQGHKNI 141

Query: 70  IELVDVFMANDN-----LNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
           + L+D+ + N+N     L    E +  DL  +I  +SI  +   I+ ++   L G+ + H
Sbjct: 142 VNLIDLEIINENSPYDGLYCYQELIDYDLAKVIH-SSIKLTEFHIQYFMYQILSGLKYIH 200

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARL-----------MASPQ-EILTSNVVTRW 172
              ++HRDLKP N+L   +G LKI DFGLAR            +ASP+   +T+ V TRW
Sbjct: 201 SADVIHRDLKPGNILCTLNGNLKICDFGLARGINPKFYNDNGNLASPKLHDITNYVATRW 260

Query: 173 YRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADW 232
           YRAPEL+   K YT A+D+WSVG I AE   R P   G D + Q+    + LG P+    
Sbjct: 261 YRAPELILSHKMYTKAIDLWSVGCILAEFYGRRPIFMGHDTLHQVYEIVKILGPPSQRLL 320

Query: 233 PEVSSFSNYN-------KIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAV 285
            + +S   YN       K+    P   + L   +  A+ +++ L+  ++  NP++R+D  
Sbjct: 321 SQFASVKAYNIFNNNLAKLHWNSPIDWKTL---YPEASNSSIHLLQNLLKWNPRERFDVE 377

Query: 286 KCLQSQYFQELPEP 299
           + +   +  E+  P
Sbjct: 378 QAITHPFLNEVRTP 391

>AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH]
           (234347..236092) [1746 bp, 581 aa]
          Length = 581

 Score =  149 bits (375), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 154/284 (54%), Gaps = 28/284 (9%)

Query: 37  AVKEIKTSQ------FKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLP 90
           A+K+ KT +         G+  SA RE+   +EL + ++ +LV++F+   ++ +V EF  
Sbjct: 193 AIKKFKTEREGVEQLHYTGISQSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAE 252

Query: 91  ADLEIIIKDTSI----MFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQL 146
            DL  II   S     + +P  +KS +   L GV + H+N+ILHRDLKP N+++  DG +
Sbjct: 253 HDLLQIIHFHSHPEKRLIAPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCV 312

Query: 147 KIADFGLARLMASPQEILTSN---VVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML 203
           KI D GLAR   +  + L +    VVT WYRAPELL GA+HY+ A+D+W+VG IF+EL+ 
Sbjct: 313 KIGDLGLARKFYNLVQTLYTGDKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFSELIG 372

Query: 204 RIPYLPGKD-----------DVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSR 252
             P   G++             +Q+      LGTPT   WP +  +  Y ++  +    R
Sbjct: 373 LRPIFKGEEAKMDSKKSVPFQGNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKF-SKYR 431

Query: 253 EELRRRFIAAT---ENALELISGMMIMNPKKRWDAVKCLQSQYF 293
           + L   + ++    + AL L+  ++  +P  R DA+  L+ +YF
Sbjct: 432 DNLSVWYHSSGGRDKAALSLLYSLLKYDPITRIDAIDALEHEYF 475

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score =  145 bits (366), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/327 (30%), Positives = 161/327 (49%), Gaps = 37/327 (11%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGR--------------SIAVKEIKTSQFKDGLDMSAL 55
           YTK   +  G Y V+ +  K S G                IA+K+I     ++ L   A+
Sbjct: 62  YTKANFSIPGHYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRAI 121

Query: 56  REVKFLQELK-HVNVIELVDVFMAN----DNLNLVLEFLPADLEIIIKDTSIMFSPADIK 110
           RE+KF+   K H N++ L+++ + N    D L    E +  DL  +I  +++ FS   IK
Sbjct: 122 RELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIH-SNVQFSEFHIK 180

Query: 111 SWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA------SPQEIL 164
            +    L GV + H   ++HRDLKP N+L +  GQLKI DFGLAR ++           +
Sbjct: 181 HFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNHI 240

Query: 165 TSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRAL 224
           T+ V TRWYRAPEL+   K Y  ++D+W++G I AE   R P   G+D + QI+   + L
Sbjct: 241 TNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVKVL 300

Query: 225 GTPTDADWPEVSSFSNYNKIQIYPPPSREELR----RRFIAATENALELISGMMIMNPKK 280
           GTP+     +  S   Y+   I+ PP  +  +      +  A  +AL+LI  ++  +P +
Sbjct: 301 GTPSRDTIIKYGSSRAYD---IFCPPKPQYAKIPWAEIYPFAGPDALDLIERLLDWDPDR 357

Query: 281 RWDAVKCLQSQYFQEL----PEPTLPQ 303
           R    + ++  + + +     EP  P 
Sbjct: 358 RLTVEEAIEHDFVKSVRDVNDEPCCPH 384

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score =  144 bits (364), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/332 (30%), Positives = 157/332 (47%), Gaps = 50/332 (15%)

Query: 16  AGEGTYAVVYLGTKKSTGRSIAVKEIK---TSQFKDGLDMSAL----------------- 55
            GEG+Y +V   T   TG  +A+K I+   +    DG  +  L                 
Sbjct: 19  VGEGSYGIVCSATHLPTGNKVAIKRIRFPDSPPSDDGQGVPRLEEDDEHDNIAKVALIRT 78

Query: 56  -REVKFLQELK-HVNVIELVDVFMANDNLN-----LVLEFLPADLEIIIKDTSIMFSPAD 108
            RE+K L     H N+I + +      ++N     LV E +  DL  I+  ++ + +   
Sbjct: 79  IREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRILASSNTL-TVDH 137

Query: 109 IKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR----------LMA 158
           I+ ++   LR +   H   ++HRDLKP+N+LL  +  LKI DFGLAR          +  
Sbjct: 138 IQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTYDPDDDASTMNG 197

Query: 159 SPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQIN 218
           +    LT  V TRWYRAPE++   + Y++A+DIWS G + AE++ R P  PGKD   Q+ 
Sbjct: 198 NNVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPGKDYHHQLL 257

Query: 219 VTFRALGTPTDADWPEVSSFSNYNKIQIY----PPPSREELRRRFIAATENALELISGMM 274
           +    LGTP+    PE     NY + + Y    P   +++  +      E  L+++  +M
Sbjct: 258 LILDTLGTPS----PEDIEAINYGRAKEYILSLPHFPKKDWSQLLGTDNEMLLDILDKLM 313

Query: 275 IMNPKKRWDAVKCLQ----SQYFQELPEPTLP 302
           I NPK+R  A + L+    + Y     EP  P
Sbjct: 314 IFNPKRRITAEQALEHPFLATYHDPKDEPNFP 345

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score =  142 bits (357), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 91/299 (30%), Positives = 152/299 (50%), Gaps = 17/299 (5%)

Query: 17  GEGTYAVVYLGTKKSTGR---SIAVKEIKTSQFKDGLDMSALREVKFLQELK-HVNVIEL 72
           G+G+Y  V     K        +A+K++ +   ++ L   A+RE+KF+   K H N++ L
Sbjct: 80  GKGSYGTVVSAVDKGNPTHEVQLAIKKVTSIFTREILLKRAIRELKFMSYFKGHRNIVSL 139

Query: 73  VDVFMAND----NLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           +D+ + N+     L    E +  DL  +I  ++++FS   IK ++   L G+ + H   +
Sbjct: 140 IDLEIVNEEPYSGLYCYQELVDYDLARVIH-SNVLFSEFHIKHFLYQILCGMKYIHSADV 198

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEI-------LTSNVVTRWYRAPELLFG 181
           +HRDLKP N+L +  G++KI DFGLAR ++    +       +T+ V TRWYRAPEL+  
Sbjct: 199 IHRDLKPGNILCSITGEIKICDFGLARGISPSFTVAGGISNHITNYVATRWYRAPELILS 258

Query: 182 AKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNY 241
            K Y+ +VD+W+VG I AE   R P   G D + Q+    + LGTP         S   Y
Sbjct: 259 HKRYSKSVDMWAVGCILAEFYGRKPVFMGNDSLHQVMEIQKILGTPKQIVIRTYGSSRCY 318

Query: 242 NKIQIYPPPSREE-LRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEP 299
           +      P  ++      F  A+  A++L+  ++  NP+ R    + L   + Q++  P
Sbjct: 319 DIFSTSKPQYKKTPWCEIFPYASSEAVDLMERLIDWNPEARLTVEEALDHPFLQQVRNP 377

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score =  131 bits (329), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 154/302 (50%), Gaps = 23/302 (7%)

Query: 6   TVD-DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQE 63
           T+D  Y   +  G G++ VV       T + +A+K++ +  ++K+       RE++ ++ 
Sbjct: 159 TIDISYPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKN-------RELETMKM 211

Query: 64  LKHVNVIELVDVFMANDN-----LNLVLEFLPADLEIIIK---DTSIMFSPADIKSWILM 115
           L H N + L   F   D      LNLVL+++P  L   ++   +  +     +IK +   
Sbjct: 212 LCHPNTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQ 271

Query: 116 TLRGVHHCHR-NFILHRDLKPNNLLLAPDG-QLKIADFGLARLMASPQEILTSNVVTRWY 173
             + +++ H    I HRD+KP NLL+ P     KI DFG A+ +  P +   S + +R+Y
Sbjct: 272 LFKALNYLHNVPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCL-KPDQPNVSYICSRYY 330

Query: 174 RAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWP 233
           RAPEL+FGA +Y++ VD+WS   + AEL+L  P   G+  +DQ+    + +G PT     
Sbjct: 331 RAPELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGIPTKD--- 387

Query: 234 EVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
           E+S  +   +  ++P      L   F A   + L+L++  +  +P +R   ++CL S YF
Sbjct: 388 EISGMNPNYEDHVFPNIKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPLQCLLSSYF 447

Query: 294 QE 295
            E
Sbjct: 448 DE 449

>Scas_22.1
          Length = 248

 Score =  122 bits (306), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 126/227 (55%), Gaps = 26/227 (11%)

Query: 82  LNLVLEFLPADLEIIIKDTSIMFS--PA-DIKSW---ILMTLRGVHHCHRNFILHRDLKP 135
           LNLVLE++P+ L   ++      S  PA ++K +   +  +L  +H C R  + HRD+KP
Sbjct: 26  LNLVLEYMPSSLYQRLRHFVTHRSNMPAIEVKLYMYQLFKSLNYLHTCAR--VCHRDIKP 83

Query: 136 NNLLLAPDG-QLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSV 194
            NLL+ P    LK+ DFG A+ +  P E   S + +R+YRAPEL+FGA +YT+ +D+WS 
Sbjct: 84  QNLLVDPTTFSLKLCDFGSAKQL-KPTEPNVSYICSRYYRAPELIFGATNYTTQIDVWSS 142

Query: 195 GVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS-SFSNYNKIQIYPPPSRE 253
           G + AEL+L  P  PG+  +DQ+    + LGTP   +   ++ ++ ++   QI P P   
Sbjct: 143 GCVMAELILGQPMFPGESGIDQLVEIIKILGTPNKREICAMNPNYMDHKFPQIVPIP--- 199

Query: 254 ELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPT 300
            L + F    E  ++            ++ A++CL + YF EL +P+
Sbjct: 200 -LNKVFKREQEETVQ-----------SKFTALQCLCASYFDELRQPS 234

>Scas_660.28
          Length = 623

 Score =  126 bits (316), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/306 (30%), Positives = 154/306 (50%), Gaps = 41/306 (13%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQE 63
           S + +Y   K  GEG++  V L    +TG+ +A+K I K    K  +     RE+ +L+ 
Sbjct: 41  SHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRL 100

Query: 64  LKHVNVIELVDVFMANDNLNLVLEFLPADL--EIIIKDTSIMFSPADIKSWILMTLRGVH 121
           L+H ++I+L DV  + D + +V+E+   +L   I+ +D     S  + + +    +  V 
Sbjct: 101 LRHPHIIKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDK---MSEDEARRFFQQIISAVE 157

Query: 122 HCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
           +CHR+ I+HRDLKP NLLL     +KIADFGL+ +M      L ++  +  Y APE++ G
Sbjct: 158 YCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISG 216

Query: 182 AKHYTSAVDIWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
             +    VD+WS GVI +  L  R+P+     D + I V F+ +                
Sbjct: 217 KLYAGPEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNINN-------------- 257

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQE-LPEP 299
                +Y  P       +F+  ++ A  LI  M+I+NP  R    + +Q ++F+  LPE 
Sbjct: 258 ----GVYTIP-------KFL--SQGASTLIKKMLIVNPLNRISIQEIMQDEWFKAGLPEY 304

Query: 300 TLPQDL 305
            +PQDL
Sbjct: 305 LIPQDL 310

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  124 bits (312), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 94/304 (30%), Positives = 153/304 (50%), Gaps = 37/304 (12%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQE 63
           S V +Y   K  GEG++  V L    +TG+ +A+K I K    K  +     RE+ +L+ 
Sbjct: 34  SRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRL 93

Query: 64  LKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           L+H ++I+L DV  + D + +V+E+   +L   I   + M S  + + +    +  V +C
Sbjct: 94  LRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRNKM-SEQEARRFFQQIISAVEYC 152

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           HR+ I+HRDLKP NLLL     +KIADFGL+ +M      L ++  +  Y APE++ G  
Sbjct: 153 HRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKL 211

Query: 184 HYTSAVDIWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYN 242
           +    VD+WS GVI +  L  R+P+     D + I V F+ +                  
Sbjct: 212 YAGPEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNISNG--------------- 251

Query: 243 KIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ-ELPEPTL 301
              +Y  P       +F++    A +LI  M+I+NP  R    + +Q ++F+ +L E  +
Sbjct: 252 ---VYTLP-------KFLSP--GASDLIKRMLIVNPLNRISIHEIMQDEWFKVDLAEYLV 299

Query: 302 PQDL 305
           PQDL
Sbjct: 300 PQDL 303

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  122 bits (306), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 151/304 (49%), Gaps = 41/304 (13%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELK 65
           + +Y   K  GEG++  V L    +TG+ +A+K I K    K  +     RE+ +L+ L+
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 111

Query: 66  HVNVIELVDVFMANDNLNLVLEFLPADL--EIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           H ++I+L DV  + D + +V+E+   +L   I+ +D     S  + + +    +  V +C
Sbjct: 112 HPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDK---MSEQEARRFFQQIISAVEYC 168

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           HR+ I+HRDLKP NLLL     +KIADFGL+ +M      L ++  +  Y APE++ G  
Sbjct: 169 HRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKL 227

Query: 184 HYTSAVDIWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYN 242
           +    VD+WS GVI +  L  R+P+     D + I V F+ +                  
Sbjct: 228 YAGPEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNISN---------------- 266

Query: 243 KIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ-ELPEPTL 301
              +Y  P       +F++    A  LI  M+I+NP  R    + +Q  +F+ +LPE  L
Sbjct: 267 --GVYTLP-------KFLSP--GAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLL 315

Query: 302 PQDL 305
           P DL
Sbjct: 316 PPDL 319

>Scas_678.13
          Length = 462

 Score =  120 bits (302), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 138/288 (47%), Gaps = 14/288 (4%)

Query: 19  GTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS--ALREVKFLQELK-HVNVIELVD- 74
           G+Y +V   +   +  +I +   K S        S  ALRE+K LQ    H N+I L D 
Sbjct: 32  GSYGIVLSASYSHSSENIVIAIKKISNIFGSTQSSKRALRELKLLQAFNGHKNIISLYDM 91

Query: 75  --VFMANDNLNLVL---EFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFIL 129
             VF     LN +    E +  D+E IIK    + +    + +I   L G+ + H   I+
Sbjct: 92  DIVFYPTGILNGIYIYEELMECDMEQIIKSRQPL-TEYHYQFFIYQILCGLRYIHSADII 150

Query: 130 HRDLKPNNLLLAPDGQLKIADFGLARL----MASPQEILTSNVVTRWYRAPELLFGAKHY 185
            R+++P+NLL+  D +LKI  F LA+     +A+  +     + TRWY APELL     Y
Sbjct: 151 MRNVRPSNLLINSDCKLKICGFSLAQKASNGVANNNQFSPEYLTTRWYHAPELLLNHHIY 210

Query: 186 TSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQ 245
           T+++D+WS G +  EL+ + P     D V+Q+N  F+ LGT +      + S +  N + 
Sbjct: 211 TTSIDVWSTGCVLGELITKEPIFHENDFVNQLNKIFQILGTHSKEALDNIGSKTIKNHVS 270

Query: 246 IYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
             P   +  +   F  AT    +L++ M+  + ++R      L+  YF
Sbjct: 271 QLPYIPKPPMENIFPGATTECQDLLNKMLKFDSEQRITVDMALRHPYF 318

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  118 bits (295), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 152/304 (50%), Gaps = 41/304 (13%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELK 65
           +  Y   K  GEG++  V L    STG+ +A+K I K    K  +     RE+ +L+ L+
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLR 95

Query: 66  HVNVIELVDVFMANDNLNLVLEFLPADL--EIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           H ++I+L DV  + D + +V+E+   +L   I+ +D     S  + + +    +  V +C
Sbjct: 96  HPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDK---MSENEARRFFQQIISAVEYC 152

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           HR+ I+HRDLKP NLLL     +KIADFGL+ +M      L ++  +  Y APE++ G  
Sbjct: 153 HRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKL 211

Query: 184 HYTSAVDIWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYN 242
           +    VD+WS GVI +  L  R+P+     D + I V F+ +                  
Sbjct: 212 YAGPEVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISN---------------- 250

Query: 243 KIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ-ELPEPTL 301
              +Y  P       +F+  ++ A  LI  M+I+NP  R    + ++ ++F+ +LP+  +
Sbjct: 251 --GVYSIP-------KFL--SQGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDLPDYLV 299

Query: 302 PQDL 305
           P D+
Sbjct: 300 PVDM 303

>Kwal_26.7276
          Length = 646

 Score =  116 bits (291), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 137/281 (48%), Gaps = 39/281 (13%)

Query: 51  DMSALREVKFLQEL-KHVNVIELVDVFM--ANDNLNLVLEFLPADL-EIIIKDTSIMFSP 106
           D + +REVKF+  +  H N++++ ++F+   N  L++V+E +  +L +++      +FS 
Sbjct: 123 DYTRVREVKFILSMPAHRNLVQIWELFIDDVNYQLHIVMECMEQNLYQLMRARRKRVFSL 182

Query: 107 ADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKIA 149
             +KS +   + G+ H H +   HRDLKP N+L++P                    +KIA
Sbjct: 183 PSLKSILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNYVVKIA 242

Query: 150 DFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLP 209
           D+GLAR + + +   T+ V TRWYR+PE+L     Y+  +DIW+ G +  E+    P  P
Sbjct: 243 DYGLARHVTN-KSPYTAYVSTRWYRSPEILLRKGSYSRPLDIWAFGCVVVEVATFRPLFP 301

Query: 210 GKDDVDQINVTFRALGTPTDADWPEVSSF----SNYNKIQIYPPPSREELRRRFIAAT-- 263
           G D++DQI      LGTP       +S +     ++ K ++    SR  L+  ++  T  
Sbjct: 302 GSDEMDQIWKILEVLGTPHTMSESAISGYQPHGGSWEKAEVL--ASRLNLKFPYVEGTSI 359

Query: 264 ---------ENALELISGMMIMNPKKRWDAVKCLQSQYFQE 295
                    +   E++   +  +PKKR    +     YF E
Sbjct: 360 ESIVANPHLQELCEVVKECLTWDPKKRATVDEICAMPYFAE 400

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score =  115 bits (288), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/297 (28%), Positives = 143/297 (48%), Gaps = 56/297 (18%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYL---------------------------GTKKSTGRS 35
           LK+  D Y   +K G G++  V L                           G +    ++
Sbjct: 31  LKTLSDRYQLIEKLGAGSFGCVTLAKAQFPLSNILGKQHDIRGTLMDQPKNGHQNYITKT 90

Query: 36  IAVKEIKT--SQFKDGLDMSALREVKFLQEL-KHVNVIELVDVFMANDN--LNLVLEFLP 90
             V  IKT  ++     D + +RE+KF+  +  + ++I++ +VF+ ++N  L++V+E + 
Sbjct: 91  QGVVAIKTMMTKLHTLQDYTRVREIKFILAIPANDHLIQIFEVFIDSENYQLHIVMECME 150

Query: 91  ADLEIIIKDTSI-MFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ---- 145
            +L  ++K     +FS   +KS +   L G+ H H +   HRDLKP N+L+ P  Q    
Sbjct: 151 QNLYQMMKHRRRRVFSIPSLKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEK 210

Query: 146 -------------LKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
                        +K+ADFGLAR + + +   T+ V TRWYR+PE+L  + +Y+  +DIW
Sbjct: 211 EYMNQIGYQDNYVIKLADFGLARHVEN-KNPYTAYVSTRWYRSPEILLRSGYYSKPLDIW 269

Query: 193 SVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPP 249
           + G +  E+ +     PG +++DQI      LGTP      + S F N N I   PP
Sbjct: 270 AFGCVAVEVTVFRALFPGANEIDQIWKILEVLGTPI-----KRSDFVNTNHITAPPP 321

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  115 bits (287), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 147/294 (50%), Gaps = 41/294 (13%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVNVIEL 72
           K  GEG++  V L    STG+ +A+K I K    K  +     RE+ +L+ L+H ++I+L
Sbjct: 39  KTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 98

Query: 73  VDVFMANDNLNLVLEFLPADL--EIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
            DV  + D + +V+E+   +L   I+ +D        + + +    +  V +CHR+ I+H
Sbjct: 99  YDVIKSKDEIIMVIEYAGNELFDYIVQRDK---MPEQEARRFFQQIISAVDYCHRHKIVH 155

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVD 190
           RDLKP NLLL     +KIADFGL+ +M      L ++  +  Y APE++ G  +    VD
Sbjct: 156 RDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKLYAGPEVD 214

Query: 191 IWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPP 249
           +WS GVI +  L  R+P+     D + I V F+ +                     +Y  
Sbjct: 215 VWSSGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------VYTI 251

Query: 250 PSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ-ELPEPTLP 302
           P+       F+  ++ A  LI  M+I+NP  R    + +Q ++F+ +LP+  +P
Sbjct: 252 PN-------FL--SQGAASLIKKMLIVNPVNRITVHEIMQDEWFKVDLPDYLVP 296

>Kwal_47.18233
          Length = 598

 Score =  114 bits (286), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 89/297 (29%), Positives = 148/297 (49%), Gaps = 41/297 (13%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFLQELKHVNVIEL 72
           K  GEG++  V L    +TG+ +A+K I K    K  +     RE+ +L+ L+H ++I+L
Sbjct: 35  KTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 94

Query: 73  VDVFMANDNLNLVLEFLPADL--EIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
            DV  + D + +V+E+   +L   I+ +D     S  + + +    +  V +CHR+ I+H
Sbjct: 95  YDVVKSKDEIVMVIEYAGNELFDYIVQRDK---MSENEARRFFQQIISAVEYCHRHKIVH 151

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVD 190
           RDLKP NLLL     +KIADFGL+ +M      L ++  +  Y APE++ G  +    VD
Sbjct: 152 RDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLRTSCGSPNYAAPEVISGKLYAGPEVD 210

Query: 191 IWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPP 249
           +WS GVI +  L  R+P+     D + I V F+ +                     IY  
Sbjct: 211 VWSSGVILYVMLCRRLPF-----DDESIPVLFKNISN------------------GIYTL 247

Query: 250 PSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ-ELPEPTLPQDL 305
           P       +F++    A  LI  M+I+NP  R    + +Q ++F+ ++ +  +P DL
Sbjct: 248 P-------KFLSP--GAANLIKRMLIVNPLNRITIHEIMQDEWFKVDMQDYLIPPDL 295

>Scas_711.15
          Length = 727

 Score =  113 bits (282), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 136/278 (48%), Gaps = 57/278 (20%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKK------------------------------ST 32
           LKS  D Y   ++ G G++  V L   K                               +
Sbjct: 31  LKSLYDRYQLIEELGNGSFGCVTLAKAKFDLINLSSNVHQCKGTLLDQTNTEYQNFIAKS 90

Query: 33  GRSIAVKEIKTSQFKDGLDMSALREVKFLQEL---KHVNVIELVDVF--MANDNLNLVLE 87
            R +A+K + T  +    D + +REVKF+  L   KH+  I++ ++F   +N  L++V+E
Sbjct: 91  QRLVAIKTMLTKLYT-LHDYTRVREVKFILALPTNKHL--IQIFEIFADTSNYQLHIVME 147

Query: 88  FLPADL-EIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ- 145
            +  +L ++++     +FS   +KS +   L G+ H H +   HRD+KP N+L++P+ + 
Sbjct: 148 CMEQNLYQMMLHRKKRVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVSPNKRY 207

Query: 146 ----------------LKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAV 189
                           +K+ADFGLAR + + +   T+ V TRWYR+PE+L    +Y++ +
Sbjct: 208 FDKERLELGFYPDNYVVKLADFGLARHVEN-KNTYTAYVSTRWYRSPEILLRNGYYSTPL 266

Query: 190 DIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
           DIW+ G +  E  +  P  PG +++DQI      LGTP
Sbjct: 267 DIWAFGCVAVEATIFKPLFPGSNELDQIWRILEVLGTP 304

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score =  112 bits (281), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 117/214 (54%), Gaps = 29/214 (13%)

Query: 51  DMSALREVKFLQEL---KHVNVIELVDVFMAND--NLNLVLEFLPADL-EIIIKDTSIMF 104
           D + +REVKF+  +   KH+  I++ ++F+ ++   L++ +E++  +L +++ +    +F
Sbjct: 122 DYTRVREVKFILSMTANKHL--IQVYEIFVDSEKYQLHIAMEYMEQNLYQMMRRRKKRVF 179

Query: 105 SPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LK 147
           S   +KS +   L G+ H H     HRDLKP N+L+ P  +                 +K
Sbjct: 180 SIPSLKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNYVVK 239

Query: 148 IADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPY 207
           +ADFGLAR + + +   T+ V TRWYR+PE+L  + +Y+  +DIW+ G +  E+ +  P 
Sbjct: 240 LADFGLARHVEN-KNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAMEVTVFKPL 298

Query: 208 LPGKDDVDQINVTFRALGTPTDADWPEVSSFSNY 241
            PG +++DQI      LGTP      E S  SNY
Sbjct: 299 FPGSNEIDQIWKILEVLGTPHTL---EESKNSNY 329

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score =  111 bits (278), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 140/290 (48%), Gaps = 40/290 (13%)

Query: 51  DMSALREVKF-LQELKHVNVIELVDVFMAND--NLNLVLEFLPADLEIIIK-DTSIMFSP 106
           D + +RE+KF LQ   H +++++ ++F+ +    L++V+E +  ++  ++K     +FS 
Sbjct: 107 DYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRKRRVFSL 166

Query: 107 ADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKIA 149
             ++S +   L G+ H H +   HRD+KP N+L++P  +                 +KIA
Sbjct: 167 PTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYPDNYVVKIA 226

Query: 150 DFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLP 209
           D+GLAR + + +   T+ V TRWYR+PE+L     Y+  +DIW+ G +  E+    P  P
Sbjct: 227 DYGLARHVTN-KSPYTAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVEVATFKPLFP 285

Query: 210 GKDDVDQINVTFRALGTPTDADWPEVSSFSNYNK--IQIYPPPSREELRRRFIAAT---- 263
           G D++DQI      LGTP      ++S +  +    +Q     SR  L+  ++       
Sbjct: 286 GADEMDQIWKILELLGTPHPCHESKISGYVPHGGAWLQAEHLASRLNLKFPYVEGKDISW 345

Query: 264 -------ENALELISGMMIMNPKKRWDAVKCLQSQYF-----QELPEPTL 301
                  E+  +++   ++ NP  R       Q  YF     QE  +P L
Sbjct: 346 VMCNPQLESLCDVVRACLVWNPDDRATVEDLSQMPYFAGTIVQETKQPPL 395

>CAGL0E01683g complement(166584..167711) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 or sp|Q12222
           Saccharomyces cerevisiae YOL128c, start by similarity
          Length = 375

 Score =  107 bits (268), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 149/306 (48%), Gaps = 33/306 (10%)

Query: 12  KEKKAGEGTYAVV---YLGTKKSTGRS-IAVKEIKT-SQFKDGLDMSALREVKFLQELKH 66
           + +K G G +  V   YL   + T     A+K++   +++K        RE++ L+   H
Sbjct: 37  EHRKIGRGAFGTVVQAYLTQDEQTWYGPFAIKKVPAQTEYKS-------RELQILRLTDH 89

Query: 67  VNVIELVDVFM---ANDN---LNLVLEFLPADLEIIIK---DTSIMFSPADIKSWILMTL 117
            N+++L   F      DN    +L +E LP  L+I I      ++  +   +K +     
Sbjct: 90  PNIVKLEYFFTHTSPKDNKVYQHLAMECLPETLQIEINRYTSNNLQLAIKHVKLYSYQIA 149

Query: 118 RGVHHCHRNFILHRDLKPNNLLLAPD-GQLKIADFGLARLMASPQEILTSNVVTRWYRAP 176
           RG+ + H   I HRD+KP+N+L+ P  G LKI DFG A+ +  P +   S + +R+YRAP
Sbjct: 150 RGMLYLHALGICHRDIKPSNILVDPKTGVLKICDFGSAKRL-EPNQPSISYICSRFYRAP 208

Query: 177 ELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVS 236
           EL+ G+  YT+ VDIW +G +  E+++      G+D + Q+    + LG P      +  
Sbjct: 209 ELILGSTQYTTQVDIWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLGPPDK----KFI 264

Query: 237 SFSNYNKIQ-IYPPP-----SREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQS 290
            FSN      +Y  P     S E  ++ F  A  + ++L+  ++   P+ R+   + +  
Sbjct: 265 FFSNPRYTGPLYSTPLFNGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRFSPRRIMAH 324

Query: 291 QYFQEL 296
            +F +L
Sbjct: 325 PFFDDL 330

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score =  108 bits (271), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 109/198 (55%), Gaps = 22/198 (11%)

Query: 51  DMSALREVKF-LQELKHVNVIELVDVFMAND--NLNLVLEFLPADLEIIIKDTSI-MFSP 106
           D + +RE+KF LQ   H N++ + ++F+ +   +L++V+E +  ++  ++K     +FS 
Sbjct: 107 DYTRVREIKFILQIPAHKNLVTIYEMFIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSL 166

Query: 107 ADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-----------------LKIA 149
             ++S +   L G+ H H +   HRD+KP N+L++P  +                 +K+A
Sbjct: 167 PTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYSDNYVVKLA 226

Query: 150 DFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLP 209
           D+GLAR + + +   T+ V TRWYR+PE+L    +Y+  +DIW+ G +  EL    P  P
Sbjct: 227 DYGLARHVNN-RSPYTTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVELATFSPLFP 285

Query: 210 GKDDVDQINVTFRALGTP 227
           G D+ DQI      LG+P
Sbjct: 286 GSDETDQIWRILDLLGSP 303

>Scas_635.1
          Length = 378

 Score =  103 bits (257), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 147/309 (47%), Gaps = 32/309 (10%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRS-IAVKEIKT-SQFKDGLDMSALREVKFLQEL 64
           + +Y K  +   GT    Y+   K       A+K++   +++K        RE++ L+  
Sbjct: 39  IQEYRKIGRGAFGTVVQAYITPNKEDWYGPFAIKKVPAQTEYKS-------RELEILRIT 91

Query: 65  KHVNVIELVDVFM---ANDN---LNLVLEFLPADLEIIIK---DTSIMFSPADIKSWILM 115
            H N+++L   F      D+    +L +E LP  L+I I       +  +   +K +   
Sbjct: 92  NHPNIVKLEYFFTHVSPQDHKVYQHLAMECLPETLQIEISRYAHNKMELALKHVKLYSYQ 151

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKIADFGLARLMASPQEILTSNVVTRWYR 174
             RG+ + H   I HRD+KP+N+L+ P+ G LKI DFG A+ +   Q  + S + +R+YR
Sbjct: 152 IARGMLYLHALGICHRDIKPSNILVDPNTGVLKICDFGSAKRLEINQPSI-SYICSRFYR 210

Query: 175 APELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPE 234
           APEL+ G   YT+ VDIW +G +  E++L      G++ + Q+    + LG P      +
Sbjct: 211 APELILGCTQYTTQVDIWGLGCVIGEMLLGKAIFQGQEPLLQLREIAKLLGPPDK----K 266

Query: 235 VSSFSN-------YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKC 287
              FSN       Y+K  ++   S+    + F  A    ++L+  +++  P+ R    + 
Sbjct: 267 FIFFSNPGYDGPLYSK-PLFSGTSQSRFEKYFGHAGVEGIDLLMKVLVYEPEIRLSPRRI 325

Query: 288 LQSQYFQEL 296
           L   +F +L
Sbjct: 326 LAHPFFDDL 334

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  104 bits (259), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 114/215 (53%), Gaps = 9/215 (4%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFL 61
           +K+   DY + +  GEG +A  +   K  +G+  A K + K S   +      L E++  
Sbjct: 74  IKTRGRDYHRGQFLGEGGFARCF-QIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIH 132

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRG 119
           + + H N+++ +D F  N N+ ++LE  P    +E+I K  +I  +  +++ ++     G
Sbjct: 133 KSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTI--TEPEVRFFMTQICGG 190

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
           + + H N ++HRDLK  N+       LKI DFGLA ++A+ +E   +   T  Y APE+L
Sbjct: 191 IQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVL 250

Query: 180 FGAKH--YTSAVDIWSVGVIFAELMLRIPYLPGKD 212
            G KH  ++  VDIWS+GV+   L++  P    KD
Sbjct: 251 MG-KHSGHSYEVDIWSIGVMLYALLIGKPPFQAKD 284

>Kwal_55.22001
          Length = 363

 Score =  101 bits (252), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 127/258 (49%), Gaps = 23/258 (8%)

Query: 56  REVKFLQELKHVNVIELVDVFM---ANDN---LNLVLEFLPADLEIIIK---DTSIMFSP 106
           RE++ L+   H NV++L   F      DN    +L +E LP  L++ I       +    
Sbjct: 70  RELEILRIADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPL 129

Query: 107 ADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKIADFGLARLMASPQEILT 165
              K +     RG+ + H   I HRD+KP+N+L+ P+ G LKI DFG A+ +   Q  + 
Sbjct: 130 KHTKLYTYQIARGMLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQNQPSI- 188

Query: 166 SNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALG 225
           S + +R+YRAPEL+ G   YT+ +DIW +G +  E+++      G++ + Q+    + LG
Sbjct: 189 SYICSRFYRAPELIVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG 248

Query: 226 TPTDADWPEVSSFSN-------YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNP 278
            P      +   FSN       ++K  ++    +E   + F  A    ++L+  ++   P
Sbjct: 249 PPDK----KFLFFSNPSYDGPLFSK-PLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEP 303

Query: 279 KKRWDAVKCLQSQYFQEL 296
           ++R    + L   +F++L
Sbjct: 304 ERRLSPRRILAHPFFEDL 321

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score =  101 bits (251), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 146/309 (47%), Gaps = 32/309 (10%)

Query: 7   VDDYTKEKKAGEGTYAVVYL--GTKKSTGRSIAVKEIKT-SQFKDGLDMSALREVKFLQE 63
           V +Y +  +   GT    YL    +K  G   A+K++   +++K        RE++ L+ 
Sbjct: 27  VKEYKRIGQGAFGTVVQAYLTPDNQKWLG-PFAIKKVPAQTEYKS-------RELEILRI 78

Query: 64  LKHVNVIEL----VDVFMANDNL--NLVLEFLPADLEIII---KDTSIMFSPADIKSWIL 114
             H NV++L      +   +  L  +L +E LP  L+  I   K  ++      +K +  
Sbjct: 79  ADHPNVVKLEYFYTHISPTDHKLYQHLAMECLPEMLQNEILRYKKNNLELPLKHVKLYAY 138

Query: 115 MTLRGVHHCHRNFILHRDLKPNNLLLAPD-GQLKIADFGLARLMASPQEILTSNVVTRWY 173
              RG+ + H   I HRD+KP+N+L+ P  G LKI DFG A+ + S Q  + S + +R+Y
Sbjct: 139 QIARGMLYLHALGICHRDIKPSNVLVDPQTGILKICDFGSAKKLESNQPSI-SYICSRYY 197

Query: 174 RAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWP 233
           RAPEL+ G   YT+ +DIW +G +  E++L      G   + Q++   + LG P      
Sbjct: 198 RAPELIVGCTQYTTKIDIWGLGCVLGEMLLGKAVFQGHQPLLQLHEITKLLGPPDK---- 253

Query: 234 EVSSFSN--YNKIQIYPP----PSREELRRRFIAATENALELISGMMIMNPKKRWDAVKC 287
               FSN  YN      P      +    + F  A  + ++L+  +++  P++R    + 
Sbjct: 254 RFIFFSNPSYNGPLFSKPLFEGAPKARFEKYFGYAGPDGVDLLMSVLVYEPERRASPRRI 313

Query: 288 LQSQYFQEL 296
           L   +F +L
Sbjct: 314 LAHPFFDDL 322

>Scas_673.20*
          Length = 758

 Score =  102 bits (253), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 116/210 (55%), Gaps = 9/210 (4%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           +L++  + Y K K+ GEG   +VY   +  T  S+A+K+I   + +  L M    E+  L
Sbjct: 473 SLRNPNERYRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDL-KIQPRLQM-IWTEMLVL 530

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPAD--IKSWILMTLRG 119
           +E +H N+I  ++ ++ +D L +V+E++       + D    F+P +  + +    TL G
Sbjct: 531 KEYQHPNIINFINSYLLHDTLWIVMEYMDGGS---LADIVSFFTPTEEQMATICRETLFG 587

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
           ++  H   I+HRD+K +N+LL+ +G +KI DFG    +       T+ V T ++ APE++
Sbjct: 588 LNFLHSRGIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVI 647

Query: 180 FGAKHYTSAVDIWSVGVIFAELML-RIPYL 208
             +K Y   VD+WS+G++  E++    PYL
Sbjct: 648 -ASKEYGPKVDVWSLGIMIIEMIEGEPPYL 676

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  100 bits (249), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 111/220 (50%), Gaps = 7/220 (3%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKT----SQFKDGLDMSALR 56
           M+ K T  D++ +++ G G+Y+ VY    +STG+  A+K        S+ K         
Sbjct: 1   MSRKRTPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKN 60

Query: 57  EVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMT 116
            +  L    H  +I+L   F  ++NL  VL+F P    + +  T   F+ A  K ++   
Sbjct: 61  TLNLLAHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQL 120

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEI--LTSNVVTRWYR 174
           +  + + H   ++HRDLKP NLLL+ +G+L I DFG+A  +A+   +   +S V T  Y 
Sbjct: 121 IDALEYIHGCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYV 180

Query: 175 APELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDV 214
           +PELL   K    + DIW+VG +  +     P   G++++
Sbjct: 181 SPELLLQNKSNFCS-DIWAVGCMLYQFTQGTPPFRGENEL 219

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  100 bits (250), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 13/202 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSA---------LREVKFLQELKHV 67
           G G+   V L   + TG   AVK I  S F +  + S           RE+  ++ L H 
Sbjct: 28  GFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHP 87

Query: 68  NVIELVDVFMANDNLNLVLEFL-PADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           NV+ L DV+  N+NL L+LE+    +L  ++ D   +     I  +  + + G+ +CH  
Sbjct: 88  NVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIII-GISYCHAL 146

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
            I+HRDLKP NLLL     +KIADFG+A L     ++L ++  +  Y APE++ G  +  
Sbjct: 147 GIVHRDLKPENLLLDSFYNIKIADFGMAALQTD-ADLLETSCGSPHYAAPEIVSGLPYEG 205

Query: 187 SAVDIWSVGVI-FAELMLRIPY 207
            A D+WS GVI FA L  R+P+
Sbjct: 206 FASDVWSCGVILFALLTGRLPF 227

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score = 97.4 bits (241), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 148/312 (47%), Gaps = 26/312 (8%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYL--GTKKSTGRSIAVKEIKT-SQFKDGLDMSALRE 57
           +T +  V +Y +      GT    YL    +K  G   A+K++   +++K        RE
Sbjct: 19  VTRQMLVKEYKRIGHGAFGTVVQAYLTPDNEKWYG-PFAIKKVPAQTEYKS-------RE 70

Query: 58  VKFLQELKHVNVIELVDVFM------ANDNLNLVLEFLPADL--EIIIKDTSIMFSP-AD 108
           +  L+   H NV++L   F            +L +E LP  L  EI+    + +  P   
Sbjct: 71  LAILRIADHPNVVKLEYFFTHVSPSDGKVYQHLAMECLPETLQHEILRYTQNKLELPLKH 130

Query: 109 IKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSN 167
           IK +     RG+ + H   I HRD+KP+N+L+ P  G LKI DFG A+ +   Q  + S 
Sbjct: 131 IKMYTYQIARGMLYLHALGICHRDIKPSNILVDPKSGVLKICDFGSAKKLEQNQPSI-SY 189

Query: 168 VVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
           + +R+YRAPEL+ G   YT+ +DIW +G +  E+++      G++ + Q++   + LG P
Sbjct: 190 ICSRFYRAPELIVGCTQYTTQIDIWGLGCVIGEMLIGKAVFQGQEPLLQLHEIAKLLG-P 248

Query: 228 TDADWPEVSSFSNYNKI---QIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDA 284
            D  +   S+ S    +    ++    ++   + F  A    ++L+  ++  +P++R   
Sbjct: 249 PDKKFIFFSNPSYGGPLFSKPLFNGTPQQRFEKYFGHAGPEGIDLLMKVLCYSPERRLSP 308

Query: 285 VKCLQSQYFQEL 296
            + L   +  EL
Sbjct: 309 RRVLCHAFLDEL 320

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 97.8 bits (242), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 139/307 (45%), Gaps = 59/307 (19%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR-EVKFLQE 63
           S  D Y   K  G G YA+V     K+TG ++AVK     Q  D       R E   L +
Sbjct: 188 SFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMK 247

Query: 64  LKHVNVIELVDVFMANDNLNLVLEFLPAD-------LEIIIKDTSIMFSPADIKSWILMT 116
           + H N++ L+D F+   +   + ++L  +        + I+K TS+     + K+     
Sbjct: 248 IHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSL--PQEESKAIFKQI 305

Query: 117 LRGVHHCHRNFILHRDLKPNNLLL------APDG-------------QLKIADFGLARLM 157
           L G+ + H   I+HRD+KP N+LL      +PD              Q+KIADFGLA+  
Sbjct: 306 LTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFT 365

Query: 158 ASPQEILTSNVV-TRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQ 216
              Q   T+ +  T  Y APE+L   K YTS VD+WS GVI    +   P  P  D    
Sbjct: 366 GEMQ--FTNTLCGTPSYVAPEVLV-KKGYTSKVDLWSAGVILYVCLCGFP--PFSD---- 416

Query: 217 INVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIM 276
                  LG P+  +    + ++ Y+       P  +E+        + AL LIS ++++
Sbjct: 417 ------QLGPPSLKEQIMSAKYAFYS-------PYWDEI-------DDAALHLISNLLVL 456

Query: 277 NPKKRWD 283
           +P+ R+D
Sbjct: 457 DPENRYD 463

>Scas_613.5
          Length = 517

 Score = 97.4 bits (241), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 137/327 (41%), Gaps = 75/327 (22%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALRE-VKFLQE 63
           S  D Y   K  G G YA V  G  K TG+++AVK     Q  D       RE    L  
Sbjct: 199 SFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMR 258

Query: 64  LKHVNVIELVDVFMANDNLNLVLEFLPAD-------LEIIIKDTSIMFSPADIKSWILMT 116
           + H N++ L+D F+   + + + ++L  D        E I+K T +     + K+     
Sbjct: 259 IHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCL--RQDETKAIFNQI 316

Query: 117 LRGVHHCHRNFILHRDLKPNNLL-------------LAP------DGQLKIADFGLARLM 157
           L G+ H H+  I+HRD+KP N+L             L P      D Q+KIADFGLA+  
Sbjct: 317 LMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFT 376

Query: 158 ASPQEILTSNVV-TRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQ 216
              Q   T+ +  T  Y APE+L   K YTS VD+WS GVI    +   P          
Sbjct: 377 GEMQ--FTNTLCGTPSYVAPEVL-TKKGYTSKVDMWSAGVILYVCLCGFP---------- 423

Query: 217 INVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREE-LRRRFIAAT-------ENALE 268
                                FS     Q+ PP  +E+ L+ +F   T       +N L 
Sbjct: 424 --------------------PFSE----QLGPPSLKEQILQAKFAFYTPYWDNIDDNVLH 459

Query: 269 LISGMMIMNPKKRWDAVKCLQSQYFQE 295
           LIS +++++   R+     +   +F +
Sbjct: 460 LISHLLVLDADARYSVEDTINHPWFND 486

>Scas_493.2
          Length = 1117

 Score = 97.8 bits (242), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 139/298 (46%), Gaps = 47/298 (15%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK---------------DGLDMSALREVKFL 61
           G G+   V L   ++T +  A+K I  S F                D L     RE+  +
Sbjct: 29  GLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREIIIM 88

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFL-PADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L+H NV+ L DV+  N NL ++LE+    +L  ++ +   +     ++ +    + G+
Sbjct: 89  KLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVR-FFRQIIIGI 147

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            +CH   I+HRDLKP NLLL     +KIADFG+A L  +  ++L ++  +  Y APE++ 
Sbjct: 148 SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL-ETEDKLLETSCGSPHYAAPEIVS 206

Query: 181 GAKHYTSAVDIWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFS 239
           G  ++    D+WS GVI FA L  R+P+       D+ +   R L     +   E+    
Sbjct: 207 GIPYHGFESDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQSGQFEM---- 255

Query: 240 NYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELP 297
                     P  +E+ R       +A +LIS ++ ++P KR    + L+    Q+ P
Sbjct: 256 ----------PDDDEMSR-------DAQDLISRILTVDPTKRIKTREILKHPLLQKYP 296

>Scas_698.37
          Length = 347

 Score = 95.5 bits (236), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 145/308 (47%), Gaps = 35/308 (11%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL 64
            T+ DY    K G G Y+ V+ G       S  +K +K  + +        RE+K L  L
Sbjct: 53  GTLTDYEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVKLR-----KIHRELKILWNL 107

Query: 65  KHV-NVIELVDVFMANDNLNLVLEFLPADLEII-IKDTSIMFSPADIKSWILMTLRGVHH 122
               N++EL+DV   +D    V  F+  D++ +  ++    F  +D++ +    L  +++
Sbjct: 108 TGGPNIVELLDV--VHDEKTRVPAFIFEDVKNVDFRELYPTFKLSDVQYYFKQLLIALNY 165

Query: 123 CHRNFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
            H   I+HRD+KP N+++ P   +L++ D+GLA     P       V +R+++ PELL  
Sbjct: 166 AHSMGIMHRDVKPQNVMIDPVQRKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLTD 224

Query: 182 AKHYTSAVDIWSVGVIFAELMLRI-PYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
              Y  ++D+WSVG + A ++ +  P+  G  + DQ+    + LGT             N
Sbjct: 225 LNQYDYSLDMWSVGCMIAAIIFKKEPFFKGGSNPDQLVKIAKVLGT---------KQLIN 275

Query: 241 Y-NKIQIYPPPSREELRR--------RFIA-----ATENALELISGMMIMNPKKRWDAVK 286
           Y  +  ++ P   + L R         FI+     AT  A++L+  ++  + ++R  A +
Sbjct: 276 YLARYGLHLPSEHDNLIRTWARKPWSHFISIETPLATPEAVDLVDNLLRYDHQERLTAEE 335

Query: 287 CLQSQYFQ 294
            +  Q+FQ
Sbjct: 336 AMNHQFFQ 343

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 97.4 bits (241), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 106/208 (50%), Gaps = 19/208 (9%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK---------------DGLDMSALREVKFL 61
           G G+   V L    STG+  AVK I  + F                D L     RE+  +
Sbjct: 26  GLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIM 85

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFL-PADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + L H NV+ L DV+  N +L LVLE+    +L  ++ +   +     I+ +    + GV
Sbjct: 86  KLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR-FFRQIIIGV 144

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            +CH   I+HRDLKP NLLL     +KIADFG+A L  +  ++L ++  +  Y APE++ 
Sbjct: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL-ETEGKLLETSCGSPHYAAPEIVS 203

Query: 181 GAKHYTSAVDIWSVGVI-FAELMLRIPY 207
           G  +   A D+WS GVI FA L  R+P+
Sbjct: 204 GIPYQGFASDVWSCGVILFALLTGRLPF 231

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 97.4 bits (241), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 105/197 (53%), Gaps = 9/197 (4%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           K G+G    VY+     +  S+A+K++    Q K  L    L E+  ++E KH N++  +
Sbjct: 625 KIGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKEL---ILNEILVMRESKHSNIVNFI 681

Query: 74  DVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           D ++A  +L +V+E++    L  ++  T  + S   I +    TL+G+   H   +LHRD
Sbjct: 682 DSYLAKGDLWIVMEYMEGGSLTDVV--THCLLSEGQIGAVCRETLKGLQFLHSKGVLHRD 739

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
           +K +N+LL+  G +K+ DFG    +       T+ V T ++ APE++   K Y   VDIW
Sbjct: 740 IKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 798

Query: 193 SVGVIFAELML-RIPYL 208
           S+G++  E++    PYL
Sbjct: 799 SLGIMIIEMIEGEPPYL 815

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 96.3 bits (238), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 146/324 (45%), Gaps = 59/324 (18%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALRE-VKFLQE 63
           S  D Y   K+ G G YA+V     K TG+ +AVK     Q  D       RE    L  
Sbjct: 195 SFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMR 254

Query: 64  LKHVNVIELVDVFMANDNLNLVLEFLPAD-------LEIIIKDTSIMFSPADIKSWILMT 116
           ++H N++ L+D F+   + + + ++L  +        E I++ T +    +  K+     
Sbjct: 255 VQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDES--KALFKQL 312

Query: 117 LRGVHHCHRNFILHRDLKPNNLL-------------LAP------DGQLKIADFGLARLM 157
           L G+ + H   I+HRD+KP N+L             L P      D Q+KIADFGLA+  
Sbjct: 313 LTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFT 372

Query: 158 ASPQEILTSNVV-TRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQ 216
              Q   T+ +  T  Y APE+L   K YTS VD+WS GVI    +   P  P  D    
Sbjct: 373 GEMQ--FTNTLCGTPSYVAPEVL-TKKGYTSKVDLWSAGVILYVCLCGFP--PFSD---- 423

Query: 217 INVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIM 276
                  LG P+  +    + ++ Y+       P  +++        ++ L LIS ++++
Sbjct: 424 ------QLGPPSLKEQILQAKYAFYS-------PYWDKI-------DDSVLHLISNLLVL 463

Query: 277 NPKKRWDAVKCLQSQYFQELPEPT 300
           NP +R++  + L   +F ++ + +
Sbjct: 464 NPDERYNIDEALNHPWFNDIQQQS 487

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 96.7 bits (239), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 108/196 (55%), Gaps = 13/196 (6%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLD-----MSALR-EVKFLQELKHVNVI 70
            G+G++  VYL    +TG  +AVK+++  ++    +     + ALR EV  L++L H+N++
Sbjct: 1182 GKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIV 1241

Query: 71   ELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
            + +     N+  +L LE++       +      F    IK      L+G+ + H   ILH
Sbjct: 1242 QYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILH 1301

Query: 131  RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR----WYRAPELLFGAKHYT 186
            RD+K +NLLL  DG  KI+DFG++R     ++I +++ +T     ++ APE++   + Y+
Sbjct: 1302 RDMKADNLLLDQDGICKISDFGISR---KSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYS 1358

Query: 187  SAVDIWSVGVIFAELM 202
            + VDIWS+G I  E+ 
Sbjct: 1359 AKVDIWSLGCIVLEMF 1374

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 96.7 bits (239), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 101/196 (51%), Gaps = 13/196 (6%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR-------EVKFLQELKHVNV 69
            G+G++  VYL    +TG  +AVK++   +F    D SA+        EV  L++L HVN+
Sbjct: 1045 GKGSFGAVYLALNVTTGEMLAVKQVTVPEF-SSQDESAISMVEALKSEVSTLKDLNHVNI 1103

Query: 70   IELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFIL 129
            ++ +     N   +L LE++       +      F    I+      L G+ + H   IL
Sbjct: 1104 VQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSKGIL 1163

Query: 130  HRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR---WYRAPELLFGAKHYT 186
            HRD+K +NLLL  DG  KI+DFG++R   S      S++  R   ++ APE++  A  Y+
Sbjct: 1164 HRDMKADNLLLDNDGVCKISDFGISR--KSNNIYSNSDMTMRGTVFWMAPEMVDTAHGYS 1221

Query: 187  SAVDIWSVGVIFAELM 202
            + VDIWS+G +  E+ 
Sbjct: 1222 AKVDIWSLGCVVLEMF 1237

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 96.3 bits (238), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 106/198 (53%), Gaps = 7/198 (3%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y  ++  G G+Y VVY    K T + +A+KE+     ++  D+ A  E+  L+ L H N+
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMA--EISLLKNLNHNNI 82

Query: 70  IELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           ++       +  L ++LE+     L  +I  +S   S  + K+++  TL G+ + H   +
Sbjct: 83  VKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGV 142

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           +HRD+K  N+LL+ D  +K+ADFG++ ++ S    L     T  + APE+L G +  ++ 
Sbjct: 143 IHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAG---TLNWMAPEIL-GNRGASTL 198

Query: 189 VDIWSVGVIFAELMLRIP 206
            DIWS+G    E++ + P
Sbjct: 199 SDIWSLGATVVEMLTKNP 216

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 95.9 bits (237), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 113/205 (55%), Gaps = 16/205 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK-------DGLDMSAL-----REVKFLQEL 64
           G G+   V L + ++T +  AVK I  + F+       +G   +AL     +E+  ++ L
Sbjct: 27  GSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKLL 86

Query: 65  KHVNVIELVDVFMANDNLNLVLEFL-PADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
            H NV+ L DV+  N +L LVLE+    +L  ++ +   +     ++++  + + G+ +C
Sbjct: 87  NHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIII-GISYC 145

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           H   ++HRDLKP NLLL     +KIADFG+A L  S  ++L ++  +  Y APE++ G  
Sbjct: 146 HSLGVVHRDLKPENLLLDNKLNIKIADFGMAAL-ESEDKLLETSCGSPHYAAPEIISGLP 204

Query: 184 HYTSAVDIWSVGVI-FAELMLRIPY 207
           +   + D+WS GVI FA L  R+P+
Sbjct: 205 YEGFSSDVWSCGVILFALLTGRLPF 229

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 95.9 bits (237), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 105/198 (53%), Gaps = 8/198 (4%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y   +  G G+Y VVY  T K T + +A+KE+      + +D+  + E+  L+ L H+N+
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQDDDELVDI--MSEIDLLKNLNHINI 79

Query: 70  IELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           ++         NL ++LE+     L+ +I     M S  + K ++  TL G+++ H   +
Sbjct: 80  VKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPM-SEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           +HRD+K  N+LL  +  +K+ADFG++  + +    L  ++   W  APE++ G +  ++ 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFGVSTKVNNTAMTLAGSL--NW-MAPEII-GNRGASTL 194

Query: 189 VDIWSVGVIFAELMLRIP 206
            DIWS+G    EL+   P
Sbjct: 195 SDIWSLGATVVELLTGNP 212

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 95.5 bits (236), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 132/285 (46%), Gaps = 43/285 (15%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           G+G +A V    ++STG++ AVK I   +  D  D    RE+  LQ+L H  +++L D F
Sbjct: 199 GQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-GVKRELDVLQKLNHPRIVKLKDFF 257

Query: 77  MANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKP 135
             NDN  +++EF+   DL   +     +   A  +      L  V + H   I HRDLKP
Sbjct: 258 EDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAG-REITRQVLEAVKYMHDQGISHRDLKP 316

Query: 136 NNLLLAPDGQ--LKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH--------Y 185
           +N+++  D    +KI DFGLA++  +    L +   T  Y APE++ G           Y
Sbjct: 317 DNIMIEQDDPVLIKITDFGLAKVQ-NQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLY 375

Query: 186 TSAVDIWSVG-VIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKI 244
           +S VD+WS+G +++  L   +P+  G+      N  F+ +   +  + P      +Y   
Sbjct: 376 SSLVDMWSIGCLVYVILTGHLPF-SGQSQ----NELFKQIKRGSYHEGP----LKDYR-- 424

Query: 245 QIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQ 289
                             +E A   I  ++ ++PK+R +A K LQ
Sbjct: 425 -----------------ISEEARNFIDCLLNVDPKERMNAGKALQ 452

>Kwal_56.22476
          Length = 697

 Score = 95.1 bits (235), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 13/217 (5%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYL----GTKKSTGRSIAVKEIKTSQFKDGLDMSALREV 58
           +K+   DY +    GEG +A  +     G K    +++A   IK+ + +  L    L E+
Sbjct: 72  IKTRGRDYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRKKL----LSEI 127

Query: 59  KFLQELKHVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTL 117
           +  + ++H N+++ VD F  + N+ ++LE  P   L  ++K   ++  P +++ +    +
Sbjct: 128 QIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEP-EVRFFTTQIV 186

Query: 118 RGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPE 177
             V + H   ++HRDLK  N+       LK+ DFGLA ++A+ +E   +   T  Y APE
Sbjct: 187 GAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPE 246

Query: 178 LLFGAKH--YTSAVDIWSVGVIFAELMLRIPYLPGKD 212
           +L G KH  ++  VDIWS GV+   L++  P    K+
Sbjct: 247 VLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKE 282

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 102/195 (52%), Gaps = 11/195 (5%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSA------LREVKFLQELKHVNVI 70
            G+G++  VYLG   +TG  +AVK+++  +F    + +       + EV  L++L H+N++
Sbjct: 1131 GKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHLNIV 1190

Query: 71   ELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
            + +     N   +L LE++       +      F    I+      L G+ + H   ILH
Sbjct: 1191 QYLGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLRGILH 1250

Query: 131  RDLKPNNLLLAPDGQLKIADFGLARL---MASPQEILTSNVVTRWYRAPELLFGAKHYTS 187
            RD+K +NLLL  DG  KI+DFG++R    + S  E+     V  ++ APE++   + Y++
Sbjct: 1251 RDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRGTV--FWMAPEMVDTTQGYSA 1308

Query: 188  AVDIWSVGVIFAELM 202
             VDIWS+G +  E+ 
Sbjct: 1309 KVDIWSLGCVVLEMF 1323

>Scas_711.25
          Length = 1515

 Score = 94.7 bits (234), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 110/197 (55%), Gaps = 15/197 (7%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLD-----MSALR-EVKFLQELKHVNVI 70
            G+G++  VYL    +TG  +AVK+++  ++    +     + ALR EV  L++L H+N++
Sbjct: 1221 GKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHLNIV 1280

Query: 71   ELVDVFMANDNL-NLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFIL 129
            + +  F   DN+ +L LE++       +      F    I+      LRG+ + H   IL
Sbjct: 1281 QYLG-FENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGIL 1339

Query: 130  HRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR----WYRAPELLFGAKHY 185
            HRD+K +NLLL  DG  KI+DFG++R     ++I +++ +T     ++ APE++   + Y
Sbjct: 1340 HRDMKADNLLLDQDGVCKISDFGISR---KSKDIYSNSDMTMRGTVFWMAPEMVDTKQGY 1396

Query: 186  TSAVDIWSVGVIFAELM 202
            ++ VDIWS+G I  E+ 
Sbjct: 1397 SAKVDIWSLGCIVLEMF 1413

>Scas_648.17
          Length = 340

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 108/225 (48%), Gaps = 10/225 (4%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL 64
            T+ DY    K G G Y+ V+ G   +      +K +K  + K        RE+K L  L
Sbjct: 45  GTISDYEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVKMK-----KIYRELKILTNL 99

Query: 65  KHV-NVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
               NVIEL+D+     +    L F      +  +     F+  DI+ +    L  +++C
Sbjct: 100 TGGPNVIELLDIVQDPGSKIPALIFEEVK-NMDFRQLYPTFTLPDIQFYFTQLLIALNYC 158

Query: 124 HRNFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
           H   I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL   
Sbjct: 159 HSMGIMHRDVKPQNVMIDPKERKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVNL 217

Query: 183 KHYTSAVDIWSVGVIFAELML-RIPYLPGKDDVDQINVTFRALGT 226
             Y  ++D+WSVG + A ++  R P+  G  + DQ+      LGT
Sbjct: 218 NQYDYSLDLWSVGCMLAAIVFKREPFFKGSSNPDQLVRIAAVLGT 262

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 112/221 (50%), Gaps = 17/221 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQ-------ELKHVNV 69
           G+GT+  V       T   +AVK +K+    + L+ S + E K L+        L   + 
Sbjct: 280 GQGTFGQVVKCQNMQTKEIVAVKVVKSK--TEYLNQSIM-EAKILELLNKRIDPLNQHHF 336

Query: 70  IELVDVFMANDNLNLVLEFLPADLEIIIKDTSIM-FSPADIKSWILMTLRGVHHCHRNFI 128
           + L D F+  ++L LV E L  +L  ++K       S   IK++    L  +     + +
Sbjct: 337 LRLHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSMNLIKNFCKQLLDSLCVLKESKL 396

Query: 129 LHRDLKPNNLLL-APDG-QLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
           +H DLKP N+LL +PD  +LK+ DFG A         + + + +R+YRAPE+L G   Y+
Sbjct: 397 IHCDLKPENVLLVSPDRPELKVIDFGSA---CEEARTVYTYIQSRFYRAPEVLMGIP-YS 452

Query: 187 SAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
           +++D+WS G I AEL L IP  PG  + +Q+      LG P
Sbjct: 453 TSIDMWSFGCIVAELFLGIPVFPGASEFNQMTRIVEMLGVP 493

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 115/221 (52%), Gaps = 17/221 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL-----KHVNVIE 71
           G+GT+  V       T   IAVK +K+        +S  + ++ L E      KH + + 
Sbjct: 368 GQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNNKH-HFLR 426

Query: 72  LVDVFMANDNLNLVLEFLPADLEIIIKDTSIM-FSPADIKSWILMTLRGVHHCHRNFILH 130
           + D F+  ++L LV E L  +L  ++K       S   I+++ +  L  +     + ++H
Sbjct: 427 MHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTIQILDSLCVLKDSKLIH 486

Query: 131 RDLKPNNLLL-APDG-QLKIADFGLARLMASPQEILT--SNVVTRWYRAPELLFGAKHYT 186
            DLKP N+LL +PD   LK+ DFG     +S +E  T  + + +R+YRAPE++ G   Y+
Sbjct: 487 CDLKPENILLCSPDKPDLKVIDFG-----SSCEETRTVYTYIQSRFYRAPEIILGIP-YS 540

Query: 187 SAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
           +++D+WS+G I AEL L IP  PG  + +Q+      LG P
Sbjct: 541 TSIDMWSLGCIVAELFLGIPIFPGSSEFNQLTRIITTLGYP 581

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 94.0 bits (232), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 105/197 (53%), Gaps = 9/197 (4%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           K G+G    VY   +  T  S+A+K++    Q K  L    + E+  ++  +H N++  +
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKEL---IINEILVMKGSRHNNIVNFI 744

Query: 74  DVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           D ++   +L +++E++    L  ++  T  + +   I +    TLRG+H  H   ++HRD
Sbjct: 745 DSYLLKGDLWVIMEYMEGGSLTDVV--THCILTEGQIAAVSRETLRGLHFLHSKGVIHRD 802

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
           +K +N+LL+ DG +K+ DFG    +       T+ V T ++ APE++   K Y   VDIW
Sbjct: 803 IKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 861

Query: 193 SVGVIFAELM-LRIPYL 208
           S+G++  E++    PYL
Sbjct: 862 SLGIMIIEMIEGEPPYL 878

>Kwal_26.7355
          Length = 1446

 Score = 94.0 bits (232), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 107/195 (54%), Gaps = 11/195 (5%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQF--KDGLDMS---ALR-EVKFLQELKHVNVI 70
            G+G++  V+LG   +TG  IAVK+++  ++  +D   +S   ALR EV  L++L H N++
Sbjct: 1153 GKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHTNIV 1212

Query: 71   ELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
            + +     N   +L LE++       +      F    I+   +  LRG+ + H   ILH
Sbjct: 1213 QYLGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIRFLAVQVLRGLSYLHSKKILH 1272

Query: 131  RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR---WYRAPELLFGAKHYTS 187
            RD+K +NLLL  DG  KI+DFG+++   S      S++  R   ++ APE++   + Y++
Sbjct: 1273 RDMKADNLLLDVDGICKISDFGISK--KSNNIYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1330

Query: 188  AVDIWSVGVIFAELM 202
             VDIWS+G +  E+ 
Sbjct: 1331 KVDIWSLGCVVLEMF 1345

>Kwal_47.18098
          Length = 374

 Score = 92.4 bits (228), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 146/336 (43%), Gaps = 62/336 (18%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAV------------KEIK------------TSQ 45
           Y  E K G G Y+ V+ G + ST   I +            +EI             T+Q
Sbjct: 40  YEIEMKVGRGKYSEVFQGVQLSTESKIVIKMLKPVKKKKIKREISILTNLSNETNPPTAQ 99

Query: 46  ----------FKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEI 95
                      K+ +     +EV  L    H N+I+L+DV   + +    L F   D  I
Sbjct: 100 PFDRDAYYENKKESVIEFTRQEVYELAHDGHKNIIQLLDVVKDHVSKTPALVFEHVD-NI 158

Query: 96  IIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKIADFGLA 154
             +     F   DI+ ++   L+ + +CH   I+HRD+KP+N+++     +L++ D+GLA
Sbjct: 159 DFRTLYPTFQDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDWGLA 218

Query: 155 RLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML-RIPYLPGKDD 213
                P       V +R+++ PELL   + Y  ++D+WS G + A ++  + P+  G  +
Sbjct: 219 EFY-HPNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHGTSN 277

Query: 214 VDQINVTFRALGTPTDADWPEVSSFSNY-NKIQIYPPPSREE----LRR---RFI----- 260
            DQ+    R LG+           F NY  K QI  P    +    +RR   RF+     
Sbjct: 278 TDQLVKIVRVLGS---------DDFENYLRKYQITLPQEFHDIDQYIRRPWHRFVNDANS 328

Query: 261 --AATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
             +  E  L LI  ++  + ++R  A + +Q  +F+
Sbjct: 329 HLSGNEEILNLIDNLLRYDHQERLTAREAMQHPWFE 364

>Scas_644.15
          Length = 726

 Score = 93.6 bits (231), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 112/223 (50%), Gaps = 11/223 (4%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFL 61
           +K+   DY +    GEG +A  +   K  +G+  A K + K S   +      L E++  
Sbjct: 85  IKTRGRDYRRGHFLGEGGFARCF-QIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIH 143

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + +KH N++  VD F  + N+ ++LE      L  ++K    +  P +++ +       V
Sbjct: 144 KSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEP-EVRFFTTQICGAV 202

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   ++HRDLK  N+    D  LK+ DFGLA ++A+ +E   +   T  Y APE+L 
Sbjct: 203 KYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLM 262

Query: 181 GAKH--YTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTF 221
           G KH  ++  VDIWS+GV+   L++  P    KD    +NV +
Sbjct: 263 G-KHAGHSFEVDIWSIGVMIYALLVGKPPFQAKD----VNVIY 300

>ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH]
           (503670..504788) [1119 bp, 372 aa]
          Length = 372

 Score = 92.0 bits (227), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 123/248 (49%), Gaps = 34/248 (13%)

Query: 66  HVNVIELVDVFM--ANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
           H N+I L+DV     +    LV E++   D  I+       FS  DI+ ++   L+ + +
Sbjct: 129 HENIIHLLDVIKDPISRTPALVFEYVDNVDFRILYP----TFSDMDIRYYMFELLKALDY 184

Query: 123 CHRNFILHRDLKPNNLLL-APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
           CH   I+HRD+KP+N+++     +L++ D+GLA L   P+E   + V +R+++ PELL  
Sbjct: 185 CHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLAELY-HPKEEYNARVASRFFKGPELLVD 243

Query: 182 AKHYTSAVDIWSVGVIFAELM-LRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
            + Y  ++D+WS+G + A ++ ++ P+  G+ + DQ+    R LG+           F  
Sbjct: 244 YRMYDYSLDLWSLGTMLASMVFMKEPFFHGRSNTDQLVKIVRVLGS---------EDFEK 294

Query: 241 Y-NKIQIYPPPS----REELRR----------RFIAATENALELISGMMIMNPKKRWDAV 285
           Y  K QI  P       + +RR          R +   E  ++LI  ++  +  +R  A 
Sbjct: 295 YLVKYQITLPREFMDMDQYIRRPWKRFINDANRHLCDNEEIIDLIDNILKYDHHERLTAR 354

Query: 286 KCLQSQYF 293
           + +Q  +F
Sbjct: 355 EAMQHPWF 362

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 122/248 (49%), Gaps = 12/248 (4%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFL 61
           +K+   DY +    GEG +A  +   K  +G+  A K + K S   +      L E++  
Sbjct: 66  IKTKGRDYHRGMFLGEGGFARCF-QMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIH 124

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
           + +KH N+++  D F  + N+ ++LE  P   L  ++K    +  P +++ +    +  +
Sbjct: 125 KSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEP-EVRFFTTQIVGAI 183

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
            + H   I+HRDLK  N+       LKI DFGLA ++A+ +E   +   T  Y APE+L 
Sbjct: 184 KYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLT 243

Query: 181 GAKH--YTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSF 238
           G KH  ++  VDIWS+GV+   L++  P    K    ++N  +  +    D  +P+    
Sbjct: 244 G-KHTGHSFEVDIWSIGVMIYALLIGKPPFQAK----EVNTIYERIKV-CDFSFPKDKPI 297

Query: 239 SNYNKIQI 246
           S+  K+ I
Sbjct: 298 SSEAKVLI 305

>Kwal_23.3590
          Length = 499

 Score = 92.8 bits (229), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 142/333 (42%), Gaps = 78/333 (23%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALRE-VKFLQE 63
           S  D Y   K+ G G YA+V     K +G  +AVK        D       RE  K L  
Sbjct: 181 SFFDRYIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMS 240

Query: 64  LKHVNVIELVDVFM-----ANDNLNLVLEFLPADLEI---IIKDTSIMFSPADIKSWILM 115
           ++H N+++L+D F+     A     LVLE + +D E+   I++ T +     +  +    
Sbjct: 241 IQHKNIVKLIDRFVEPVSKAQIQTFLVLEKV-SDGELFDRIVRKTRL--REDETNAIFKQ 297

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLA-------------------PDGQLKIADFGLARL 156
            L G+ + H   I+HRD+KP N+LL+                    D  +KIADFGLA+ 
Sbjct: 298 ILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKF 357

Query: 157 MASPQEILTSNVV-TRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVD 215
           +   Q   T+ +  T  Y APE+L     YTS VD+WS GV+    +   P         
Sbjct: 358 IGEMQ--FTNTLCGTPSYVAPEVLTKTG-YTSRVDMWSAGVLLYVCLCGFP--------- 405

Query: 216 QINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREE-LRRRFIAAT-------ENAL 267
                                 FS     Q+ PP  +E+ L  +F   +       ++ L
Sbjct: 406 ---------------------PFSE----QLAPPSMKEQILNGKFAFYSPYWDDIDDSCL 440

Query: 268 ELISGMMIMNPKKRWDAVKCLQSQYFQE-LPEP 299
            LIS ++++NP  R+D  K +   +F   +PEP
Sbjct: 441 HLISNLLVVNPAYRFDVQKTINHPWFSNTIPEP 473

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 116/224 (51%), Gaps = 23/224 (10%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL--------KHVN 68
           G+GT+  V       T   +AVK +K+   +      ++ E K L+ L        KH +
Sbjct: 376 GQGTFGQVVKCQNLLTKEILAVKVVKS---RTEYLTQSITEAKILELLNQKIDPTNKH-H 431

Query: 69  VIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIM-FSPADIKSWILMTLRGVHHCHRNF 127
            + + D F+  ++L LV E L  +L  ++K       S   I+++    L  +     + 
Sbjct: 432 FLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESK 491

Query: 128 ILHRDLKPNNLLL-APDG-QLKIADFGLARLMASPQEILT--SNVVTRWYRAPELLFGAK 183
           ++H DLKP N+LL APD  +LKI DFG     +S +E  T  + + +R+YRAPE++ G  
Sbjct: 492 LIHCDLKPENILLCAPDKPELKIIDFG-----SSCEEARTVYTYIQSRFYRAPEIILGIP 546

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
            Y++++D+WS+G I AEL L IP  PG  + +Q+      LG P
Sbjct: 547 -YSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYP 589

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 106/213 (49%), Gaps = 5/213 (2%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDGLDMSALREVKFL 61
           +K+   DY +    GEG +A  +   K   G+  A K + K S   +      L E++  
Sbjct: 83  IKTRGRDYHRGHFLGEGGFARCF-QMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIH 141

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVH 121
           + +KH N+++  D F  + N+ ++LE  P    + +       +  +++  ++  +  + 
Sbjct: 142 KSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIR 201

Query: 122 HCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
           + H   ++HRDLK  N+    +  LKI DFGLA ++A+ +E   +   T  Y APE+L G
Sbjct: 202 YMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG 261

Query: 182 AKH--YTSAVDIWSVGVIFAELMLRIPYLPGKD 212
            KH  ++  VDIWS+GV+   L+   P    K+
Sbjct: 262 -KHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE 293

>Scas_651.3
          Length = 793

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 118/226 (52%), Gaps = 23/226 (10%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQ--------ELKHVN 68
           G+GT+  V      +T   +AVK IK+    + L+ S + E K L+        E KH +
Sbjct: 387 GQGTFGQVVKCQNLTTKEILAVKVIKSR--SEYLNQS-ITEAKILELINNKIDPENKH-H 442

Query: 69  VIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIM-FSPADIKSWILMTLRGVHHCHRNF 127
            + + D F+  ++L LV E L  +L  ++K       S   I+ +    L  +     + 
Sbjct: 443 FLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLKDSK 502

Query: 128 ILHRDLKPNNLLL-APDG-QLKIADFGLARLMASPQEILT--SNVVTRWYRAPELLFGAK 183
           ++H DLKP N+LL +PD   LKI DFG     +S +E  T  + + +R+YRAPE++ G  
Sbjct: 503 LIHCDLKPENILLCSPDKPALKIIDFG-----SSCEETRTVYTYIQSRFYRAPEIILGIP 557

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTD 229
            Y++++D+WS+G I AEL L IP  PG  + +Q+      LG P +
Sbjct: 558 -YSTSIDMWSLGCIVAELFLGIPIFPGSSEYNQLTRIVDTLGYPPN 602

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 104/206 (50%), Gaps = 18/206 (8%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK------------DGLDMSALREVKFLQEL 64
           G G+   V L     TG+  AVK I  S F             D L     RE+  ++ L
Sbjct: 26  GAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMKLL 85

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
            H NV+ L DV+    +L +VLE++       ++++   +  + A    +    + G+ +
Sbjct: 86  NHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA--VRFFRQIIIGISY 143

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
           CH   I+HRDLKP NLLL     +K+ADFG+A L  S  ++L ++  +  Y APE++ G 
Sbjct: 144 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL-ESKDKLLETSCGSPHYAAPEIVSGL 202

Query: 183 KHYTSAVDIWSVGVI-FAELMLRIPY 207
            ++    D+WS GVI +A L  R+P+
Sbjct: 203 PYHGFESDVWSCGVILYALLTGRLPF 228

>Scas_618.8
          Length = 427

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 103/210 (49%), Gaps = 18/210 (8%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR------E 57
           K T  DY   K  G G++ VV   TKKS    +A+K +     K  L+ + ++      E
Sbjct: 21  KVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKIL----LKKALEGNQVQLQMLYDE 76

Query: 58  VKFLQELKHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILM 115
           +  L++L H N++E  + F  +D + +V +        + IIK     FS  D    ++ 
Sbjct: 77  LTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGR--FSEDDAVKILIQ 134

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRW 172
            L  V + H   I+HRDLKP NLL      D +L IADFG+A+ +   ++++     +  
Sbjct: 135 ILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLG 194

Query: 173 YRAPELLFGAKHYTSAVDIWSVGVIFAELM 202
           Y APE+L    H     DIWS+GVI   L+
Sbjct: 195 YVAPEVLTVDGH-GKPCDIWSIGVITYTLL 223

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 91.7 bits (226), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 112/218 (51%), Gaps = 14/218 (6%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-----KTSQFKDGLDMSALREV 58
           + TV  +   K  G+G+   V L     TG+  A+K +     K++Q K  L     RE+
Sbjct: 67  RDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ-LPYGIEREI 125

Query: 59  KFLQELKHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMT 116
             ++ + H NV+ L +V+     L LVLE++      + ++    +  S A    +    
Sbjct: 126 IIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEA--IHYFKQI 183

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQ-LKIADFGLARLMASPQEILTSNVVTRWYRA 175
           ++ V +CH   I HRDLKP NLLL    + +KIADFG+A L  S  ++L ++  +  Y +
Sbjct: 184 VQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETS-DKLLETSCGSPHYAS 242

Query: 176 PELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDD 213
           PE++ G K++ S  D+WS G+I   L+    +LP  DD
Sbjct: 243 PEIVLGRKYHGSPSDVWSCGIILFALL--TGHLPFNDD 278

>Kwal_0.96
          Length = 427

 Score = 90.5 bits (223), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 100/201 (49%), Gaps = 10/201 (4%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI--KTSQFKDGLDMSALREVKFLQELKH 66
           DY   K  G G++ VV    + S+G ++A+K +  K  + KD        E+  LQ+L H
Sbjct: 45  DYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDH 104

Query: 67  VNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            N+++  D F + D   +V +        + I+K     F+  D    +   L+ V + H
Sbjct: 105 PNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGK--FTEEDAVRIVYQILKAVEYLH 162

Query: 125 RNFILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
              I+HRDLKP NLL    A D QL + DFG+A+ + +  E++     +  Y APE++  
Sbjct: 163 SRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAPEVVTT 222

Query: 182 AKHYTSAVDIWSVGVIFAELM 202
           + H     DIWS+GV+   L+
Sbjct: 223 SGH-GKPCDIWSLGVVTYTLL 242

>Scas_713.7
          Length = 983

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 103/198 (52%), Gaps = 7/198 (3%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y  ++  G+G+Y VVY    K T + +A+KE+      D   +  + E+  L+ L HVN+
Sbjct: 26  YQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYDN--DDELIEIMTEIDLLKNLNHVNI 83

Query: 70  IELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           ++       + NL ++LEF     L+ ++          D K +I  TL G+ + H   +
Sbjct: 84  VKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVYIRQTLNGLVYLHEQGV 143

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           +HRD+K  NLLL  +  +K+ADFG++  +++    L  ++   W  +PE++ G +  ++ 
Sbjct: 144 IHRDIKAANLLLDSNDVVKLADFGVSTKVSNTAMTLAGSL--HW-MSPEII-GNRGASTL 199

Query: 189 VDIWSVGVIFAELMLRIP 206
            DIWS+G    EL+   P
Sbjct: 200 SDIWSLGATVVELVTGNP 217

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 107/198 (54%), Gaps = 9/198 (4%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y  ++  G+G Y VVY    ++T + IA+K I+    +       + E+  L+ LKH N+
Sbjct: 19  YALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEE--ELHEHMLEIDLLKNLKHENI 76

Query: 70  IELVDVFMANDNLNLVLEF-LPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           ++      ++  L ++LE+ +   L  +IK  ++  S A  K+++  TLRG+ + H   +
Sbjct: 77  VKYHGFIQSSHELYILLEYCIRGSLRDLIKKEAL--SEAKAKTYVRQTLRGLQYLHDQGV 134

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           +HRD+K  NLLL  +G +K+ADFG++  + +    +T      W  APE++ G K  ++ 
Sbjct: 135 IHRDIKAANLLLTENGVVKLADFGVSTRVNN--MAMTYAGSPNWM-APEVMLG-KGASTV 190

Query: 189 VDIWSVGVIFAELMLRIP 206
            DIWS+G    EL+   P
Sbjct: 191 SDIWSLGATVVELLTGNP 208

>Scas_700.54
          Length = 698

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 83/327 (25%), Positives = 142/327 (43%), Gaps = 56/327 (17%)

Query: 2   TLKSTVDDYT-KEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKF 60
           TL     D++ +++  G+G +A V    ++STG++ AVK I   +    ++    RE++ 
Sbjct: 214 TLTGIFKDFSIQDEVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME-GVSRELEV 272

Query: 61  LQELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRG 119
           LQ+L H  ++ L   +   D+  +V+EF+   DL   +     +   A  K      L  
Sbjct: 273 LQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAG-KEISRQILEA 331

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQ--LKIADFGLARLMASPQEILTSNVVTRWYRAPE 177
           V + H   I HRDLKP+N+L+  D    +KI DFGLA++  +    + +   T  Y APE
Sbjct: 332 VKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNG-SFMKTFCGTLAYVAPE 390

Query: 178 LLFGA-------KHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDA 230
           ++ G          Y+S VD+WS+G +   ++    +LP                     
Sbjct: 391 VIGGKGETNEERNEYSSLVDMWSMGCLVYVIL--TGHLP--------------------- 427

Query: 231 DWPEVSSFSNYNKIQIYPPPSREELRR---RFIAATENALELISGMMIMNPKKRWDAVKC 287
                  FS   + Q+Y   SR        +    ++ A   I  ++ +NP  R  A + 
Sbjct: 428 -------FSGSTQEQLYKQISRGSYHEGPLKDFRISDEARSFIDSLLQVNPGNRLTAARA 480

Query: 288 LQ---------SQYFQELPEPTLPQDL 305
           L+         SQ F+E  + +L + L
Sbjct: 481 LEHPWIKMAQYSQSFKEASQISLTESL 507

>Kwal_55.20326
          Length = 750

 Score = 90.5 bits (223), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 121/268 (45%), Gaps = 40/268 (14%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIK-----------------TSQFK 47
           +T  ++ K  + G G++  VYLG    TG  +AVK+++                   Q+ 
Sbjct: 453 ATPKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYN 512

Query: 48  DGLDMSALR---------------EVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPAD 92
              + SA++               E+  L+EL+H N++          NLN+ LE++P  
Sbjct: 513 QNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGG 572

Query: 93  LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFG 152
               + ++   F    I+++    L G+ + HR  I+HRD+K  N+L+   G +KI DFG
Sbjct: 573 SVSSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFG 632

Query: 153 LARLMA---SPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLP 209
           +++ ++     Q    S   + ++ APE++      T   DIWSVG +  E+       P
Sbjct: 633 ISKKLSPLNQQQNKRASLQGSVYWMAPEVVKQVV-TTKKADIWSVGCVIIEMFTGKHPFP 691

Query: 210 GKDDVDQINVTFRALGTPTDADWPEVSS 237
              D  Q+   F+ +GT T  D P  SS
Sbjct: 692 ---DFSQMQAIFK-IGTNTFPDSPSWSS 715

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 90.5 bits (223), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 104/199 (52%), Gaps = 11/199 (5%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSA-LREVKFLQELKHVN 68
           Y  ++  G G Y VVY   K+ T +  A+K+I   +F+D  +++  + E+  L+ L+H N
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQI---EFEDESELNEHMLEIDLLKNLRHQN 66

Query: 69  VIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127
           ++E          L ++LE+     L  I+K   ++    D  +++  TL G+ + H   
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLL--EDDTVNYVTQTLYGLQYLHEQG 124

Query: 128 ILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTS 187
           ++HRD+K  NLLL  +G +K+ADFG++  +   +  +T      W  APE++ G    T 
Sbjct: 125 VIHRDIKAANLLLTEEGIVKLADFGVSTRIN--RMAMTYAGSPNWM-APEVMTGQGASTV 181

Query: 188 AVDIWSVGVIFAELMLRIP 206
           + DIWS+G    EL+   P
Sbjct: 182 S-DIWSLGATVVELLTGNP 199

>Kwal_33.13984
          Length = 649

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 109/221 (49%), Gaps = 17/221 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK-------HVNV 69
           G+GT+  V       T   +AVK +K+   K      ++ E K L+ L          + 
Sbjct: 285 GQGTFGQVVKCQNLLTKEILAVKVVKS---KSEYLNQSITEAKILELLNGKIDPQGEHHF 341

Query: 70  IELVDVFMANDNLNLVLEFLPADLEIIIKDTSIM-FSPADIKSWILMTLRGVHHCHRNFI 128
           + + + F+  ++L LV E L ++L  ++K       S + I+++    L  +     + +
Sbjct: 342 LRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLKEHKL 401

Query: 129 LHRDLKPNNLLLAP--DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
           +H DLKP N+LL      +LK+ DFG A         L + + +R+YRAPE++ G   Y+
Sbjct: 402 IHCDLKPENILLVSLDRPELKVIDFGSA---CEETRTLYTYIQSRFYRAPEVILGIP-YS 457

Query: 187 SAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
           + +D+WS+G I AEL L IP  PG  + +QI      LG P
Sbjct: 458 TGIDMWSLGCIIAELFLGIPIFPGSSEFNQITRIVDTLGLP 498

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 89.4 bits (220), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 137/327 (41%), Gaps = 77/327 (23%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSAL-REVKFLQ 62
           +S  D Y   K+ G G YA+V     K TG ++AVK     Q  D         E K L 
Sbjct: 95  RSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILL 154

Query: 63  ELKHVNVIELVDVFM-----ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILM 115
            ++H N+++L+D F+           LVLE +      E I++  ++     + K+    
Sbjct: 155 SIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNL--REDETKALFRQ 212

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLAP-------------------DGQLKIADFGLARL 156
            L G+ + H   I+HRD+KP N+LL+                    D Q+KIADFGLA+ 
Sbjct: 213 LLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKF 272

Query: 157 MASPQEILTSNVV--TRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDV 214
                E+  +N +  T  Y APE+L     YTS VD+WS GV+    +   P        
Sbjct: 273 TG---EMKFTNTLCGTPSYVAPEVLVKT-GYTSRVDMWSAGVLLYVCLCGFP-------- 320

Query: 215 DQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREE-LRRRFIAAT-------ENA 266
                                  FS     Q+ PP  +E+ L+ +F   +       ++ 
Sbjct: 321 ----------------------PFSE----QLAPPSMKEQILQGKFAFYSPYWDNIDDSV 354

Query: 267 LELISGMMIMNPKKRWDAVKCLQSQYF 293
           L LIS ++++NP  R+     L   +F
Sbjct: 355 LHLISNLLVVNPASRFSVNDALTHPWF 381

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 107/221 (48%), Gaps = 17/221 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV-------NV 69
           G+GT+  V       T   +AVK +K+   K      ++ E K L+ L          + 
Sbjct: 339 GQGTFGQVVKCQNLITKEILAVKVVKS---KSEYLNQSVTEAKVLELLNRQIDPNNEHHF 395

Query: 70  IELVDVFMANDNLNLVLEFLPADLEIIIKDTSIM-FSPADIKSWILMTLRGVHHCHRNFI 128
           + L D F+   +L LV E L  +L  ++K       S   IK++    L  +     + +
Sbjct: 396 LRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSLCVLKDSKL 455

Query: 129 LHRDLKPNNLLLAPDGQ--LKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
           +H DLKP N+LL  + +  LK+ DFG A         + + + +R+YRAPE+L G   Y+
Sbjct: 456 IHCDLKPENILLVSNDRPDLKVIDFGSA---CEETRTIYTYIQSRFYRAPEVLLGIP-YS 511

Query: 187 SAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTP 227
           + +D+WS G I AEL L IP  PG  + DQ+     +LG P
Sbjct: 512 TGIDMWSFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMP 552

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 118/261 (45%), Gaps = 35/261 (13%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIK----------------------- 42
           T   + K  + G G++  VYLG    TG  +AVK+++                       
Sbjct: 411 TPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSSNAVV 470

Query: 43  ---TSQFKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKD 99
              T   +DG   S+ + +  L+EL H N++          NLN+ LE++P      + +
Sbjct: 471 KKLTDPPQDGGRASSTK-MNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 529

Query: 100 TSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA- 158
           +   F    +K++   TL G+ + HR  I+HRD+K  NLL+   G +KI DFG+++ ++ 
Sbjct: 530 SYGPFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISKKLSP 589

Query: 159 --SPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQ 216
               Q    S   + ++ APE++      T   DIWSVG +  E+       P   D  Q
Sbjct: 590 LNKKQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVVVEMFTGKHPFP---DFSQ 645

Query: 217 INVTFRALGTPTDADWPEVSS 237
           +   F+ +GT T  + P  +S
Sbjct: 646 MQAIFK-IGTNTIPELPSWAS 665

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 89.7 bits (221), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 108/219 (49%), Gaps = 17/219 (7%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTS--QFKDGLDMSALR---EVKFLQELKHVN 68
           KK GEG    V +  KKS G+  AVK  +TS    ++ ++    +   E      L H N
Sbjct: 183 KKIGEGASGSVSI-VKKSNGQQYAVKMFRTSPNSTQEQIEKYCKKITAEFCMGSTLHHAN 241

Query: 69  VIELVDVFMANDNLNLVLEFLPADL-EIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127
           VIE  D+    ++L +V+E+ P D  ++++ +T    SP +I  +      GV++ H   
Sbjct: 242 VIETFDIIREGNSLLMVMEYAPYDFFDLVMTNT---MSPDEISCYFKQLCHGVNYLHAMG 298

Query: 128 ILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE----ILTSNVVTRWYRAPELLFGAK 183
           I HRDLK +N ++  DG LK+ DFG A +   P E      T  V +  Y +PELL    
Sbjct: 299 IAHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELLEMNH 358

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFR 222
           +     D+WS+ +I+  + L+    P K    Q N +FR
Sbjct: 359 YDPRLADVWSLAIIYYCMTLK--RFPWKAPRKQFN-SFR 394

>Scas_668.22
          Length = 893

 Score = 90.1 bits (222), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 106/202 (52%), Gaps = 9/202 (4%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVN 68
           YT   K G+G    VY+  +  +  S+A+K++    Q K  L    + E+  ++  +H N
Sbjct: 611 YTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKEL---IINEILVMKGSRHPN 667

Query: 69  VIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127
           ++  +D ++ + +L +++E++    L  ++  T  + +   I +    TL G+   H   
Sbjct: 668 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVV--THCILTEGQIGAVCRETLSGLQFLHSKG 725

Query: 128 ILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTS 187
           +LHRD+K +N+LL+  G +K+ DFG    +       T+ V T ++ APE++   K Y  
Sbjct: 726 VLHRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGP 784

Query: 188 AVDIWSVGVIFAELML-RIPYL 208
            VDIWS+G++  E++    PYL
Sbjct: 785 KVDIWSLGIMIIEMIEGEPPYL 806

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 90.1 bits (222), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 107/205 (52%), Gaps = 16/205 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK------------DGLDMSALREVKFLQEL 64
           G G+   V +   ++ G+  AVK I  S F             D L     RE+  ++ L
Sbjct: 24  GVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYGIEREIIIMKLL 83

Query: 65  KHVNVIELVDVFMANDNLNLVLEFL-PADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
            H NV+ L DV+  + +L +VLE++   +L  ++ +   +     ++ +    + G+ +C
Sbjct: 84  NHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVR-FFRQIIIGISYC 142

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           H   I+HRDLKP NLLL     +K+ADFG+A L  S  ++L ++  +  Y APE++ G  
Sbjct: 143 HALGIVHRDLKPENLLLDHKFNVKLADFGMAAL-ESKDKLLETSCGSPHYAAPEIVSGLP 201

Query: 184 HYTSAVDIWSVGVI-FAELMLRIPY 207
           ++    D+WS GVI +A L  R+P+
Sbjct: 202 YHGFESDVWSCGVILYALLTGRLPF 226

>Kwal_26.7861
          Length = 955

 Score = 89.7 bits (221), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 104/197 (52%), Gaps = 9/197 (4%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           K G+G    VY   +  T  S+A+K++    Q K  L    + E+  ++  KH N++  +
Sbjct: 672 KIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL---IINEILVMKASKHANIVNFI 728

Query: 74  DVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           D ++   +L +V+E++    L  ++  T  + +   I +    TL+G+   H   ++HRD
Sbjct: 729 DSYLLRGDLWVVMEYMEGGSLTDVV--THCILTEGQIGAVSRETLKGLQFLHSKGVIHRD 786

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
           +K +N+LL+  G++K+ DFG    +       T+ V T ++ APE++   K Y   VDIW
Sbjct: 787 IKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 845

Query: 193 SVGVIFAELML-RIPYL 208
           S+G++  E++    PYL
Sbjct: 846 SLGIMIIEMIEGEPPYL 862

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 109/226 (48%), Gaps = 16/226 (7%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           + +Y    K G G Y+ V+ G   +  +   +K +K  + K        RE+K L  L  
Sbjct: 47  ISNYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVKMK-----KIYRELKILTNLTG 101

Query: 67  V-NVIELVDVFM--ANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
             NVI L+D+    A+    L+ E +  AD   +       F+  D++ +    L  + +
Sbjct: 102 GPNVIGLLDIVQDQASKIPALIFEEVKNADFRTLYPS----FTLQDLQYYFTQLLIALDY 157

Query: 123 CHRNFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
           CH   I+HRD+KP N+++ P   +L++ D+GLA     P       V +R+++ PELL  
Sbjct: 158 CHSMGIMHRDVKPQNVMIDPAQKKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVN 216

Query: 182 AKHYTSAVDIWSVGVIFAELMLRI-PYLPGKDDVDQINVTFRALGT 226
              Y  ++D+WSVG + A ++ +  P+  G  + DQ+      LGT
Sbjct: 217 LNQYDYSLDLWSVGCMLAAIIFKKEPFFKGSSNADQLVKIADVLGT 262

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 111/219 (50%), Gaps = 14/219 (6%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK-DGLDMSAL-----RE 57
           + TV  +   K  G+G+   V L     +G+  A+K +     + +   ++AL     RE
Sbjct: 55  RDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIERE 114

Query: 58  VKFLQELKHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILM 115
           +  ++ + H N++ L +V+     L LVLE++      + +I    +    A    +   
Sbjct: 115 IIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEA--IHYFKQ 172

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-LKIADFGLARLMASPQEILTSNVVTRWYR 174
            ++GV +CH   I HRDLKP NLLL    + +KIADFG+A L  +   +L ++  +  Y 
Sbjct: 173 IVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETT-NRLLETSCGSPHYA 231

Query: 175 APELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDD 213
           +PE++ G K++ S  D+WS G+I   L+    +LP  DD
Sbjct: 232 SPEIVMGQKYHGSPSDVWSCGIILFALL--TGHLPFNDD 268

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 97/200 (48%), Gaps = 10/200 (5%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK-EIKTSQFKDGLDMSAL-REVKFLQELKHV 67
           Y   K  G GT+ VV       TG  +AVK  IK +   + + + AL  E+  LQ L H 
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 68  NVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
           N++   D F + D   ++ +        + I+K     F+  D    ++  L  V + H 
Sbjct: 97  NIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGK--FTEEDAVRILVEILSAVKYMHS 154

Query: 126 NFILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
             I+HRDLKP NLL    + +  L +ADFG+A+ + S +E+L     +  Y APE+L   
Sbjct: 155 QNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQD 214

Query: 183 KHYTSAVDIWSVGVIFAELM 202
            H     DIWS+GVI   L+
Sbjct: 215 GH-GKPCDIWSIGVITYTLL 233

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 104/197 (52%), Gaps = 9/197 (4%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           K G+G    VY   +  T  S+A+K++    Q K  L    + E+  ++  KH N++  +
Sbjct: 703 KIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL---IVNEILVMKGSKHNNIVNFI 759

Query: 74  DVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           D ++   +L +V+E++    L  ++  T  + +   I +    TL+G+   H   ++HRD
Sbjct: 760 DSYLFRGDLWVVMEYMEGGSLTDVV--THCILTEGQIGAVSRETLKGLQFLHSKGVIHRD 817

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
           +K +N+LL+ +G +K+ DFG    +       T+ V T ++ APE++   K Y   VDIW
Sbjct: 818 IKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 876

Query: 193 SVGVIFAELML-RIPYL 208
           S+G++  E++    PYL
Sbjct: 877 SLGIMIIEMIEGEPPYL 893

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 104/195 (53%), Gaps = 11/195 (5%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDM-----SALR-EVKFLQELKHVNVI 70
            G+G++  VYL    +TG  +AVK+++  ++    ++      AL+ EV  L++L H+N++
Sbjct: 1158 GKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHLNIV 1217

Query: 71   ELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
            + +   +  +  +L LE++       +      F    I+      L G+ + H   ILH
Sbjct: 1218 QYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLKYLHSKGILH 1277

Query: 131  RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTR---WYRAPELLFGAKHYTS 187
            RD+K +NLLL  DG  KI+DFG+++   S      S++  R   ++ APE++   + Y++
Sbjct: 1278 RDMKADNLLLDEDGICKISDFGISK--KSKNIYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1335

Query: 188  AVDIWSVGVIFAELM 202
             VDIWS+G +  E+ 
Sbjct: 1336 KVDIWSLGCVVLEMF 1350

>CAGL0I05192g complement(493635..494756) highly similar to sp|P15790
           Saccharomyces cerevisiae YIL035c CKA1 casein kinase II,
           start by similarity
          Length = 373

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 152/348 (43%), Gaps = 68/348 (19%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAV---------------------- 38
           +T  + V DY  E K G G Y+ V+ G + ++ + I +                      
Sbjct: 31  VTWSNNVKDYEIEMKVGRGKYSEVFQGVQLASRKHIVIKMLKPVKKKKIRREIKILTNLS 90

Query: 39  --------KEIKTSQFKDGLDMSALREVK-FLQEL---KHVNVIELVDVFM--ANDNLNL 84
                   +E     +    D + L++++ ++ EL    H N+I+L DV     +    L
Sbjct: 91  NEKNPPTAQEFNRDLYFSNRDENILKQIRPYIYELPHHGHENIIQLFDVIRDPISRTPAL 150

Query: 85  VLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLL-AP 142
           V E +   D  ++        S  DI+ ++   L+ + +CH   I+HRD+KP+N+++   
Sbjct: 151 VFEHVNNMDFRVLYPK----LSDIDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHK 206

Query: 143 DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELM 202
             +L++ D+GLA       E     V +R+++ PELL   + Y  ++D+WS G + A ++
Sbjct: 207 QRKLRLIDWGLAEFYHVNME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMI 265

Query: 203 L-RIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNY-NKIQIYPPPSREEL----R 256
             + P+  G  + DQ+    R LG+           F  Y  K QI  P    ++    R
Sbjct: 266 FQKEPFFHGTSNTDQLVKIVRVLGS---------DDFEKYLIKYQITLPREFHDMDQYIR 316

Query: 257 R----------RFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
           R          R ++  E+ ++L+  ++  + ++R  A + +   +F+
Sbjct: 317 RPWYRFVNDQNRHLSDNEDVIDLLDNLLRYDHQERLTAKEAMGHPWFE 364

>CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces
           cerevisiae YFL029c CAK1 cdk-activating protein kinase,
           hypothetical start
          Length = 360

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 103/220 (46%), Gaps = 53/220 (24%)

Query: 68  NVIELVDVFMANDNLNLVLEFLPADLEIIIK-------------------DTSIMFSPAD 108
           +VI+L++    N N+ L  +F P DLE  ++                   +TS+  S  +
Sbjct: 60  HVIKLIEDQCKNSNIELWFKFYPIDLEDYLRSCFKPQNKFNPYYTLGEVLETSLRSSYVN 119

Query: 109 -------IKSWILMTLRGVHHCHRNFILHRDLKPNNLLL----APDGQLKIADFGLA--- 154
                   K + L  ++G++  H++ I+HRD+KP N++L         L + DFG++   
Sbjct: 120 EFDVNEFAKDFFLQIVKGLNFIHQSGIIHRDIKPRNIVLEKLSTGKFNLVLIDFGISYDI 179

Query: 155 ---RLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELM--------- 202
               +   P   +T +V T  Y+APELLFG K+Y+SAVDIW++ VI +            
Sbjct: 180 TETNIDERPDSKIT-DVSTSIYKAPELLFGVKNYSSAVDIWAMLVILSNFFSLASDCKNY 238

Query: 203 ----LRIPYLPGKDDVDQINV---TFRALGTPTDADWPEV 235
                   Y PG++D   I +    F   G PT  +WPEV
Sbjct: 239 LSSCFDDGYRPGEEDGSDIKLIFSIFEKFGVPTANEWPEV 278

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 88.2 bits (217), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 108/219 (49%), Gaps = 28/219 (12%)

Query: 19  GTYAVVYLGTKKSTGRSIAVKEIKTSQ-----------------FKDGLDMSAL------ 55
           GT A + +  K++  R +  +++KT+                   K+G D SAL      
Sbjct: 116 GTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTD-SALNPYGIE 174

Query: 56  REVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILM 115
           RE+  ++ + H NV+ L++V+     L LVLE++          +    S  +   +   
Sbjct: 175 REIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQ 234

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLAPDGQ-LKIADFGLARLMASPQEILTSNVVTRWYR 174
            ++GV +CH   I HRDLKP NLLL    + +KIADFG+A L   P ++L ++  +  Y 
Sbjct: 235 IIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALEL-PNKLLETSCGSPHYA 293

Query: 175 APELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDD 213
           +PE++ G  ++    D+WS G+I   L+    +LP  DD
Sbjct: 294 SPEIVMGKPYHGGPSDVWSCGIILFALL--TGHLPFNDD 330

>ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)
           [2016 bp, 671 aa]
          Length = 671

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 99/199 (49%), Gaps = 14/199 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR---EVKFLQELKHVNVIELV 73
           G G    V +  + S GR+ AVK+ +  +  + +   A +   E      L H NVIE +
Sbjct: 124 GSGAGGSVKVLVRPSDGRTFAVKQFRPRRPGESVKDYARKCTSEYMIGSMLHHPNVIETL 183

Query: 74  DVFMANDNLNL---VLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
           DVF +N   N    V+E+ P D   ++   S   S  +I       + GV++ H     H
Sbjct: 184 DVF-SNSKQNQYYEVMEYCPVDFFAVV--MSGQMSRGEINCCFKQLVEGVNYLHSKGYAH 240

Query: 131 RDLKPNNLLLAPDGQLKIADFGLA---RLMASPQEILTSNVV-TRWYRAPELLFGAKHYT 186
           RDLK +N ++  DG LK+ DFG A   +      E +   VV +  Y APE+L   K Y+
Sbjct: 241 RDLKLDNCVMTRDGILKLIDFGSAFVFKYTYEADEKMAHGVVGSDPYLAPEVLTSTKSYS 300

Query: 187 SA-VDIWSVGVIFAELMLR 204
           +  VDIWS+G+I+  ++L+
Sbjct: 301 APLVDIWSIGIIYCCMILK 319

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 106/223 (47%), Gaps = 10/223 (4%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           +++Y    K G G Y+ V+ G          +K +K  + K        RE+K L  L  
Sbjct: 47  INNYEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVKMK-----KIYRELKILTNLTG 101

Query: 67  V-NVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
             N+I L+D+     +    L F      +  +     F+ +D + +    L  + +CH 
Sbjct: 102 GPNIIGLLDIVQDPGSKIPALIFEEVK-NVEFRTLYPAFTLSDTQHYFKQLLIALDYCHS 160

Query: 126 NFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
             I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL     
Sbjct: 161 MGIMHRDVKPQNVMIDPTERKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVNLNQ 219

Query: 185 YTSAVDIWSVGVIFAELMLRI-PYLPGKDDVDQINVTFRALGT 226
           Y  ++D+WSVG + A ++ +  P+  G  + DQ+    R LGT
Sbjct: 220 YDYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT 262

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 87.0 bits (214), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 101/213 (47%), Gaps = 11/213 (5%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFK-DGLDMSAL-REVKFLQELKH 66
           DY   K  G GT+ VV      S+G ++AVK +     K   + +  L  E+  LQ+L H
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH 104

Query: 67  VNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            N++   D F + +   +V +        + I++     F   D    +   L+GV + H
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGK--FCEVDAVFIVKQILQGVQYLH 162

Query: 125 RNFILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG 181
           +  I+HRDLKP N+L    + D  L I DFG+A+ +    E++     +  Y APE+L  
Sbjct: 163 QRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTS 222

Query: 182 AKHYTSAVDIWSVGVIFAELMLRI-PYLPGKDD 213
           + H     DIWS+GVI   L+    P+L    D
Sbjct: 223 SGH-GKPCDIWSIGVITYTLLCGYSPFLAESAD 254

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 87.4 bits (215), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 110/225 (48%), Gaps = 11/225 (4%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQF--KDGLDMSALRE- 57
           M+ + +  D+   ++ G G+Y+ VY   ++S+    A+K         ++ +    + + 
Sbjct: 1   MSKRKSPHDFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKN 60

Query: 58  -VKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMT 116
            +  L +  H  +I+L   F   +NL  V++  P    + +     +FS A  + ++   
Sbjct: 61  TLNLLGQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQL 120

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP------QEILTSNVVT 170
           +  V + H   ++HRDLKP N+LL  +G+L IADFG A  +          +  TS V T
Sbjct: 121 VDTVEYIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGT 180

Query: 171 RWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVD 215
             Y +PELL   K Y S+ D+W++G +  + +   P   G+++++
Sbjct: 181 AEYVSPELLLENKSYYSS-DVWALGCMLYQFLQGTPPFRGQNEME 224

>Scas_707.3
          Length = 1598

 Score = 87.4 bits (215), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 8/158 (5%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQF---KDGLDMSALREVK 59
           L  T+ DYT  K   +G Y  VYL  KK TG   A+K +K S         ++ + R + 
Sbjct: 692 LTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIM 751

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPAD-IKSWILMTL 117
            +Q  K   V  L   F   +NL LV+E+LP  DL  +IK   + + P   +K ++   +
Sbjct: 752 MVQSDKPY-VARLFATFQNKENLFLVMEYLPGGDLATLIK--MMGYLPDQWVKQYLTEII 808

Query: 118 RGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR 155
            GV   HRN+I+H DLKP+NLL+   G +K+ DFGL+R
Sbjct: 809 VGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSR 846

>Kwal_26.7788
          Length = 1267

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 104/213 (48%), Gaps = 6/213 (2%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEI-KTSQFKDG-LDMSALREVKFL 61
           + T+  +   K  G+G+   V L     TG+  A+K + KT   + G L     RE+  +
Sbjct: 52  RDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIM 111

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVH 121
           + + H NV+ L +V+     L LVLE++          +       +   +    + G  
Sbjct: 112 KLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTA 171

Query: 122 HCHRNFILHRDLKPNNLLL-APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
           +CH   I HRDLKP NLLL   + ++KIADFG+A L  S  ++L ++  +  Y +PE++ 
Sbjct: 172 YCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTS-NKLLETSCGSPHYASPEIVM 230

Query: 181 GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDD 213
           G  +     D+WS G+I   L+    +LP  DD
Sbjct: 231 GKNYNGGPSDVWSCGIILFALL--TGHLPFNDD 261

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 86.3 bits (212), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 97/203 (47%), Gaps = 14/203 (6%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSA---LREVKFLQELK 65
           +Y   K  G GT+ VV       T   +AVK +     K G D+       E+  LQ LK
Sbjct: 44  NYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALK-GNDVQLQMLYDELSILQMLK 102

Query: 66  HVNVIELVDVFMANDNLNLVLEF-LPADL--EIIIKDTSIMFSPADIKSWILMTLRGVHH 122
           H N++E  D F + D   +V +  +  +L   I+ K     F+  D  S  +  L  V +
Sbjct: 103 HPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK---FTERDAVSITMQILSAVDY 159

Query: 123 CHRNFILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
            H   ++HRDLKP N+L    + D QL IADFG+A+ +    +++     +  Y APE+L
Sbjct: 160 MHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVL 219

Query: 180 FGAKHYTSAVDIWSVGVIFAELM 202
               H     DIWS+GVI   L+
Sbjct: 220 TNNGH-GKPCDIWSIGVIVYTLL 241

>Kwal_33.13112
          Length = 505

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 107/200 (53%), Gaps = 6/200 (3%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNV 69
           Y  ++  G+G++  VY    K TG  +AVK I   + +D +D+ A +E+ FL EL+   V
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDVLA-QEIYFLSELRAPFV 94

Query: 70  IELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILM-TLRGVHHCHRNF 127
                 ++ + ++ +V+EF        ++K       P +  ++I+   L G+ + H   
Sbjct: 95  TTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQR 154

Query: 128 ILHRDLKPNNLLLAPDGQLKIADFGLA-RLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
            +HRD+K  N+LL  +G++K+ DFG++ ++MA+ +    + V T ++ APE++     Y 
Sbjct: 155 KIHRDVKAANILLTDEGEVKLGDFGVSGQIMATLKR--NTFVGTPYWMAPEIIARDNGYD 212

Query: 187 SAVDIWSVGVIFAELMLRIP 206
              DIWS+G+   EL+   P
Sbjct: 213 EKADIWSLGITAMELLTGQP 232

>Kwal_26.8709
          Length = 829

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 128/294 (43%), Gaps = 47/294 (15%)

Query: 17  GEGTYAVVYLGTKKSTGRS------IAVKEIKTSQFKDGLD--MSALREVKFLQELKHVN 68
           GEG +  V LG  K++  S      +A+K I+        +  +   RE+  L+ L H N
Sbjct: 47  GEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINALKHLNHPN 106

Query: 69  VIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           ++ L +V   +  + +VLE+       + I K   +   PA         + GV++ H  
Sbjct: 107 IVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPAC--RLFAQLISGVYYMHSK 164

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
            ++HRDLK  NLLL  +  L I DFG         E++ ++  +  Y APEL+  A+ Y 
Sbjct: 165 GLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARPYE 224

Query: 187 S-AVDIWSVGVIFAELMLRIPYLPGKDDV-----DQINVTFRALGTPTDADWPEVSSFSN 240
           +   D+WS GVI   ++    YLP  DD      D I   +R + T T   +P+      
Sbjct: 225 ARKADVWSCGVILYAMLAG--YLPWDDDPENPDGDDIGKLYRYI-TRTPLKFPDY----- 276

Query: 241 YNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
                I P P                 +L+  ++I +PK+R    K L+ Q+ Q
Sbjct: 277 -----IAPVP----------------RDLLREILIPDPKRRITISKTLKHQWLQ 309

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 87.0 bits (214), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 99/201 (49%), Gaps = 15/201 (7%)

Query: 17   GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDM--SALREVKFLQELKHVNVIELVD 74
            G G++  VY      TG  +AVKEIK    K    +  S   E++ ++ L H N+++   
Sbjct: 1266 GSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYYG 1325

Query: 75   VFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLK 134
            V +  D +N+ +EF        + +   +      + + L  L G+   H++ ++HRD+K
Sbjct: 1326 VEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDIK 1385

Query: 135  PNNLLLAPDGQLKIADFGLARLMA---SPQEILTSN---------VVTRWYRAPELLFGA 182
            P N+LL  +G +K  DFG A+L+A   S +  L +N         + T  Y APE + G 
Sbjct: 1386 PENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVTGQ 1445

Query: 183  KHYT-SAVDIWSVGVIFAELM 202
             H    + DIWS+G +  E++
Sbjct: 1446 GHGKFGSDDIWSLGCVVLEMV 1466

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 103/197 (52%), Gaps = 9/197 (4%)

Query: 15  KAGEGTYAVVYLGTKKSTGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVNVIELV 73
           K G+G    VY   +  T  S+A+K++    Q K  L    + E+  ++  KH N++  +
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKEL---IINEILVMKGSKHPNIVNFI 681

Query: 74  DVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           D ++   +L +++E++    L  ++  T  + +   I +    TL G+   H   +LHRD
Sbjct: 682 DSYVLKGDLWVIMEYMEGGSLTDVV--THCILTEGQIGAVCRETLSGLEFLHSKGVLHRD 739

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
           +K +N+LL+ +G +K+ DFG    +       T+ V T ++ APE++   K Y   VDIW
Sbjct: 740 IKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 798

Query: 193 SVGVIFAELML-RIPYL 208
           S+G++  E++    PYL
Sbjct: 799 SLGIMIIEMIEGEPPYL 815

>Scas_616.10
          Length = 1461

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 84/159 (52%), Gaps = 4/159 (2%)

Query: 56  REVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILM 115
           RE+  ++ + H NV+ L +V+     L LVLE++          +    S  +   +   
Sbjct: 185 REIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQ 244

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKIADFGLARLMASPQEILTSNVVTRWYR 174
            ++GV +CH   I HRDLKP NLLL   +  +KIADFG+A L   P ++L ++  +  Y 
Sbjct: 245 IIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAALEL-PNKLLQTSCGSPHYA 303

Query: 175 APELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDD 213
           +PE++ G  ++    D+WS G+I   L+    +LP  DD
Sbjct: 304 SPEIVMGKSYHGGPSDVWSCGIILFALL--TGHLPFNDD 340

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 85.9 bits (211), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 105/217 (48%), Gaps = 21/217 (9%)

Query: 19  GTYAVVYLGTKKSTGRSIAVKEIKT-----SQFKDGLDMSAL--REVKFLQEL-KHVNVI 70
           G+++VV+      TG+ +A+K ++       Q +    ++AL   E   L+ L  H N+ 
Sbjct: 16  GSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQK---VAALVHNEYAILRRLGTHRNIC 72

Query: 71  ELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPA---DIKSWILMTLRGVHHCHRN 126
           +L+D +   D    VLE+    DL   IK  +I   P    +  S++      + +CH  
Sbjct: 73  QLLDFYEDADTYVFVLEYCAYGDLYDFIK--AIRERPTMRINFHSFLFQLCSAISYCHSK 130

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYT 186
            + HRD+KP N+L+   GQ+K+ DFGL+++ +  ++     + T  Y APE      H T
Sbjct: 131 DVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---IGTEKYLAPETFLREYHNT 187

Query: 187 SAVDIWSVGV-IFAELMLRIPYLPGKDDVDQINVTFR 222
            A D WS+G+ IF  +    P+     D  + +  F+
Sbjct: 188 FATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQ 224

>Scas_700.34
          Length = 864

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 100/213 (46%), Gaps = 19/213 (8%)

Query: 17  GEGTYAVVYLGTKK------STG----RSIAVKEIK--TSQFKDGLDMSALREVKFLQEL 64
           GEG +  V LG  K      S+G    + +A+K I+  T       ++   RE+  L+ L
Sbjct: 55  GEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINALKHL 114

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
            H N+++L +V   +  + +VLE+       + I +   +   PA         + GVH+
Sbjct: 115 THPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPA--CRLFAQLINGVHY 172

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
            H   ++HRDLK  NLLL     L I DFG      S  E++ ++  +  Y APEL+   
Sbjct: 173 IHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGSPCYAAPELVVST 232

Query: 183 KHYTS-AVDIWSVGVIFAELMLRIPYLPGKDDV 214
           K Y +   DIWS GVI   ++    YLP  DD 
Sbjct: 233 KPYEAKKADIWSCGVILYAMLAG--YLPWDDDA 263

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 114/223 (51%), Gaps = 35/223 (15%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-------ALREVKFLQELKHVNV 69
           G G Y  V L     TG  +A+K +   + + G  +          +E++ ++   H NV
Sbjct: 57  GNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVMKRCHHENV 116

Query: 70  IELVDVFMAND----NLNLVLEFL--------PAD-LEIIIKDTSIMFSPADIKSWILMT 116
           +EL ++   ND     + LVLE+         P + +EI     SI+ +    +  +L  
Sbjct: 117 VELYEIL--NDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSIL-TFQQSRKVVLDV 173

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLA--------RLMASPQEILTSNV 168
           + G+ + H   I HRD+KP+NLL++ +G +KI+DFG+A         + +S +++L S  
Sbjct: 174 VSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRA 233

Query: 169 V-TRWYRAPELLFGAKHY--TSAVDIWSVGV-IFAELMLRIPY 207
           + T  + APEL    K Y  +SA+DIWS+GV I+  L  ++P+
Sbjct: 234 LGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

>Kwal_26.7635
          Length = 691

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 98/202 (48%), Gaps = 2/202 (0%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLD-MSALREVKFLQEL 64
           +VDD+   K  G+G++  V    KK T +  A+K I+ S      + +  L E   L  +
Sbjct: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
           ++  ++ L   F + D L +VL F+              FS +  + +    L  +   H
Sbjct: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
              +++RDLKP N+LL   G + + DFGL +L    Q+   +   T  Y APELL G + 
Sbjct: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLG-QG 532

Query: 185 YTSAVDIWSVGVIFAELMLRIP 206
           Y+  VD W++GV+  E+M  +P
Sbjct: 533 YSKVVDWWTLGVLLYEMMTGLP 554

>Kwal_26.8941
          Length = 661

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 107/239 (44%), Gaps = 17/239 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKT---SQFKDGLDMSALREVKFLQELKHVNVIELV 73
           G G    V +  + S G + AVKE +    ++           E      L H NVIE +
Sbjct: 138 GSGAGGSVRVIVRPSDGATFAVKEFRPRRPTELAKDYAKKCTAEFCIGSTLHHPNVIETL 197

Query: 74  DVF--MANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHR 131
           D+F     +    V+E+ P D   ++   S   S  +I   +     GV + H   + HR
Sbjct: 198 DIFSDAKQNKYYEVMEYCPIDFFAVV--MSGNMSRGEINCCLRQLSEGVRYLHNMGLAHR 255

Query: 132 DLKPNNLLLAPDGQLKIADFGLARLMASPQE---ILTSNVV-TRWYRAPELLFGAKHYTS 187
           DLK +N ++  DG LK+ DFG A +   P +    +   +V +  Y APE++   K Y  
Sbjct: 256 DLKLDNCVMTCDGILKLIDFGSAVVFKYPFDSSVTMAHGIVGSDPYLAPEVMTSTKRYDP 315

Query: 188 A-VDIWSVGVIFAELML-RIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKI 244
             VDIWS+G+I+  +ML R P+   K+  D     FR    P D +   V S   + K+
Sbjct: 316 QFVDIWSIGIIYCCMMLKRFPWKTPKESDDN----FRLFCLPDDVEHDYVKSAREHEKL 370

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 133/277 (48%), Gaps = 16/277 (5%)

Query: 6    TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVK--FL-- 61
            ++DD+   K  G+G +  V L   K+T    A+K +K        D+ + R  K  FL  
Sbjct: 830  SLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLA 889

Query: 62   QELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGV 120
             E KH  +  L   F   + +   +EF+   DL   +++  +    A  K +    L  +
Sbjct: 890  TETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNRRLSVRRA--KFYAAEVLLSL 947

Query: 121  HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
             + H N +++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 181  GAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSN 240
            G + YT AVD W+ GV+  +++L      G+D+ D++   F A+ T    D P       
Sbjct: 1008 G-QAYTKAVDWWTFGVLLYQMLLCQSPFSGEDE-DEV---FNAILT----DEPLYPIDMA 1058

Query: 241  YNKIQIYPPPSREELRRRFIAATENALELISGMMIMN 277
             + +QI+     ++  +R  A  ++ALE+++     N
Sbjct: 1059 GDIVQIFQGLLTKDPEKRLGAGPKDALEIMAEPFFSN 1095

>Scas_718.90
          Length = 647

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 138/292 (47%), Gaps = 31/292 (10%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL--QELKHVNVIE 71
           KK GEG    V +  + + G+  AVK  +  +  + +  S    V+F     L H N+IE
Sbjct: 319 KKLGEGATGSVSI-VQGTDGKMFAVKMFRAPKTTNVVTYSKKITVEFCIGSTLHHQNIIE 377

Query: 72  LVDVFMANDNLNLVLEFLPADL-EIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
             D+    +   +V+E+ P D   +++ D   + +  ++  +      GV++ H   I H
Sbjct: 378 TFDMLREGETFLVVMEYAPYDFFNLVMAD---LMTTKEVSCYFKQLCNGVNYLHDMGIAH 434

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQE--ILTSN--VVTRWYRAPELLFGAKHYT 186
           RDLK +N +++ +G LK+ DFG A +   P E  I+ +   V +  Y APELL  + +  
Sbjct: 435 RDLKLDNCVVSHNGILKLIDFGSAVIFQYPYENKIVKAQGIVGSDPYLAPELLNTSTYDP 494

Query: 187 SAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQI 246
             VD+WS+ +I+  ++LR    P K      N +FR      D D  +  +   Y  +++
Sbjct: 495 RPVDVWSIAIIYYCMILR--RFPWKAPRKSFN-SFRLFC--EDPDDEDDVAKGPYRLLRL 549

Query: 247 YPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPE 298
            P  SR                LI+ M++++PKKR    + ++ ++F  + +
Sbjct: 550 LPSKSR---------------PLIAKMLLLDPKKRILMNEVVKDEWFASIKQ 586

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 128/286 (44%), Gaps = 50/286 (17%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIK----------------------- 42
           T  ++ K  + G G++  VYLG    TG  +AVK+++                       
Sbjct: 385 TPKNWLKGARIGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVA 444

Query: 43  ----TSQFKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIK 98
               T+  +  +D +   E+  L+EL+H N++          NLN+ LE++P      + 
Sbjct: 445 KAPSTNLHRKMID-ALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSML 503

Query: 99  DTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR--- 155
                F    I ++    L GV + HR  I+HRD+K  N+L+   G +KI DFG+++   
Sbjct: 504 SNYGPFEEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 563

Query: 156 -LMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML-RIPYLPGKDD 213
            L    Q+  TS   + ++ +PE++      TS  DIWS G +  E+   + PY     D
Sbjct: 564 PLNQENQDKRTSLQGSVYWMSPEVV-KQTATTSKADIWSTGCVVIEMFTGKHPY----PD 618

Query: 214 VDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRF 259
             Q+   F+ +GT      PE+ S+++        P  R+ +R+ F
Sbjct: 619 FSQMQALFK-IGTNV---TPEIPSWAS--------PQGRDFIRKTF 652

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 136/314 (43%), Gaps = 75/314 (23%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR-EVKFLQE 63
           S  D Y   K+ G G YA+V     K TG+S+AVK     +  D       R E K L  
Sbjct: 150 SFFDRYIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMG 209

Query: 64  LKHVNVIELVDVFM-----ANDNLNLVLEFLPADLEI---IIKDTSIMFSPADIKSWILM 115
           L H N+++L++ F+     +     LVLE +  D E+   I++ T +     + ++    
Sbjct: 210 LNHENIVKLLERFVEPLSKSQVQTYLVLEKI-QDGELFDKIVRKTKL--HQDETRALFKQ 266

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLL------APDG-------------QLKIADFGLARL 156
            L G+ + H   I+HRD+KP N+LL      +PD               +KIADFGLA+ 
Sbjct: 267 ILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKF 326

Query: 157 MASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQ 216
               Q   T+   T  Y A E+L     YTS VD+WS GV+    +   P          
Sbjct: 327 TGEMQ-FTTTLCGTPSYVAAEVL-TKTGYTSKVDLWSAGVLLYVCLCGFP---------- 374

Query: 217 INVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREE-LRRRFIAAT-------ENALE 268
                                FS+    Q+ PP  +E+ L+ +F   +       ++ L 
Sbjct: 375 --------------------PFSD----QLAPPSMKEQILQGKFAFYSPYWDEIDDSVLH 410

Query: 269 LISGMMIMNPKKRW 282
           LIS +++++P KR+
Sbjct: 411 LISNLLVVDPAKRY 424

>Scas_477.5
          Length = 703

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 142/333 (42%), Gaps = 76/333 (22%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKE------------------------- 40
           T   + K  + G G++  VYLG    TG  +AVK+                         
Sbjct: 402 TPKSWLKGARIGSGSFGTVYLGMNAQTGELMAVKQVGITAPPTPSAVVDKSKNSNSNGSG 461

Query: 41  -------IKTSQFKDGLDM-----SALR-EVKFLQELKHVNVIELVDVFMANDNLNLVLE 87
                  I   Q K+  +M      AL+ E+  L+EL H N++          NLN+ LE
Sbjct: 462 KNNSNGKIANDQAKNSPNMHKKMVDALQHEMNLLKELHHENIVTYYGSSQEGPNLNIFLE 521

Query: 88  FLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLK 147
           ++P      + +    F  + I ++I   L GV + H   I+HRD+K  N+L+   G +K
Sbjct: 522 YVPGGSVSSMLNNYGPFEESLIVNFIRQVLIGVAYLHNKNIIHRDIKGANILIDTKGCVK 581

Query: 148 IADFGLARLMA--SPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRI 205
           I DFG+++ ++  S Q+   S   + ++ APE++      T   DIWS G +  E+    
Sbjct: 582 ITDFGISKKLSPLSKQDKRASLQGSVYWMAPEVV-KQTATTEKADIWSTGCVVIEMFTGK 640

Query: 206 PYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAATEN 265
              P   D  Q+   F+ +GT T    PEV S+++             +L + F++ T  
Sbjct: 641 HPFP---DFSQMQTIFK-IGTNTT---PEVPSWAS-------------DLGKDFLSKT-- 678

Query: 266 ALELISGMMIMNPKKRWDAVKCLQ-----SQYF 293
                     +N KKR  A++ LQ     +Q+F
Sbjct: 679 --------FEVNYKKRLSALEILQHPWLDTQHF 703

>Kwal_26.8796
          Length = 796

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 109/218 (50%), Gaps = 17/218 (7%)

Query: 3   LKSTVDDYT-KEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFL 61
           L   + DY+ K++  G+G +A V    ++ TG++ AVK I   +    +D  A RE++ L
Sbjct: 180 LTGILRDYSIKDEVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVA-RELEVL 238

Query: 62  QELKHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRG 119
           Q L H  ++ L   +   D+  LV+EF+     ++ +    S+       +      L  
Sbjct: 239 QRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEA 296

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQ--LKIADFGLARLMASPQEILTSNVVTRWYRAPE 177
           V + H   I HRDLKP+N+L+  D    +KI DFGLA++  +    + +   T  Y APE
Sbjct: 297 VKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNG-TFMKTFCGTLAYVAPE 355

Query: 178 LLFG-------AKHYTSAVDIWSVG-VIFAELMLRIPY 207
           ++ G          Y+S VD+WS+G +++  L   +P+
Sbjct: 356 VISGKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPF 393

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 106/223 (47%), Gaps = 10/223 (4%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           + +Y   KK G G Y+ V+ G          +K +K  + K        RE+K L  L  
Sbjct: 48  ISNYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVKMK-----KIYRELKVLTNLTG 102

Query: 67  V-NVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
             N+I L+D+     +    L F      +  +     F+ +D + +    L  + +CH 
Sbjct: 103 GPNIIGLLDIVQDPGSKIPALIFEEVK-NVDFRTLYPSFTLSDTQFYFTQLLTALDYCHS 161

Query: 126 NFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
             I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL     
Sbjct: 162 MGIMHRDVKPQNVMIDPNERKLRLIDWGLAEFY-HPGVDYNIRVASRYHKGPELLVSLNQ 220

Query: 185 YTSAVDIWSVGVIFAELMLRI-PYLPGKDDVDQINVTFRALGT 226
           Y  ++D+W+VG + A ++ +  P+  G  + DQ+    + LGT
Sbjct: 221 YDYSLDLWAVGCMIAAIVFKKEPFFKGSTNADQLVKIAKVLGT 263

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 84.3 bits (207), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           DY   K  G G + VV         +++A+K +     K         E+  LQ+L H N
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPN 114

Query: 69  VIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           +++  D F + +   +V +        + I+K     F+  D    ++  L  V + H  
Sbjct: 115 IVKFKDWFESREKFYIVTQLATGGELFDRILKKGK--FTETDAVKIVVQMLTAVEYMHSQ 172

Query: 127 FILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
            ++HRDLKP N+L    + + QL I+DFG+A+ ++S  +++     +  Y APE+L  + 
Sbjct: 173 NVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSG 232

Query: 184 HYTSAVDIWSVGVIFAELM 202
           H     DIWS+GVI   L+
Sbjct: 233 H-GKPCDIWSLGVITYTLL 250

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 130/292 (44%), Gaps = 41/292 (14%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL 64
           S + +Y   K  GEG++  VYL T + T + + +K        +  D + +REV + ++ 
Sbjct: 32  SEIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKT------GNKRDPNVVREVFYHRQF 85

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
               + +L +V +    + +VLE+       E ++K+  +    +  K         V++
Sbjct: 86  DFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEES--KKLFSQIASAVYY 143

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
            H    +HRDLK  N+LL  +G  K+ DFG  R MA+  ++ T    T  Y APEL+   
Sbjct: 144 AHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETI-CGTTVYMAPELIERK 202

Query: 183 KHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYN 242
            +    VDIWS+G+I   ++    Y+P  +D D I    + +    D           +N
Sbjct: 203 CYDGFKVDIWSLGIILYTMI--NGYMPFDED-DDIKTKLKIVNDELD-----------FN 248

Query: 243 KIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
           +  I                +++A++LI GM+  NP +R    + L   + Q
Sbjct: 249 QEWI----------------SDDAIDLIQGMLRKNPNERISLAQVLSHPFLQ 284

>Scas_715.34
          Length = 1150

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 108/219 (49%), Gaps = 9/219 (4%)

Query: 4    KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVK--FL 61
            K ++D++   K  G+G +  V L   K+TGR  A+K +K        D+ + R  K  FL
Sbjct: 817  KVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFL 876

Query: 62   --QELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLR 118
               + KH  +  L   F   + +   +EF+   DL   +++  +    A  K +    L 
Sbjct: 877  LATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLL 934

Query: 119  GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
             + + H N +++RDLK  N+LL P G +KIAD+GL +         ++   T  + APE+
Sbjct: 935  ALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMAPEI 994

Query: 179  LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQI 217
            L   + YT AVD W+ GV+  +++L      G DD D++
Sbjct: 995  L-KEQGYTRAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV 1031

>KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces
           cerevisiae YIL035c CKA1 casein kinase II, catalytic
           alpha chain, start by similarity
          Length = 373

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 114/259 (44%), Gaps = 38/259 (14%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAV------------KEIK--------- 42
           K+    Y  E K G G Y+ V+ G + ST   I +            +EI          
Sbjct: 34  KANNSQYEVECKVGRGKYSEVFQGVQLSTRNKIVIKMLKPVKKKKIKREITILANLSNEK 93

Query: 43  ---TSQFKDGLDMSALREVKFLQELK----------HVNVIELVDVFMANDNLNLVLEFL 89
              T+Q  D       R  + L+  +          H N+I L+DV     +    L F 
Sbjct: 94  NPPTAQPYDEAKYYTNRREEVLKYARDKVYDLPHNGHENIITLLDVVRDPISKTPALIFE 153

Query: 90  PADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKI 148
             D     +     FS  DI+ ++   L+ + +CH   I+HRD+KP+N+++     +L++
Sbjct: 154 HID-NTEFRRLYASFSDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQHKLRL 212

Query: 149 ADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELM-LRIPY 207
            D+GLA       E     V +R+++ PELL   + Y  ++D+WS G + A ++ L+ P+
Sbjct: 213 IDWGLAEFYHPSME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMVFLKEPF 271

Query: 208 LPGKDDVDQINVTFRALGT 226
             G  + DQ+    R LG+
Sbjct: 272 FYGSSNTDQLVKIVRVLGS 290

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 2/202 (0%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-ALREVKFLQEL 64
           ++DD+   K  G+G++  V    K+ T +  A+K I+ S      +++  L E   L  +
Sbjct: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            +  ++ L   F +++ L LVL F+              F  +  + +    L  +   H
Sbjct: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
              I++RDLKP N+LL   G + + DFGL +L    QE  T+   T  Y APELL G + 
Sbjct: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG-QG 556

Query: 185 YTSAVDIWSVGVIFAELMLRIP 206
           YT  VD W++GV+  E++  +P
Sbjct: 557 YTKVVDWWTLGVLLYEMLTGLP 578

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 98/202 (48%), Gaps = 13/202 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR---EVKFLQELKHVNVIELV 73
           G G    V + T+ + G + AVKE +  +  + +   A +   E      L H NVIE V
Sbjct: 222 GSGAGGSVKILTRPTDGATFAVKEFRPRKPNESVKEYAKKCTAEFCIGSSLHHPNVIETV 281

Query: 74  DVFM--ANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHR 131
           DVF     +    V+++ P D   ++   +   S  +I   +     GV + H   + HR
Sbjct: 282 DVFSDSKQNKYYEVMQYCPIDFFAVV--MTGKMSRGEINCCLKQLTEGVRYLHSMGLAHR 339

Query: 132 DLKPNNLLLAPDGQLKIADFGLARLMASPQE---ILTSNVV-TRWYRAPELLFGAKHYT- 186
           DLK +N ++  DG +K+ DFG A +   P E    +   +V +  Y APE++   K Y  
Sbjct: 340 DLKLDNCVMTADGIIKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPEVITSTKSYDP 399

Query: 187 SAVDIWSVGVIFAELML-RIPY 207
             VDIWS+G+I+  +ML R P+
Sbjct: 400 QCVDIWSIGIIYCCMMLKRFPW 421

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 84.3 bits (207), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 98/196 (50%), Gaps = 16/196 (8%)

Query: 17  GEGTYAVVYLGTKKS----TGRSI-AVKEIKTSQFKDGLDMSALREVKFL--QELKHVNV 69
           G+G++ VV +  KK+    +G  + AVKE +    ++ +  S     +F     LKH N+
Sbjct: 337 GKGSFGVVRICHKKNLKSVSGEILYAVKEFRRRPTENPVKYSKRLTSEFCISSSLKHTNI 396

Query: 70  IELVDVFM-ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           IE +D+F  A  +   V+E+        +II    + +  AD   ++   + GV + H  
Sbjct: 397 IETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADC--FLKQLITGVVYMHNM 454

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARL--MASPQEILTSNVVTRW--YRAPELLFGA 182
            + HRDLKP NLLL  DG LKI DFG +    MA  +EI  S  V     Y APE     
Sbjct: 455 GVCHRDLKPENLLLTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQE 514

Query: 183 KHYTSAVDIWSVGVIF 198
           +    AVDIW+ GVI+
Sbjct: 515 EFDPRAVDIWACGVIY 530

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 84.3 bits (207), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 94/193 (48%), Gaps = 8/193 (4%)

Query: 17  GEGTYAVVYLGTKKSTG---RSIAVKEIKTSQFKDGLD--MSALREVKFLQELKHVNVIE 71
           GEG +  V LG  KS     +++A+K I+        +  +   RE+  L+ L H N++ 
Sbjct: 63  GEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNIVT 122

Query: 72  LVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
           L +V   +  + +VL +    +    I+    +  PA  + +  + + GVH+ H   + H
Sbjct: 123 LEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQL-ISGVHYMHHKGLAH 181

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTS-AV 189
           RDLK  NLLL     L I DFG     +S  +++ ++  +  Y APEL+   K Y +   
Sbjct: 182 RDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARKA 241

Query: 190 DIWSVGVIFAELM 202
           D+WS GVI   ++
Sbjct: 242 DVWSCGVILYAML 254

>Kwal_23.6325
          Length = 1542

 Score = 84.3 bits (207), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 103/215 (47%), Gaps = 16/215 (7%)

Query: 10   YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDM--SALREVKFLQELKHV 67
            + K +  G G +  V+      TG  +AVKEIK    K    +  +   E+  L+ L H 
Sbjct: 1249 WQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHP 1308

Query: 68   NVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127
            NV++   V +  D +NL +E+        + +   +      + + L  L G+ + H++ 
Sbjct: 1309 NVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSS 1368

Query: 128  ILHRDLKPNNLLLAPDGQLKIADFGLARLMAS------------PQEILTSNVVTRWYRA 175
            ++HRD+KP N+LL  +G +K  DFG AR +A+              + + S + T  Y +
Sbjct: 1369 VVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMS 1428

Query: 176  PELLFGAKHYT-SAVDIWSVGVIFAELML-RIPYL 208
            PE + GAK     + DIWS+G +  E++  R P+ 
Sbjct: 1429 PESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWF 1463

>Kwal_55.21709
          Length = 340

 Score = 82.8 bits (203), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 106/223 (47%), Gaps = 10/223 (4%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           ++ Y    K G G Y+ V+ G          +K +K  +          RE+K L  L  
Sbjct: 47  IEHYEIVNKIGRGKYSEVFRGKCVVNDEYCVIKVLKPVK-----LKKIYRELKILTNLTG 101

Query: 67  V-NVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
             NVI L+D+   + +    L F      +  +   + F+  DI+ +    L  + +CH 
Sbjct: 102 GPNVIALLDIVQDSGSKIPALIFEEVK-NVDFRTLYLKFTLPDIQYYFSQLLIALDYCHS 160

Query: 126 NFILHRDLKPNNLLLAP-DGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
             I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL     
Sbjct: 161 MGIMHRDVKPQNVMIDPVERKLRLIDWGLAEFY-HPGVDYNVRVASRYHKGPELLVNLNQ 219

Query: 185 YTSAVDIWSVGVIFAELMLRI-PYLPGKDDVDQINVTFRALGT 226
           Y  ++D+WSVG + A ++ +  P+  G  + DQ+    R LGT
Sbjct: 220 YDYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT 262

>Scas_692.24
          Length = 718

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 106/223 (47%), Gaps = 17/223 (7%)

Query: 33  GRSIAVKEIKTSQFKDGLDMSALR---EVKFLQELKHVNVIELVDVFMANDNLNL--VLE 87
           G + AVKE +  +  + +   A +   E      L H NVIE VD+F  +       V++
Sbjct: 237 GVTFAVKEFRPRKPNESVKEYAKKCTAEFCIGSTLHHPNVIETVDIFSDSKQNKYFEVMQ 296

Query: 88  FLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLK 147
           + P D   ++   +   S  +I   +   L GV + H   + HRDLK +N ++  DG LK
Sbjct: 297 YCPVDFFAVV--MTGKMSRGEINCCLKQLLEGVKYLHSMGLAHRDLKLDNCVMNEDGILK 354

Query: 148 IADFGLARLMASPQE---ILTSNVV-TRWYRAPELLFGAKHYT-SAVDIWSVGVIFAELM 202
           + DFG A +   P E    +   +V +  Y APE++   K Y    VDIWSVG+I+  +M
Sbjct: 355 LIDFGSAVVFRYPYEDDIAMAHGIVGSDPYLAPEVITSTKSYDPQCVDIWSVGIIYCCMM 414

Query: 203 L-RIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKI 244
           L R P+   ++  D     FR    P D +   V S  ++ ++
Sbjct: 415 LKRFPWKAPRESDD----NFRLYSMPDDMEHDYVESARHHEEL 453

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 113/247 (45%), Gaps = 50/247 (20%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR-EVKFLQELK 65
            ++Y+ EK+ G+G++AVVY G     GR+IA+K +  S+ K+   +  L  E+  L+++K
Sbjct: 18  TENYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIK 77

Query: 66  HVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIM-------------FSPADIKS 111
           H +++ L+D    + +  L++E+    DL   IK    +             + P   + 
Sbjct: 78  HPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEH 137

Query: 112 WILMTLRGVHHCHR----------NFILHRDLKPNNLLLAP------DGQ---------- 145
             L  +  V++  +            ++HRD+KP NLLL        D +          
Sbjct: 138 NGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVGI 197

Query: 146 -----LKIADFGLARLMASPQEILTSNVV-TRWYRAPELLFGAKHYTSAVDIWSVGVIFA 199
                LKIADFG AR +  P   L   +  +  Y APE+L   + Y +  D+WSVG +  
Sbjct: 198 YNLPILKIADFGFARFL--PNTSLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVLY 254

Query: 200 ELMLRIP 206
           E+    P
Sbjct: 255 EMCCGRP 261

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 104/198 (52%), Gaps = 10/198 (5%)

Query: 15  KAGEGTYAVVYLGTKKS-TGRSIAVKEIK-TSQFKDGLDMSALREVKFLQELKHVNVIEL 72
           K G+G    VYL   +S   + +A+K++    Q K  L    + E+  +   KH N++  
Sbjct: 571 KIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKEL---IVNEIMVMSSSKHQNIVNY 627

Query: 73  VDVFMANDNLNLVLEFLPAD-LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHR 131
           +D +++  +L +V+E++    L  ++  T  + +   I +     L+G+   H   +LHR
Sbjct: 628 IDSYLSGLDLWVVMEYMEGGCLTDVV--TYCVLTEGQIGAVCREVLQGLEFLHSKGVLHR 685

Query: 132 DLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDI 191
           D+K +N+LL+ +G +K+ DFG    +       T+ V T ++ APE++   K Y   VDI
Sbjct: 686 DIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIV-SRKEYGPKVDI 744

Query: 192 WSVGVIFAELML-RIPYL 208
           WS+G++  E++    PYL
Sbjct: 745 WSLGIMIIEMIEGEPPYL 762

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 101/208 (48%), Gaps = 20/208 (9%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           G G +A V    +++TG++ AVK I   +    +D    RE++ LQ+L H  ++ L   +
Sbjct: 195 GTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD-GVSRELEVLQKLNHPRIVSLKAFY 253

Query: 77  MANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKP 135
               N  +V+EF+   DL   +     +   A  +      L  + + H   I HRDLKP
Sbjct: 254 EDEANYYMVMEFISGGDLMDFVAAHGAVGEEAG-REISRQILEAIQYIHSKGISHRDLKP 312

Query: 136 NNLLLAPDGQ--LKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG------------ 181
           +N+L+  D    +KI DFGLA++  +   I+ +   T  Y APE++ G            
Sbjct: 313 DNILIEQDDPVLVKITDFGLAKVQGNG-SIMKTFCGTLAYVAPEVIGGFTGATGEEETEE 371

Query: 182 -AKHYTSAVDIWSVG-VIFAELMLRIPY 207
               Y+S VD+WS+G ++F  L   +P+
Sbjct: 372 ERIEYSSLVDMWSMGCLVFVILTGHLPF 399

>Kwal_55.21545
          Length = 865

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 97/196 (49%), Gaps = 13/196 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV-NVIELVDV 75
           G G + VVY G    T +  A+K +      D ++    +E++FL  LK V N+      
Sbjct: 26  GRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVE-DVQKEIQFLSSLKQVPNITHYYGS 84

Query: 76  FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADI-KSWILMTLR----GVHHCHRNFILH 130
           ++ +  L +++E+              +  P  I + +I + +R     + H H++ ++H
Sbjct: 85  YLNDTKLWVIMEYCAGG------SLRTLLRPGKIGEQYIGVIMRELLTALMHIHKDGVIH 138

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVD 190
           RD+K  N+L+  DG +K+ DFG+A  ++  +    +   T ++ APE++    +Y + VD
Sbjct: 139 RDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDTKVD 198

Query: 191 IWSVGVIFAELMLRIP 206
           IWS+G+   E+    P
Sbjct: 199 IWSLGITAYEIATGNP 214

>Kwal_33.13831
          Length = 700

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 84/168 (50%), Gaps = 10/168 (5%)

Query: 43  TSQFKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTS 101
           TS+F  G    +L E +   +  H N+++++D+   +D    VLEF P+ DL  ++  TS
Sbjct: 447 TSEFIIG---HSLSERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTS 503

Query: 102 IM-FSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP 160
                P +   ++   L GV + H + I H DLKP N+L  P G LKI DFG + +  + 
Sbjct: 504 KNGLHPLEADCFMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSCVFQTA 563

Query: 161 QE----ILTSNVVTRWYRAPELLFGAKHYTSA-VDIWSVGVIFAELML 203
            E      T  V +  Y APE     + Y    VD WS GVI+  ++L
Sbjct: 564 WEKQVHFQTGAVGSEPYVAPEEFIAEREYDPRLVDSWSCGVIYCTMVL 611

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 139/303 (45%), Gaps = 44/303 (14%)

Query: 4    KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVK--FL 61
            K ++D++   K  G+G +  V L   K+T R  A+K +K        D+ + R  K  FL
Sbjct: 811  KVSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFL 870

Query: 62   --QELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLR 118
               + KH  +  L   F   + +   +EF+   DL   +++  +    A  K +    L 
Sbjct: 871  LATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLL 928

Query: 119  GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
             +   H N +++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APEL
Sbjct: 929  ALKFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPEL 988

Query: 179  LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSF 238
            L   + YT AVD W+ GV+  +++L      G DD D++   F A+ T    D P     
Sbjct: 989  L-REQDYTKAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEP----- 1034

Query: 239  SNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRW-----DAVKCLQSQYF 293
                   +YP           I    + +++  G++  +P+KR      DA++ ++  +F
Sbjct: 1035 -------LYP-----------IDMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFF 1076

Query: 294  QEL 296
            + +
Sbjct: 1077 RNI 1079

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 108/219 (49%), Gaps = 9/219 (4%)

Query: 4    KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVK--FL 61
            K ++D++   K  G+G +  V L   K+T R  A+K +K        D+ + R  K  FL
Sbjct: 818  KVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFL 877

Query: 62   --QELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLR 118
               + KH  +  L   F   + +   +EF+   DL   +++  +    A  K +    L 
Sbjct: 878  LATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLL 935

Query: 119  GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
             + + H N +++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APE+
Sbjct: 936  ALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEI 995

Query: 179  LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQI 217
            L   + YT AVD W+ GV+  +++L      G DD D++
Sbjct: 996  L-KEQEYTKAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV 1032

>Kwal_33.14434
          Length = 759

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 101/208 (48%), Gaps = 20/208 (9%)

Query: 10  YTKEKKA-GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREV--KFLQE--- 63
           YTK  +  G G    V L  +    +  AVKE +T       D  A R+   K   E   
Sbjct: 403 YTKTGENLGAGAGGSVRLVRRTQDNKLFAVKEFRTK-----FDHEAKRDYVKKITSEYCI 457

Query: 64  ---LKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGV 120
              L+H N+IE V++   N+ +  V+EF   DL  I+    + +   +I       L GV
Sbjct: 458 GTTLRHPNIIETVEIVYDNNRILQVMEFCDYDLFAIVMSNKMSYE--EICCCFKQILTGV 515

Query: 121 HHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE---ILTSNVV-TRWYRAP 176
            + H   + HRDLK +N ++   G +K+ DFG A + + P     + +S +V +  Y AP
Sbjct: 516 QYLHSMGLAHRDLKLDNCVINKHGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYLAP 575

Query: 177 ELLFGAKHYTSAVDIWSVGVIFAELMLR 204
           E+   +K+    VD+WSV +IFA ++L+
Sbjct: 576 EVCIFSKYDPRPVDVWSVAIIFACMVLK 603

>Kwal_27.10581
          Length = 1154

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 107/221 (48%), Gaps = 8/221 (3%)

Query: 4    KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVK--FL 61
            K ++DD+   K  G+G +  V L   K+  R  A+K +K        D+ + R  K  FL
Sbjct: 821  KISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVFL 880

Query: 62   --QELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLR 118
               + KH  +  L   F   + +   +EF+   DL   +++  +    A  K +    L 
Sbjct: 881  LATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLL 938

Query: 119  GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
             + + H N +++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APE+
Sbjct: 939  ALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEI 998

Query: 179  LFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINV 219
            L   + YT AVD W+ GV+  +++L      G+D+ +  N 
Sbjct: 999  L-KEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNA 1038

>Kwal_33.14192
          Length = 577

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 107/224 (47%), Gaps = 30/224 (13%)

Query: 64  LKHVNVIELVDVFMANDNLNLVLEFLPADL-EIIIKDTSIMFSPADIKSWILMTLRGVHH 122
           L H N+IE +D+     N  +V+E+ P D   +++ D   + S  +I  +      GV +
Sbjct: 277 LHHCNIIETLDMLQEGTNFLVVMEYCPYDFFNLVMSD---LMSKNEISCYFKQICNGVDY 333

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASP--QEILTSN--VVTRWYRAPEL 178
            HR  + HRDLK +N ++   G LK+ DFG A +   P  +EIL +   V +  Y APEL
Sbjct: 334 LHRMGLAHRDLKLDNCVVTKQGILKLIDFGSAVVFQYPYEKEILRAKGIVGSDPYLAPEL 393

Query: 179 LFGAKHYTSAVDIWSVGVIFAELML-RIPYLPGKDDVDQINVTFRALGTPTDADWPEVSS 237
           L    +    VD+WS+ ++F  + L R P+   +D       +FR      D++    S+
Sbjct: 394 LSHPSYDPRPVDVWSIAIMFYCITLKRFPWKAPRDKYQ----SFRLFCEGADSE--RDST 447

Query: 238 FSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKR 281
              +  +++ P  SR                +IS M+ ++PK+R
Sbjct: 448 RGPFRLLKLLPRHSR---------------PVISQMLQLDPKRR 476

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 103/212 (48%), Gaps = 15/212 (7%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           V +Y  +K+ GEG++  VYL T + T + + +K        D  D + +REV + ++  +
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKT------GDKSDPNVVREVFYHRQFDY 92

Query: 67  VNVIELVDVFMANDNLNLVLEFLPADL---EIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
             + +L +V +    + + LE+ P       ++ K        A++ + I      VH+ 
Sbjct: 93  PYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITG---AVHYA 149

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           H    +HRDLK  N+LL  +G  K+ DFG  R   + + +L +   T  Y APE++    
Sbjct: 150 HTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKP 208

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVD 215
           +    VDIWS+GVI   L+     LP  +D D
Sbjct: 209 YDGFKVDIWSLGVILYTLLCGC--LPFDEDDD 238

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 108/250 (43%), Gaps = 40/250 (16%)

Query: 12  KEKKAGEGTYAVVYLGTKKSTGRSIAVKEIK----------------------------- 42
           K  + G G++  VYLG    TG  +AVK+++                             
Sbjct: 441 KGARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTA 500

Query: 43  ---TSQFKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKD 99
              TSQ    +  +   E+  L+EL H N++          NLN+ LE++P      + +
Sbjct: 501 VKNTSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 560

Query: 100 TSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA- 158
               F    +K++    L G+ + H+  I+HRD+K  N+L+   G +KI DFG+++ ++ 
Sbjct: 561 NYGPFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSP 620

Query: 159 --SPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQ 216
               Q    S   + ++ APE++      T   DIWSVG +  E+       P   D  Q
Sbjct: 621 LNKQQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVIVEMFTGKHPFP---DFSQ 676

Query: 217 INVTFRALGT 226
           +   F+ +GT
Sbjct: 677 MQAIFK-IGT 685

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 2/202 (0%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMS-ALREVKFLQEL 64
           ++DD+   K  G+G++  V    KK T +  A+K I+ S      +++  L E   L  +
Sbjct: 385 SIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 444

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            +  ++ L   F + + L LVL F+              F  +  + +    L  +   H
Sbjct: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLH 504

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
              +++RDLKP N+LL   G + + DFGL +L    Q+   +   T  Y APELL G + 
Sbjct: 505 SLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLG-QG 563

Query: 185 YTSAVDIWSVGVIFAELMLRIP 206
           Y+  VD W++GV+  E++  +P
Sbjct: 564 YSKVVDWWTLGVLLYEMLTGLP 585

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 82.0 bits (201), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 130/283 (45%), Gaps = 24/283 (8%)

Query: 4    KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVK--FL 61
            K ++DD+   K  G+G +  V L   K+T R  A+K +K        D+ + R  K  FL
Sbjct: 816  KVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFL 875

Query: 62   --QELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMTLR 118
               + KH  +  L   F   + +   +EF+   DL   +++  +    A  K +    L 
Sbjct: 876  LATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLL 933

Query: 119  GVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178
             + + H N I++RDLK  N+LL  +G +KIAD+GL +      E+   N  + +   PE 
Sbjct: 934  ALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCK-----DEMWFGNRTSTFCGTPEF 988

Query: 179  L----FGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPE 234
            +       + YT AVD W+ GV+  +++L      G DD D++   F A+ T    D P 
Sbjct: 989  MAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEPL 1040

Query: 235  VSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMN 277
                   + +QI+     ++  +R  A + +ALE++      N
Sbjct: 1041 YPIDMAGDIVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRN 1083

>Scas_640.14*
          Length = 728

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 93/214 (43%), Gaps = 14/214 (6%)

Query: 17  GEGTYAVVYLGTKKST---------GRSIAVKEIKTSQFKDGLD--MSALREVKFLQELK 65
           GEG +  V +G   ++          + +A+K I+    K G +  M   RE+  L+ L 
Sbjct: 45  GEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKHLT 104

Query: 66  HVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
           H N++ L +V   +  + +VLE+                  A         + GV + H 
Sbjct: 105 HPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHS 164

Query: 126 NFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHY 185
             I+HRDLK  NLLL     L I DFG      +  E++ ++  +  Y APEL+   + Y
Sbjct: 165 KGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTEPY 224

Query: 186 TS-AVDIWSVGVIFAELMLRIPYLPGKDDVDQIN 218
            +   DIWS G+I   ++    YLP  DD    N
Sbjct: 225 KARKADIWSCGIILYGML--AGYLPWDDDKQNPN 256

>Scas_704.50
          Length = 369

 Score = 80.5 bits (197), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 79/337 (23%), Positives = 144/337 (42%), Gaps = 62/337 (18%)

Query: 9   DYTKEKKAGEGTYAVVYLGTKKSTGRSIAV------------KEIK-------------T 43
           DY  E K G G Y+ V+ G K +    I +            +EI              T
Sbjct: 39  DYEIEVKVGRGKYSEVFQGVKLNDRSPIVIKMLKPVKKKKIKREISILTNLSNEKTPPTT 98

Query: 44  SQFKDGLDMSALRE------VKFLQEL---KHVNVIELVDVFMANDNLNLVLEFLPADLE 94
             F   L  +  +E        +L +L    H N+I+L D+     +    L F   D  
Sbjct: 99  LPFDVDLYYTNKKESVLKFKADYLYDLPHDGHKNIIQLFDIIKDPISKTPALVFEHVD-N 157

Query: 95  IIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLL-APDGQLKIADFGL 153
           I  +      +  DI+ ++   L+ + +CH   I+HRD+KP+N+++   + +L++ D+GL
Sbjct: 158 IDFRVLYPKLTDMDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGL 217

Query: 154 ARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML-RIPYLPGKD 212
           A    +  E     V +R+++ PELL   + Y  ++D+WS G + A ++  + P+  G  
Sbjct: 218 AEFYHANME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMVFQKEPFFHGTS 276

Query: 213 DVDQINVTFRALGTPTDADWPEVSSFSNY-NKIQIYPPPSREEL----RR---------- 257
           + DQ+    R LG+           F  Y  K +I  P    ++    RR          
Sbjct: 277 NTDQLVKIVRVLGS---------EDFEKYLTKYEITLPREFHDMDQYIRRPWYRFINDAN 327

Query: 258 RFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
           R +   E+ ++LI  ++  + ++R  A + +   +F+
Sbjct: 328 RHLCDNEDIIDLIDNLLKYDHQERLTAKEAMGHPWFE 364

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 80.1 bits (196), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQ-FKDGLDMSALREVKFLQ 62
           K ++ D+   +K G+G +  VY    K +G   A+K I+ ++  +  L     REV    
Sbjct: 94  KLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQL 153

Query: 63  ELKHVNVIELVDVFMANDNLNLVLEF-LPADLEIIIKDTSIMFSPADIKSWILMTLRGVH 121
            + H N+I+L   F     + L++E  +  +L   +K+    F+      +I      +H
Sbjct: 154 GMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNG-PFNDVLASHYIYQIADALH 212

Query: 122 HCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLM--ASPQEILTSNVVTRWYRAPELL 179
           + H+  I+HRD+KP N+L+  D  +K+ADFG + L    S ++ L   +    Y +PE++
Sbjct: 213 YMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTID---YLSPEMI 269

Query: 180 FGAKHYTSAVDIWSVGVIFAELMLRIP 206
              + Y   VD+W++GV+  EL++ +P
Sbjct: 270 -TPREYDEQVDVWALGVLAYELVVGVP 295

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 81.3 bits (199), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 88/181 (48%), Gaps = 16/181 (8%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQF---KDGLDMSALREVK 59
           L  ++ DY   K   +G Y  VYL  KK TG   A+K ++ S         ++ + R + 
Sbjct: 775 LTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIM 834

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPAD--IKSWILMT 116
            +Q  K   V  L   F   DNL LV+E+LP  DL  ++K   +M    D  +K ++   
Sbjct: 835 MVQSDKPY-VARLYATFQNKDNLFLVMEYLPGGDLATLLK---MMGCLPDEWVKQYLSEI 890

Query: 117 LRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARL------MASPQEILTSNVVT 170
           + GV   H N I+H DLKP NLL+   G LK+ DFGL+R          P+ I  SN  T
Sbjct: 891 IIGVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGLVKRHRHIPKPISLSNADT 950

Query: 171 R 171
           R
Sbjct: 951 R 951

>AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C
           (HAL5) - SH] (399738..401789) [2052 bp, 683 aa]
          Length = 683

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 77/147 (52%), Gaps = 9/147 (6%)

Query: 66  HVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFS---PADIKSWILMTLRGVH 121
           H N+++++D+  A+D    V EF P+ DL  ++  +S   S   P +   ++   L GV 
Sbjct: 451 HPNILKVLDLMQAHDVFIEVFEFCPSGDLFSLLTRSSKTGSGLHPLEADCFMKQLLNGVR 510

Query: 122 HCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE----ILTSNVVTRWYRAPE 177
           + H + + H DLKP N+L  P+G LK+ DFG + +  +  E      T  V +  Y APE
Sbjct: 511 YMHDHGVAHCDLKPENILFTPNGTLKLCDFGSSSVFQTAWEKRVHFQTGAVGSEPYVAPE 570

Query: 178 LLFGAKHY-TSAVDIWSVGVIFAELML 203
                + Y T  VD WS G+I+  ++L
Sbjct: 571 EFIPKREYDTRLVDCWSCGIIYCTMVL 597

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 102/205 (49%), Gaps = 18/205 (8%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           G+G +A V    +++TG++ AVK I   +    +D    RE++ L+ L H  ++ L   +
Sbjct: 224 GQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD-GVTRELEVLRRLNHPRIVSLKGFY 282

Query: 77  MANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLK 134
             +++  L++EF+     ++ +    S+       +      L  V + H   I HRDLK
Sbjct: 283 EDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVRYIHEQGISHRDLK 340

Query: 135 PNNLLLAPDGQ--LKIADFGLARLMASPQEILTSNVVTRWYRAPELLFG---------AK 183
           P+N+L+  D    +KI DFGLA++  +    + +   T  Y APE++ G           
Sbjct: 341 PDNILIEQDDPVLVKITDFGLAKIQDNT-TFMKTFCGTLAYVAPEVIGGKNPEGNGANGN 399

Query: 184 HYTSAVDIWSVG-VIFAELMLRIPY 207
            Y+S VD+WS+G +++  L   +P+
Sbjct: 400 LYSSLVDMWSIGCLVYVILTGHLPF 424

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 101/210 (48%), Gaps = 22/210 (10%)

Query: 17  GEGTYAVVYLGTKKST----GRSIAVKEIKTSQFKDGLDMSALREVKFLQELK------H 66
           GEG +  V LG  K+      R++A+K I+    +D +  ++ +E+K  +EL       H
Sbjct: 52  GEGEFGKVKLGWSKARLDGDSRNVAIKLIR----RDTVPKNSEKEIKIYRELNALKLLSH 107

Query: 67  VNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            N++ L +V   +  + +VL++       + I K   +   PA         + GVH+ H
Sbjct: 108 PNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPA--CRLFAQLISGVHYIH 165

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184
              + HRDLK  NLLL     L I DFG         +++ ++  +  Y APEL+  +K 
Sbjct: 166 YKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHK-NDLMRTSCGSPCYAAPELVVSSKP 224

Query: 185 YTS-AVDIWSVGVIFAELMLRIPYLPGKDD 213
           Y++   D+WS GVI   ++    YLP  DD
Sbjct: 225 YSAQKADVWSCGVILYAMLAG--YLPWDDD 252

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 116/258 (44%), Gaps = 37/258 (14%)

Query: 1    MTLKSTVDD----YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDM--SA 54
            +TL S++ +    + K    G G++  VY      TG  +AVKEIK +  K    +  S 
Sbjct: 1178 LTLASSLSNVSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSI 1237

Query: 55   LREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWIL 114
              E+  L+ L H NV++   V +  D +N+ +E+        +     +      + + L
Sbjct: 1238 RDEMTVLEMLNHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAHGRIEDEMVTQVYSL 1297

Query: 115  MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMAS--------PQEILTS 166
              L G+ + H + + HRD+KP N+LL  +G +K  DFG A+++AS         Q +   
Sbjct: 1298 QMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGE 1357

Query: 167  NVV-TRWYRAPELLFGAKHYT-SAVDIWSVGVIFAELML--------------------- 203
             ++ T  Y +PE + G  +    + DIWS+G +  E++                      
Sbjct: 1358 KMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAG 1417

Query: 204  RIPYLPGKDDVDQINVTF 221
            +IP  P K+++ Q  + F
Sbjct: 1418 QIPMFPSKNEMSQAGIKF 1435

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 98/199 (49%), Gaps = 9/199 (4%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK-EIKTSQFKDGLDMSALREVKFLQELKHVN 68
           Y  ++  G G++ VV    +  +   +AVK  +K +  K+G       E+  +Q L H N
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 69  VIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           +++  D F       +V +        + I+ D    ++  D  + ++  L+ V + H  
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK--YTEEDAVNIVVQILKAVEYLHSQ 182

Query: 127 FILHRDLKPNNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
            I+HRDLKP NLL    + D ++ +ADFG+AR + +  +++     +  Y APE +F + 
Sbjct: 183 NIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPE-VFTSD 241

Query: 184 HYTSAVDIWSVGVIFAELM 202
            +    DIWSVGVI   L+
Sbjct: 242 GHGKPSDIWSVGVITYTLL 260

>YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kinase
           II (protein kinase CK2), catalytic (alpha) subunit [1119
           bp, 372 aa]
          Length = 372

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 116/263 (44%), Gaps = 48/263 (18%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVK------------------------- 39
           +   DY  E K G G Y+ V+ G K  +   I +K                         
Sbjct: 35  TNTKDYEIENKVGRGKYSEVFQGVKLDSKVKIVIKMLKPVKKKKIKREIKILTDLSNEKV 94

Query: 40  ----------EIKTSQFKDGLDMSALREVKFLQELK-HVNVIELVDVFM--ANDNLNLVL 86
                     +  T+Q +D L    +R   F Q    H N+I L D+     +    LV 
Sbjct: 95  PPTTLPFQKDQYYTNQKEDVLKF--IRPYIFDQPHNGHANIIHLFDIIKDPISKTPALVF 152

Query: 87  EFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLL-APDG 144
           E++   D  I+    + +    +I+ ++   L+ + +CH   I+HRD+KP+N+++   + 
Sbjct: 153 EYVDNVDFRILYPKLTDL----EIRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKNK 208

Query: 145 QLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML- 203
           +L++ D+GLA       E     V +R+++ PELL   + Y  ++D+WS G + A ++  
Sbjct: 209 KLRLIDWGLAEFYHVNME-YNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFK 267

Query: 204 RIPYLPGKDDVDQINVTFRALGT 226
           R P+  G  + DQ+    + LGT
Sbjct: 268 REPFFHGTSNTDQLVKIVKVLGT 290

>Kwal_27.9763
          Length = 868

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 9/203 (4%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL 64
           S    Y  ++  G+G Y +VY    + T + +A+K I+  + +       + E+  L+ L
Sbjct: 18  SNTHHYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYDEEE--ELNEHMLEIDLLKNL 75

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           KH N+++       +  L ++LE+     L  +IK   +       K++I  TL G+ + 
Sbjct: 76  KHENIVKYHGFIQKSHQLFILLEYCSQGSLRDLIKRGPV--EEQQCKTYIRQTLHGLKYL 133

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           H   ++HRD+K  NLLL     +K+ADFG++  + +    +T      W  APE++ G  
Sbjct: 134 HDQGVIHRDIKAANLLLDAQNVVKLADFGVSTRVNNLA--MTYAGSPNWM-APEVMMGQG 190

Query: 184 HYTSAVDIWSVGVIFAELMLRIP 206
             T + DIWS+G    E++   P
Sbjct: 191 ASTVS-DIWSLGATVVEILTGNP 212

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 113/253 (44%), Gaps = 51/253 (20%)

Query: 2   TLKSTVDDYTKEKKAGEGTYAVVYLGTKKS-TGRSIAVKEIKTSQFKDGLDMSALR-EVK 59
            L ++  +YT EK+ G+G++A VY G   S   + +A+KE+  ++ K+   +  L  E+ 
Sbjct: 16  NLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIA 75

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTL- 117
            L+++KH +++ L+D    + +  L++E+    DL  ++K    +     +   +     
Sbjct: 76  ILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYP 135

Query: 118 ---RGVHHCHRNFIL-------------------HRDLKPNNLLLAP------DGQ---- 145
                 +  HR F+L                   HRD+KP NLLL+       D +    
Sbjct: 136 PPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHE 195

Query: 146 -----------LKIADFGLARLMASPQEILTSNVV-TRWYRAPELLFGAKHYTSAVDIWS 193
                      LKIADFG AR +  P   L   +  +  Y APE+L   + Y +  D+WS
Sbjct: 196 LGFVGIYNLPILKIADFGFARFL--PNTSLAETLCGSPLYMAPEIL-NYQKYNAKADLWS 252

Query: 194 VGVIFAELMLRIP 206
           VG +  E+    P
Sbjct: 253 VGTVVFEMCCGTP 265

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 128/288 (44%), Gaps = 32/288 (11%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR---EVKFLQELKHVNVI 70
           K  G+G    V +  K + G+  AVK  +    ++ L   + +   E      L+H N+I
Sbjct: 268 KVPGKGVSGSVSV-IKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNII 326

Query: 71  ELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILH 130
           E +D+    +   +V+E+ P D   ++   S   +  ++  +     RGV + H   + H
Sbjct: 327 ETLDMLQEGELFLVVMEYCPYDFFNLV--MSNQMTKHEVWCYFKQICRGVDYLHSQGLAH 384

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMA----SPQEILTSNVVTRWYRAPELLFGAKHYT 186
           RDLK +N ++  DG LK+ DFG A +      S  E     V +  Y APELL    +  
Sbjct: 385 RDLKLDNCVVTADGILKLIDFGSAIIFRYNFNSKLEPAKGIVGSDPYLAPELLTQLYYDP 444

Query: 187 SAVDIWSVGVIFAELML-RIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQ 245
           SA D+WS+ V+F  + L R P+    +DV    +  +    P D +     S   Y  ++
Sbjct: 445 SAADVWSIAVMFYCMSLRRFPWKKPSEDVPSFKLFCQK---PDDEN---DHSKGPYRLLK 498

Query: 246 IYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYF 293
           + P  +R                LIS M+ ++PKKR    + +Q  +F
Sbjct: 499 LLPRATR---------------LLISRMLELDPKKRASITEIIQDPWF 531

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 98/204 (48%), Gaps = 14/204 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           GEG    V     ++  +  A+K I             LRE++F +  K   ++    +F
Sbjct: 187 GEGAGGSVAKCKLRTGKKVFALKTINILNGDPEFQKQLLRELQFNKSFKSEYIVRYFGMF 246

Query: 77  M--ANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWIL-----MTLRGVHHCHRNFI 128
               N ++ + +E++    LE I K+  ++     I   +L       LRG+ + H   +
Sbjct: 247 TDEQNSSIYIAMEYMGGKSLEAIYKE--LLSRGGRISEKVLGKISEAVLRGLSYLHEKKV 304

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSA 188
           +HRD+KP N+LL  DGQ+K+ DFG++    +   + T+   T +Y APE + G + Y+  
Sbjct: 305 IHRDIKPQNILLNEDGQVKLCDFGVSGEAVN--SLATTFTGTSYYMAPERIQG-QPYSVT 361

Query: 189 VDIWSVGVIFAELML-RIPYLPGK 211
            D+WS+G+   E+     P+ P K
Sbjct: 362 CDVWSLGLTILEVAQGHFPFGPDK 385

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 100/208 (48%), Gaps = 17/208 (8%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKD-GLDMSAL--------REVKFLQEL 64
           +K GEG    V +  +++ G+  A K  +     + G + S L         E      L
Sbjct: 306 RKLGEGASGSVSV-VERTDGKLFACKMFRKPHLNNEGTNQSQLANYSKKVTTEFCIGSTL 364

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
            H N++E +D+    D   LV+E+ P D   ++   S + +  ++  +      GV++ H
Sbjct: 365 HHENIVETLDMLTEGDTYLLVMEYAPYDFFNLV--MSNLMTQDEVNCYFKQLCHGVNYLH 422

Query: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE--ILTSN--VVTRWYRAPELLF 180
              + HRDLK +N ++  DG LK+ DFG A +   P E  I+ S+  V +  Y APELL 
Sbjct: 423 SMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELLK 482

Query: 181 GAKHYTSAVDIWSVGVIFAELML-RIPY 207
              +     D+WS+ +IF  ++L R P+
Sbjct: 483 QTSYDPRVADVWSIAIIFYCMVLKRFPW 510

>Kwal_0.307
          Length = 490

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 96/196 (48%), Gaps = 16/196 (8%)

Query: 17  GEGTYAVVYLGTKKS----TGRSI-AVKEI--KTSQFKDGLDMSALREVKFLQELKHVNV 69
           G+G + VV +  KKS     G  + AVKE   K S+  +        E      LKH N+
Sbjct: 274 GKGAFGVVRICHKKSQDDPNGEKLYAVKEFRRKPSESPEKYSRRLTSEFCISSSLKHTNI 333

Query: 70  IELVDVFM-ANDNLNLVLEF-LPADL-EIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           I  +D+F  A  +   V+E+    DL  +II    + +  AD   +    +RGV + H  
Sbjct: 334 IMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADC--FFKQLIRGVVYMHDM 391

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARL--MASPQEILTSNVV--TRWYRAPELLFGA 182
            + HRDLKP NLLL+ +G LKI DFG +    MA  ++I  S  V  +  Y APE     
Sbjct: 392 GVCHRDLKPENLLLSSNGTLKITDFGNSECFRMAWEKDIHLSGGVCGSSPYIAPEEYVHE 451

Query: 183 KHYTSAVDIWSVGVIF 198
           +     VDIW+ GVI+
Sbjct: 452 EFDPRPVDIWACGVIY 467

>Scas_690.13
          Length = 354

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 99/203 (48%), Gaps = 11/203 (5%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR----EVK 59
           K T+ D+   +  G G++  V+L      GR  A+K +K  Q    + M  +     E +
Sbjct: 38  KYTLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV---VRMKQIEHTNDERR 94

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRG 119
            L+ ++H  +I +   F  + NL +V++++       +   S  F     K +      G
Sbjct: 95  MLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLG 154

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
           + + H + I++RDLKP N+LL  +G +KI DFG A+ + +    L        Y APE++
Sbjct: 155 LEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGPPD---YIAPEVI 211

Query: 180 FGAKHYTSAVDIWSVGVIFAELM 202
              K Y  +VD WS+GV+  E++
Sbjct: 212 -ATKPYNKSVDWWSLGVLIFEML 233

>Kwal_47.18307
          Length = 621

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 111/232 (47%), Gaps = 28/232 (12%)

Query: 1   MTLKSTVDDYTKEKKAGEGTYAVVYLGTKKS-TGRSIAVKEIKTSQF------------K 47
           M +K T D Y    + G+G+Y+ VY   ++S +GR+ A+K                   K
Sbjct: 1   MAVKRTPDSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEK 60

Query: 48  DGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPA 107
           D L+M        L +  H+ +++L   F   +NL  VLE++    E++     +     
Sbjct: 61  DLLNM--------LAKGGHLGIVKLFCTFHDIENLYFVLEYVSGG-ELLALIQRLGRLTE 111

Query: 108 DIKSWILMTL-RGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQ----E 162
           D+   I   L   V + H   ++HRDLKP N+LL+ +G++ I DFG A   A  +    +
Sbjct: 112 DLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTK 171

Query: 163 ILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDV 214
              S V T  Y +PELL  ++   S+ DIW++G I  +L    P   G++++
Sbjct: 172 RTASFVGTAEYVSPELLLHSQCGFSS-DIWALGCIIYQLNQGKPPFRGENEL 222

>KLLA0A06820g complement(615686..618004) some similarities with
           sp|P38970 Saccharomyces cerevisiae YJL165c HAL5 ser/thr
           protein kinase, hypothetical start
          Length = 772

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 82/170 (48%), Gaps = 9/170 (5%)

Query: 43  TSQFKDGLDMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTS 101
           TS+F  GL +S   + +      H N++ ++D+    +    V+EF P+ DL  +I  +S
Sbjct: 516 TSEFVIGLSLSGGNKSRRSSARTHPNILNVIDLMQTPNAFYEVMEFCPSGDLYSLITRSS 575

Query: 102 ---IMFSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA 158
               +  P +   ++   L G+ + H + + H D+KP NLL  P G LKI DFG + +  
Sbjct: 576 KSDSVLHPLEADCFMKQLLHGIQYMHAHGVAHCDIKPENLLFLPTGVLKICDFGTSSVFQ 635

Query: 159 SPQE----ILTSNVVTRWYRAPELLFGAKHYTSA-VDIWSVGVIFAELML 203
           +  E      T    +  Y APE     + Y    VD WS G+I+  ++L
Sbjct: 636 TAWEKKAHFQTGPAGSEPYVAPEEFIPKQQYDPRLVDCWSCGIIYCVMVL 685

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 88/167 (52%), Gaps = 21/167 (12%)

Query: 2   TLKS---TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREV 58
           T+KS   ++ DY   K   +G Y  VYL  KK TG   A+K ++ S      DM A  +V
Sbjct: 783 TVKSPTPSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKS------DMIAKNQV 836

Query: 59  KFLQELKHVNVIE--------LVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPAD- 108
             ++  + + +++        L   F   DNL LV+E+LP  DL  +IK   + + P   
Sbjct: 837 TNVKSERAIMMVQSDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIK--MMGYLPDQW 894

Query: 109 IKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLAR 155
            K ++   + GV+  H+N I+H DLKP NLL+   G +K+ DFGL+R
Sbjct: 895 AKQYLTEIVVGVNDMHQNGIIHHDLKPENLLIDNAGHVKLTDFGLSR 941

 Score = 35.0 bits (79), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 46/112 (41%), Gaps = 22/112 (19%)

Query: 173  YRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADW 232
            Y APE + G        D WSVG IF EL+L  P        +  +  F+ + +     W
Sbjct: 1153 YLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPF----HAETPDAVFKKILSGV-IQW 1207

Query: 233  PEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDA 284
            PE   F N  + + +  P               A +LI  +++++P KR  A
Sbjct: 1208 PE---FKNEEEEREFLTPE--------------AKDLIEKLLVVDPAKRLGA 1242

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 93/196 (47%), Gaps = 16/196 (8%)

Query: 17  GEGTYAVVYLGTKK-----STGRSIAVKEIK--TSQFKDGLDMSALREVKFLQELKHVNV 69
           G+G + VV +  KK        +  AVKE K   ++ K+        E      L H N+
Sbjct: 301 GKGAFGVVRICHKKVPENPKVEKLYAVKEFKRKATEPKEKFAKRLTSEFCISSSLHHTNI 360

Query: 70  IELVDVFM-ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRN 126
           ++ +D+F  AN +   V+E+        +II    + +  AD   +    LRGV + H  
Sbjct: 361 VDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADC--FFKQLLRGVVYMHDM 418

Query: 127 FILHRDLKPNNLLLAPDGQLKIADFGLARL--MASPQEILTSNVV--TRWYRAPELLFGA 182
            + HRDLKP NL+L  DG LKI DFG +    MA  ++I  S  V  +  Y APE     
Sbjct: 419 GVCHRDLKPENLILTHDGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVLE 478

Query: 183 KHYTSAVDIWSVGVIF 198
           +     VDIW+ GVI+
Sbjct: 479 EFDPRPVDIWACGVIY 494

>Kwal_26.8751
          Length = 848

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 131/300 (43%), Gaps = 61/300 (20%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKH 66
           V +Y   K  GEG++  VYL +   T + + +K           D + +REV + ++  +
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLK------MGSKNDPNVVREVFYHRQFDY 87

Query: 67  VNVIELVDVFMANDNLNLVLEFLP---------ADLEIIIKDTSIMFSPADIKSWILMTL 117
            ++ +L +V +  + + + LE+ P         A   I +++ S +FS           +
Sbjct: 88  SHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFS---------QIV 138

Query: 118 RGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPE 177
             V++ H    +HRDLK  N+LL   G  K+ DFG  R  A+ + IL +   T  Y APE
Sbjct: 139 GAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECAT-KGILETICGTTVYMAPE 197

Query: 178 LLFGAKHYTSAVDIWSVGVI-FAELMLRIPYLPGKDDVDQINVTFRALG-TPT-DADWPE 234
           L+    +    +D WS+G+I +  +   +P+    D+VD++   ++ +   PT D D+ +
Sbjct: 198 LIERKPYEGYKIDTWSLGIILYTMIHGTMPF----DEVDEVKTKYKIVHYNPTYDNDYID 253

Query: 235 VSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQ 294
                                         N  ELIS ++  +P +R    + LQ  + Q
Sbjct: 254 -----------------------------SNGKELISQLLEKDPNQRPSLTQVLQHPFLQ 284

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 101/217 (46%), Gaps = 15/217 (6%)

Query: 3   LKSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR-EVKFL 61
           +K  + D+   +  G+G+Y+ V L T   +G+  A K +          +  +  E   L
Sbjct: 193 IKKGIKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTL 252

Query: 62  QELKHV---NVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTL 117
           Q L       VI+L   F    NL  +LE+ P  D   ++K    + S    K +    L
Sbjct: 253 QRLNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTL-SEECTKYYGAQIL 311

Query: 118 RGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMA-----SPQEILT---SNVV 169
             +HH H+  I+HRD+KP N+LL    ++K+ DFG A+L+       P ++ T   S V 
Sbjct: 312 DAIHHLHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVG 371

Query: 170 TRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIP 206
           T  Y +PELL    +  S  DIW+ G I  +++   P
Sbjct: 372 TAEYVSPELL-NDNYVDSRCDIWAFGCILFQMVAGKP 407

>KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1
           Kluyveromyces lactis cyclin-dependent kinase activating
           kinase 1, start by similarity
          Length = 321

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 73/143 (51%), Gaps = 14/143 (9%)

Query: 113 ILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRW 172
           I   + G+ + H N I+HRD+KP N++L    ++ + DFG++       E  T +  T  
Sbjct: 118 IRQIIEGLVYIHGNGIIHRDVKPQNIMLNSYNEVVLGDFGISYNRNLDNEAKTCDCSTSI 177

Query: 173 YRAPELLFGAKHYTSAVDIWSVGVIFAEL-------------MLRIPYLPGKDDVDQINV 219
           Y+APELLF   +Y   +DIW++ V+ ++L             ++ I +     D+  +  
Sbjct: 178 YKAPELLFSVSNYKFEIDIWALAVLISQLWNDKTQSKSKSSKVIDIDF-DECSDIKLVLT 236

Query: 220 TFRALGTPTDADWPEVSSFSNYN 242
            F   G P++ DWP+V+   ++N
Sbjct: 237 LFDKFGKPSNEDWPQVTKNESFN 259

>Scas_700.35
          Length = 439

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 105/216 (48%), Gaps = 24/216 (11%)

Query: 17  GEGTY-AVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDV 75
           GEG   +V     +K++ +  A+K I T            RE++F +  K   ++    +
Sbjct: 156 GEGAGGSVAKCRLRKNSSQVFALKTINTLNTDPEFQKQLFRELEFNKSFKSNYIVTYYGM 215

Query: 76  FMANDNLN----LVLEFLPA-DLEIIIKDTSIMFSPADIKSWIL-----MTLRGVHHCHR 125
           F  ND LN    + +E++    L+ I K  S++     I   IL       LRG+ + H 
Sbjct: 216 F--NDTLNGSIYIAMEYMGGQSLDTIYK--SLLSRGGRIGEKILGKIAESVLRGLSYLHE 271

Query: 126 NFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHY 185
             I+HRD+KP N+LL  +G++K+ DFG++    +   + T+   T +Y APE + G   Y
Sbjct: 272 RKIIHRDIKPQNILLNEEGEVKLCDFGVSG--EAVNSLATTFTGTSFYMAPERIQG-HPY 328

Query: 186 TSAVDIWSVGVIFAELML-RIPYLPGKDDVDQINVT 220
           +   D+WS+G+   E+   R P+     D D+I  T
Sbjct: 329 SVTCDVWSLGLTILEVAQGRFPF-----DSDKITTT 359

>Kwal_56.24059
          Length = 353

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 100/203 (49%), Gaps = 11/203 (5%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR----EVK 59
           K +++D+   +  G G++  V+L      GR  A+K +K  Q    + M  +     E +
Sbjct: 37  KYSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV---IRMKQIEHTNDERR 93

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRG 119
            L+ + H  +I +   F  + NL +V++++       +   S  F     K +    +  
Sbjct: 94  MLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 153

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
           + + H + I++RDLKP N+LL  +G +KI DFG A+ + +    L     T  Y APE++
Sbjct: 154 LEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCG---TPDYIAPEVI 210

Query: 180 FGAKHYTSAVDIWSVGVIFAELM 202
              K Y  +VD WS+G++  E++
Sbjct: 211 -ATKPYNKSVDWWSLGILIFEML 232

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 110/219 (50%), Gaps = 28/219 (12%)

Query: 14  KKAGEGTYAVVYLGT--------------KKSTGRSIAVKE-IKTSQFKDGLDMSALREV 58
           +KAG+G    VYL                K   G  +A+K+ I + Q +  L    + E+
Sbjct: 592 EKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKEL---IVNEI 648

Query: 59  KFLQELKHVNVIELVDVFM-ANDNLNLVLEFLPA-DLEIIIKDT---SIMFSP---ADIK 110
             +++ KH N++  ++ ++   D+L +V+E++    L  II+++   S   SP     I 
Sbjct: 649 LVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIA 708

Query: 111 SWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVT 170
             +  T +G+   H   I+HRD+K +N+LL   G++KI DFG    +   +    + V T
Sbjct: 709 YIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGT 768

Query: 171 RWYRAPELLFGAKHYTSAVDIWSVGVIFAELM-LRIPYL 208
            ++ APE++   + Y   VD+WS+G++  E++    PYL
Sbjct: 769 PYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 806

>YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activating
           kinase (serine/threonine protein kinase) responsible for
           in vivo activation of Cdc28p, also involved in spore
           wall formation [1107 bp, 368 aa]
          Length = 368

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 101/231 (43%), Gaps = 54/231 (23%)

Query: 111 SWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDG-----QLKIADFGLARLMAS------ 159
           S+    + G+   H N I+HRD+KP N++L  +      +L I DFG++  MA+      
Sbjct: 135 SFFRQMVEGIAFLHENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDFGISYDMANNSQTSA 194

Query: 160 -PQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVI----FAELMLRIPYLP----- 209
            P +   +++ T  Y+APE+LFG K Y   VD+WS+ +I    F     R+ ++P     
Sbjct: 195 EPMDSKVTDISTGIYKAPEVLFGVKCYDGGVDVWSLLIIISQWFQRETSRMGHVPAMIDD 254

Query: 210 GKDDVDQ-------INVTFRALGTPTDADWPEVSSFSNYN-------------------- 242
           G DD++        I   F  LG P+   W EV+   + +                    
Sbjct: 255 GSDDMNSDGSDFRLICSIFEKLGIPSIQKWEEVAQHGSVDAFVGMFGADGDGKYVLDQEK 314

Query: 243 KIQI----YPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQ 289
            +QI       P  +E+    +   +  +  I GM+  +P +RW   + LQ
Sbjct: 315 DVQISIVERNMPRLDEIAD--VKVKQKFINCILGMVSFSPNERWSCQRILQ 363

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 98/206 (47%), Gaps = 9/206 (4%)

Query: 17  GEGTYAVVYLGTKK-STGRSIAVKEIKT-SQFKDGLDMSAL-REVKFLQEL-KHVNVIEL 72
           GEG++  V     K  +   +AVK +   +  + GL    + REV    +  KH NV+ +
Sbjct: 21  GEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSKCSKHANVLRV 80

Query: 73  VDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRD 132
           +D  +  + L ++LE           +  +   P   + +    +R +++ H   + HRD
Sbjct: 81  IDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRD 140

Query: 133 LKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRW---YRAPELLFGAKHYTSAV 189
           +KP N+LL   G LK+ADFGLA         L  +   R    Y APE+L    +Y +  
Sbjct: 141 IKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANIT 200

Query: 190 DIWSVGV-IFAELMLRIPY-LPGKDD 213
           DIWS GV +F  L   IP+ +P K+D
Sbjct: 201 DIWSAGVLLFVLLTGEIPWSIPAKED 226

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 11/203 (5%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR----EVK 59
           K T+ D+   +  G G++  V+L      GR  A+K +K  Q    + M  +     E +
Sbjct: 56  KYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQI---IRMKQIEHTNDERR 112

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRG 119
            L+ ++H  +I +   F  + NL +V++++       +   S  F     K +       
Sbjct: 113 MLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLA 172

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
           + + H + I++RDLKP N+LL  +G +KI DFG A+ + +    L     T  Y APE++
Sbjct: 173 LEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVITVTWTLCG---TPDYIAPEVI 229

Query: 180 FGAKHYTSAVDIWSVGVIFAELM 202
              K Y  +VD WS+G++  E++
Sbjct: 230 -TTKPYNKSVDWWSLGILIFEML 251

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 100/203 (49%), Gaps = 11/203 (5%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR----EVK 59
           K ++ D+   +  G G++  V+L      GR  A+K +K +Q    + M  +     E +
Sbjct: 45  KYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQV---VKMKQIEHTNDERR 101

Query: 60  FLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRG 119
            L+ ++H  +I +   F  + NL +V++++       +   S  F     K +       
Sbjct: 102 MLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLA 161

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELL 179
           + + H + I++RDLKP N+LL  +G +KI DFG A+ + +    L     T  Y APE++
Sbjct: 162 LEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAKEVETVTWTLCG---TPDYIAPEVI 218

Query: 180 FGAKHYTSAVDIWSVGVIFAELM 202
              K Y  +VD WS+GV+  E++
Sbjct: 219 -ATKPYNKSVDWWSLGVLIYEML 240

>Scas_598.6
          Length = 790

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 109/216 (50%), Gaps = 25/216 (11%)

Query: 14  KKAGEGTYAVVYLGTK-----------KSTGRSIAVKE-IKTSQFKDGLDMSALREVKFL 61
           +KAG+G    VYL  +              G  +A+K+ I + Q +  L    + E+  +
Sbjct: 506 EKAGQGASGSVYLAERIAIPPGEFDETPEVGDKVAIKQMILSKQPRKEL---IVNEILVM 562

Query: 62  QELKHVNVIELVDVFM-ANDNLNLVLEFLPA-DLEIIIKDTSIMFSPAD------IKSWI 113
           ++ +H N++  ++ ++   D+L +V+EF+    L  II+++    S +       I   +
Sbjct: 563 KDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIV 622

Query: 114 LMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWY 173
             T +G+   H   I+HRD+K +N+LL  + ++KI DFG    +   +    + V T ++
Sbjct: 623 RETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYW 682

Query: 174 RAPELLFGAKHYTSAVDIWSVGVIFAELM-LRIPYL 208
            APE++   + Y   VD+WS+G++  E++    PYL
Sbjct: 683 MAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 717

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 103/256 (40%), Gaps = 47/256 (18%)

Query: 10   YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSAL-----REVKFLQEL 64
            + K    G GT+  VY       G  +AVKEIK     D   M  +      E+  L+ L
Sbjct: 1034 WQKRSFIGGGTFGQVYSAINLENGEILAVKEIK---IHDTTTMKKIFPLIKEEMTVLEML 1090

Query: 65   KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124
             H N+++   V +  D +N+ +E+        + D   +      + +    L G+ + H
Sbjct: 1091 NHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLH 1150

Query: 125  RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVV--------------- 169
            ++ ++HRD+KP N+LL  +G +K  DFG AR +   +     N                 
Sbjct: 1151 QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMM 1210

Query: 170  -TRWYRAPELLFGA--KHYTSAVDIWSVGVIFAELML---------------------RI 205
             T  Y APE + G+  K    A D+W++G +  E+                       RI
Sbjct: 1211 GTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRI 1270

Query: 206  PYLPGKDDVDQINVTF 221
            P LP +D++      F
Sbjct: 1271 PQLPNRDEMTAAGRAF 1286

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 95/196 (48%), Gaps = 13/196 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV-NVIELVDV 75
           G G + VVY G    TGR  A+K +      D ++    RE++FL  LK + N+      
Sbjct: 30  GRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVE-DVQREIQFLASLKQISNITRYYGS 88

Query: 76  FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADI-KSWILMTLR----GVHHCHRNFILH 130
           ++ + +L +++E               +  P  I + +I + +R     +   H++ ++H
Sbjct: 89  YLKDTSLWIIMEHCAGG------SLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIH 142

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVD 190
           RD+K  N+L+  +G +K+ DFG+A  +        +   T ++ APE++    +Y + VD
Sbjct: 143 RDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVD 202

Query: 191 IWSVGVIFAELMLRIP 206
           IWS+G+   E+    P
Sbjct: 203 IWSLGITTYEIATGNP 218

>Kwal_14.1159
          Length = 1521

 Score = 78.6 bits (192), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 83/157 (52%), Gaps = 10/157 (6%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQF---KDGLDMSALREVKFLQ 62
           ++ DY   K   +G Y  V+L  ++ TG   A+K +K S         ++ + R +  +Q
Sbjct: 673 SIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 732

Query: 63  ELKHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPAD--IKSWILMTLRG 119
             K   V +L   F    NL LV+E+L   DL  +IK   +M S  D  +K +I   + G
Sbjct: 733 SNKPY-VAKLYATFQNRGNLFLVMEYLSGGDLGTLIK---MMGSLPDQWVKQYISEVIYG 788

Query: 120 VHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARL 156
           V   H++ I+H DLKP+NLL+   G LK+ DFGL+R+
Sbjct: 789 VEDMHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRM 825

>Scas_201.1*
          Length = 274

 Score = 76.3 bits (186), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 94/190 (49%), Gaps = 10/190 (5%)

Query: 20  TYAVVYLGTKKSTGRSIAVKEIKTSQFK-DGLDMSALR-EVKFLQELKHVNVIELVDVFM 77
           T+ VV    +  +  ++AVK +  +  K + + +  L  E+  LQ L H N++   D F 
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 78  ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHRDLKP 135
           + D   +V +        + IIK     F+  D  + ++  L  V + H   I+HRDLKP
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGK--FTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKP 162

Query: 136 NNLLL---APDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIW 192
            N+L    + + QL IADFG+A+ + S  +++     +  Y APE+L    H     DIW
Sbjct: 163 ENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGH-GKPCDIW 221

Query: 193 SVGVIFAELM 202
           S+GVI   L+
Sbjct: 222 SLGVITYTLL 231

>Scas_720.94
          Length = 1683

 Score = 78.2 bits (191), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 126/318 (39%), Gaps = 56/318 (17%)

Query: 10   YTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSAL--REVKFLQELKHV 67
            + K    G GT+  VY       G  +AVKEIK    K    +  L   E+  L+ L H 
Sbjct: 1361 WQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHP 1420

Query: 68   NVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127
            N+++   V +  D +N+ +E+        + +   +      + + L  L G+ + H+  
Sbjct: 1421 NIVQYYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAG 1480

Query: 128  ILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILT--------------------SN 167
            ++HRD+KP N+LL  +G +K  DFG AR +A     +T                    +N
Sbjct: 1481 VVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGAN 1540

Query: 168  VV-----TRWYRAPELLFGAKHYT--SAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVT 220
             V     T  Y APE + G K+ T   + DIWS G +  E+                 +T
Sbjct: 1541 SVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEM-----------------IT 1583

Query: 221  FRALGTPTDADWPEVSSFSNYNKIQIYPPPSREELRRRFIAATENALELISGMMIMNPKK 280
             R      D +W  +   +     Q+  P       RRF+             ++ +P K
Sbjct: 1584 GRRPWANLDNEWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQRC----------LVQDPIK 1633

Query: 281  RWDAVKCLQSQYFQELPE 298
            R  AV+ L   +  E+ E
Sbjct: 1634 RATAVELLMDPWIVEIRE 1651

>Scas_700.28
          Length = 896

 Score = 78.2 bits (191), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 89/187 (47%), Gaps = 9/187 (4%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           GEG++  VYL   + T   + +K        D  D + +REV + ++  +  + +L +V 
Sbjct: 45  GEGSFGKVYLAQHRPTHTKVVLKS------SDKNDPNIVREVFYHRQFDYPYITKLYEVI 98

Query: 77  MANDNLNLVLEFLPADLEIIIKDTSIMFSPAD-IKSWILMTLRGVHHCHRNFILHRDLKP 135
           +    + + LE+ P   E+  +  S+   P D         + GVH+ H    +HRDLK 
Sbjct: 99  ITETKVWMALEYCPGK-ELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLNCVHRDLKL 157

Query: 136 NNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVG 195
            N+LL   G  K+ DFG  R   + +  L +   T  Y APEL+    +    +DIWS+G
Sbjct: 158 ENILLDKSGDAKLTDFGFTRECMT-KTTLETICGTTVYMAPELIERKSYDGFKIDIWSLG 216

Query: 196 VIFAELM 202
           VI   ++
Sbjct: 217 VILYTMI 223

>Scas_685.24
          Length = 515

 Score = 77.8 bits (190), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 104/207 (50%), Gaps = 5/207 (2%)

Query: 5   STVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQEL 64
           S   +Y  ++  G G +  VY    ++T + +A+K +      + L++ A +E+ FL EL
Sbjct: 17  SKAHNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNERLEVLA-QEIFFLAEL 75

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILMT-LRGVHH 122
           K   +I  +   + + ++ +V+E+        ++K       P    ++I    L+G+ +
Sbjct: 76  KSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQY 135

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF-G 181
            H    +HRD+K  N+LL  +G +K+ DFG++  + S     T  V T ++ APE+    
Sbjct: 136 LHEQKKIHRDIKAANILLTEEGHVKLGDFGVSGQLKSTLRRGTI-VGTPYWMAPEVASQN 194

Query: 182 AKHYTSAVDIWSVGVIFAELMLRIPYL 208
            + Y   +DIWS+G+   EL+  +P L
Sbjct: 195 IEGYDEKIDIWSLGITVFELLKGVPPL 221

>Kwal_14.1249
          Length = 344

 Score = 77.0 bits (188), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 120/263 (45%), Gaps = 45/263 (17%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVNVIELVDVF 76
           GE   +  +    K+  R++ V  ++ S  K    M  L  ++ LQ  +  ++IELV   
Sbjct: 6   GELVVSTRFSSIYKNKARALKVTHVE-SVAKPHDPMCELAILRKLQVGRSAHIIELVSFE 64

Query: 77  MANDNLNLVLEFLPADL-EIIIK-------DTSIMFSPADIKSWILMTLR---------- 118
           +A   + L   F   ++ + ++K       +  ++    D  S ++  L+          
Sbjct: 65  VARGVVTLQFPFYKQNMYQYVLKYYQKRRWNPYLLTEQGDSGSKLVNNLKIDYALDFFRQ 124

Query: 119 ---GVHHCHRNFILHRDLKPNNLLLAPDG-----QLKIADFGLARLMASPQEILTS---N 167
               + + H + I+HRD+K  N+++  DG     QL + DFG+A    + QE   S   +
Sbjct: 125 LADALSNLHEHKIIHRDVKLQNVMVDEDGPHDIPQLVLIDFGIAYDPETSQEAADSKITD 184

Query: 168 VVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLR-------IP--------YLPGKD 212
           V T  Y+APELLF  K+Y+SA DIWS+ V+ ++L          IP         L    
Sbjct: 185 VSTSIYKAPELLFSVKNYSSAADIWSLMVLVSQLFQTESSSDRFIPAFVSDGSEVLEQGS 244

Query: 213 DVDQINVTFRALGTPTDADWPEV 235
           D+  ++  F  LG P+  +WPEV
Sbjct: 245 DIRLVSSIFEKLGIPSLQEWPEV 267

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 90/194 (46%), Gaps = 14/194 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRS---IAVKEIKTSQFKDGLDMSALREVKFL--QELKHVNVIE 71
           G+G + VV +  KK    +    AVKE K    +D    S     +F     LKH N+I 
Sbjct: 229 GKGAFGVVRICHKKDANGTEALYAVKEFKKRPSEDQEKYSRRLTSEFCLSSSLKHTNIIN 288

Query: 72  LVDVFM-ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
            +D+F  A  +   V+E+        +I+    + +  AD   +    +RGV + H   +
Sbjct: 289 TLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADC--FFKQMIRGVVYMHDMGV 346

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARL--MASPQEILTSNVV--TRWYRAPELLFGAKH 184
            HRDLKP NL+L  +G LKI DFG      MA  ++I  S  V  +  Y APE     + 
Sbjct: 347 CHRDLKPENLILTANGVLKITDFGNGECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEEF 406

Query: 185 YTSAVDIWSVGVIF 198
               VDIW+ G I+
Sbjct: 407 DPRPVDIWACGTIY 420

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 89/199 (44%), Gaps = 19/199 (9%)

Query: 17  GEGTYAVVYLGTKKSTGRS--------IAVKEIK--TSQFKDGLDMSALREVKFLQELKH 66
           G+G + VV +  KK+             AVKE K  TS+  +        E      L H
Sbjct: 323 GKGAFGVVRICQKKNVSSQDGNKSEKLYAVKEFKRRTSESAEKYSKRLTSEFCISSSLHH 382

Query: 67  VNVIELVDVFM-ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
            N++  +D+F  A      V+E+        +++    + +  AD   +    +RGV + 
Sbjct: 383 TNIVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADC--FFKQLIRGVVYM 440

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARL--MASPQEILTSNVV--TRWYRAPELL 179
           H   + HRDLKP NLLL  DG LKI DFG +    MA  + I  S  V  +  Y APE  
Sbjct: 441 HEMGVCHRDLKPENLLLTHDGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAPEEY 500

Query: 180 FGAKHYTSAVDIWSVGVIF 198
              +     VDIW+ GVI+
Sbjct: 501 IKEEFDPRPVDIWACGVIY 519

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 2/201 (0%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLD-MSALREVKFLQELK 65
           +DD+      G+G+Y  V    KK T +  A+K I+ S      + +  L E   L  ++
Sbjct: 374 IDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVE 433

Query: 66  HVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125
              ++ L   F   + L LVL  +             +F  +  + +    L  +   H+
Sbjct: 434 CPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHK 493

Query: 126 NFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHY 185
             +++RDLKP N+LL   G + + DFGL +L     E  ++   T  Y APE+L G K Y
Sbjct: 494 MDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLG-KGY 552

Query: 186 TSAVDIWSVGVIFAELMLRIP 206
           T  VD W++GV+  E++  +P
Sbjct: 553 TKVVDWWTLGVLLYEMLTGLP 573

>Scas_628.9
          Length = 621

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 90/195 (46%), Gaps = 15/195 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRS----IAVKEIK--TSQFKDGLDMSALREVKFLQELKHVNVI 70
           G+G +  V +  KK   +      AVKE K  +S+  +        E      L H+N++
Sbjct: 342 GKGAFGTVRICHKKDPKQEKELLFAVKEFKKKSSEPFEKYSKRLTSEFCISSSLHHINIV 401

Query: 71  ELVDVFM-ANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNF 127
             +D+F  A      V+E+        +I+    + ++ AD   +    +RGV + H   
Sbjct: 402 TTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADC--FFKQLMRGVVYMHDMG 459

Query: 128 ILHRDLKPNNLLLAPDGQLKIADFGLARL--MASPQEILTSNVV--TRWYRAPELLFGAK 183
           + HRDLKP NLLL  DG LKI DFG +    MA   +I  S  V  +  Y APE     +
Sbjct: 460 VSHRDLKPENLLLTSDGVLKITDFGNSECFKMAWEDDIHLSGGVCGSSPYIAPEEYIKEE 519

Query: 184 HYTSAVDIWSVGVIF 198
                VDIW+ GVI+
Sbjct: 520 FDPRCVDIWACGVIY 534

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 109/235 (46%), Gaps = 39/235 (16%)

Query: 7   VDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQF---KDGLDMSA--------- 54
           +DD+   +  GEG Y  V L     + +  A+K++K ++    +D ++  A         
Sbjct: 167 LDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIE 226

Query: 55  --LREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADL-------EIIIKDTSIMFS 105
               E   L +L+H N+++L   F  N  L LVL+++P          +  + + ++ F 
Sbjct: 227 RTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFY 286

Query: 106 PADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARL-----MASP 160
            A++          +   H   I++RDLKP N LL   G L + DFGL++       A+P
Sbjct: 287 AAELSC-------ALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATP 339

Query: 161 QE-----ILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPG 210
           +E      L S + T  Y APE+L G + YT   D +S+G +  ++++  P   G
Sbjct: 340 EEGENVNQLYSIIGTPEYCAPEILAG-EPYTQNCDWYSLGCLVYDMLIGKPPFTG 393

>Scas_651.19
          Length = 801

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 9/145 (6%)

Query: 68  NVIELVDVFMANDNLNLVLEFLPA-DLEIIIKDTS---IMFSPADIKSWILMTLRGVHHC 123
           N+++++D+   ND    V+EF P+ DL  ++   S       P +   ++   L GV + 
Sbjct: 573 NILKIIDLLENNDTFFEVMEFCPSGDLYSLLTRKSKNGTALHPLEADCFMKQLLHGVKYM 632

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQE----ILTSNVVTRWYRAPELL 179
           H + + H DLKP N+L  PDG LKI DFG + +  +  E      +  + +  Y APE  
Sbjct: 633 HDHGVAHCDLKPENILFHPDGLLKICDFGTSCVFQTAWEKHVHFQSGAMGSEPYVAPEEF 692

Query: 180 FGAKHYT-SAVDIWSVGVIFAELML 203
              K Y    VD WS GV++  +++
Sbjct: 693 ISGKEYDPRLVDCWSCGVVYCTMVM 717

>Scas_660.20
          Length = 957

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 109/223 (48%), Gaps = 16/223 (7%)

Query: 4   KSTVDDYTKEKKAGEGTYAVVYLGT-KKSTGRSIAVKE------IKTSQFKD-GLDMSAL 55
           K +  D+  +++ G G+Y+ VY    K++T R  A+K       IK S+ K   ++ + L
Sbjct: 5   KRSPHDFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTL 64

Query: 56  REVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILM 115
                L +  H  +++L   F   +NL  VL++LP    + +      FS    K + + 
Sbjct: 65  N---LLAKAHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQ 121

Query: 116 TLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMAS----PQEILTSNVVTR 171
            +  +   H   ++HRDLKP N+LL  DG+L I DFG A    +      +  +S V T 
Sbjct: 122 LVDTLEFIHSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTA 181

Query: 172 WYRAPELLFGAKHYTSAVDIWSVGVIFAELMLRIPYLPGKDDV 214
            Y +PELL   +   S+ D+W++G +  + +   P   G++++
Sbjct: 182 EYVSPELLLHNQCSFSS-DVWALGCMIFQFVTGSPPFRGENEL 223

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 110/221 (49%), Gaps = 9/221 (4%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQF-KDGLDMSALREVKFLQEL 64
           T+ D+   K  G+G +  VY    + TG   A+K ++  +  +  +     REV+     
Sbjct: 96  TLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSF 155

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123
           KH N+ +L   F     + L++E++   +L   +K+   + +      ++      + + 
Sbjct: 156 KHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPL-NETLASYFVYQMANALDYM 214

Query: 124 HRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAK 183
           H   ILHRD+KP N+L+  +  +K+ DFG +      Q+  T    T  Y +PEL+  ++
Sbjct: 215 HSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTL-CGTIDYLSPELI-KSR 272

Query: 184 HYTSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRAL 224
            Y + VD+W++GV+  EL++  P  P ++D  ++  T+R +
Sbjct: 273 EYNNKVDVWALGVLTYELLVGSP--PFEEDTKEM--TYRRI 309

>Kwal_27.9773
          Length = 406

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 103/242 (42%), Gaps = 43/242 (17%)

Query: 8   DDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV 67
           ++Y   ++ G G++  V       T R +  KEIK            + E   L +LKH 
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSKERQQLISECAILSQLKHE 76

Query: 68  NVIELVDVFMANDNLNLVLEFLP-ADLEIII---KDTSIMFSPADIKSWILMTLRGVHHC 123
           N++E  +     D L   +E+    DL  +I   K          + S ++  L  ++ C
Sbjct: 77  NIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYRC 136

Query: 124 H---------------------RNFILHRDLKPNNLLLA----PDGQ------------L 146
           H                      N ++HRDLKP N+ L+    PD +            +
Sbjct: 137 HYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKISV 196

Query: 147 KIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELM-LRI 205
           K+ DFGLA+ + +  E  T+ V T +Y +PE+L   + Y+   DIWS+G +  E+  LR 
Sbjct: 197 KLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 206 PY 207
           P+
Sbjct: 256 PF 257

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 120/275 (43%), Gaps = 56/275 (20%)

Query: 10  YTKEKKAGEGTYAVVYLGTKKSTGRS-IAVKEIKTSQFKDGLDMSALR-EVKFLQELKHV 67
           Y  EK+ G+G++A VY G   +  +S IAVK +  S+ K+   +  L  E+  L+++KH 
Sbjct: 11  YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHP 70

Query: 68  NVIELVDVFMANDNLNLVLEFLP-ADLEIIIKDTSIM----------------------- 103
           +++ L+D      +  LV+++    DL  +IK    +                       
Sbjct: 71  HIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNG 130

Query: 104 FSPADIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAP------DGQ------------ 145
            + A +  ++      +       ++HRD+KP NLLLA       D +            
Sbjct: 131 LNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYN 190

Query: 146 ---LKIADFGLARLMASPQ--EILTSNVVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAE 200
              LKIADFG AR + S    E L  + +   Y APE+L   + Y +  D+WSVG +  E
Sbjct: 191 LPILKIADFGFARFLPSTSLAETLCGSPL---YMAPEIL-NYQKYNAKADLWSVGTVLFE 246

Query: 201 LMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEV 235
           +   +P     + ++      RA     + ++PEV
Sbjct: 247 MCCGVPPFTASNHLELFKKIKRA---HDEINFPEV 278

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 88/161 (54%), Gaps = 8/161 (4%)

Query: 51  DMSALREVKFLQELKHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPA- 107
           D   +RE    Q L H NV +L ++   +++  +  EF+     L+ II+  S+  + A 
Sbjct: 135 DKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYIIQHGSLKENHAR 194

Query: 108 DIKSWILMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSN 167
            +   IL  L+   + H N I+HRDLK  N++L+  G++K+ DFGL+  M  P++ L + 
Sbjct: 195 KVSRGILSALQ---YLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSN-MYDPRKSLQTF 250

Query: 168 VVTRWYRAPELLFGAKHYTSAVDIWSVGVIFAELML-RIPY 207
             + ++ APELL    +    VD+WS GV+   L+  ++P+
Sbjct: 251 CGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPF 291

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 99/197 (50%), Gaps = 15/197 (7%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV-NVIELVDV 75
           G G + +VY G    T +  A+K +     +D ++    RE++FL  LK + N+      
Sbjct: 23  GRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVE-DVQREIQFLASLKQIPNITRYYGS 81

Query: 76  FMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADI-KSWILMTLR----GVHHCHRNFIL 129
           ++   +L +++E+     L  +++       P  I + +I + +R     +   H++ ++
Sbjct: 82  YLRGTSLWIIMEYCAGGSLRSLLR-------PGKIDEKYIGVIMRELLVALKVIHKDNVI 134

Query: 130 HRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAV 189
           HRD+K  N+L+  +GQ+K+ DFG+A  +        +   T ++ APE++    +Y + V
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKV 194

Query: 190 DIWSVGVIFAELMLRIP 206
           DIWS+G+   E+    P
Sbjct: 195 DIWSLGITAYEIATGNP 211

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 96/212 (45%), Gaps = 19/212 (8%)

Query: 17  GEGTYAVVYLGTKK--STG--------RSIAVKEIKTSQF--KDGLDMSALREVKFLQEL 64
           GEG +  V LG  +  STG        + +A+K I+          ++   RE+  L+ L
Sbjct: 51  GEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALKHL 110

Query: 65  KHVNVIELVDVFMANDNLNLVLEFLPAD--LEIIIKDTSIMFSPADIKSWILMTLRGVHH 122
            H NV+ L +V   +  + +VLE+       + I +   +  S A         + GV +
Sbjct: 111 THPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTA--CRLFAQLISGVTY 168

Query: 123 CHRNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGA 182
            H   ++HRDLK  NLLL  +  L I DFG         E + ++  +  Y APEL+   
Sbjct: 169 MHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIST 228

Query: 183 KHYTS-AVDIWSVGVIFAELMLRIPYLPGKDD 213
           + Y +   D+WS G+I   ++    YLP  DD
Sbjct: 229 RPYVARKADVWSCGIILYAML--AGYLPWDDD 258

>CAGL0F03707g complement(359839..361665) similar to sp|Q08732
           Saccharomyces cerevisiae YOR267c, start by similarity
          Length = 608

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 101/228 (44%), Gaps = 36/228 (15%)

Query: 14  KKAGEGTYAVVYLGTKKSTGRSIAVKEI---KTSQFKDGLDMSALREVKFLQELKHVNVI 70
           K  G G    V +  + + G + AVKE    K ++         + E      L HVNVI
Sbjct: 184 KTLGSGAGGSVKILKRPTDGATFAVKEFRPKKPTETSKQYAKKCIAEFTIGSTLHHVNVI 243

Query: 71  ELVDVFMANDNLNL--VLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFI 128
           E +D+F          V+E+ P D   ++   S   S  ++   +     GV + H   +
Sbjct: 244 ETMDIFSDAKKQRYFEVMEYCPVDFFAVV--MSGKMSRGEVNCCLKQLACGVKYLHSMGL 301

Query: 129 LHRDLKPNNLLLAPDGQLKIADFGLARLMASP--QEI-LTSNVV-TRWYRAPELLFGAK- 183
            HRDLK +N ++  +G LK+ DFG A +   P  QE+ L S +V +  Y APE+L     
Sbjct: 302 AHRDLKLDNCVMTENGILKLIDFGSAVVFRYPFEQEVTLASGIVGSDPYLAPEVLGKISR 361

Query: 184 ---------HYT--------------SAVDIWSVGVIFAELML-RIPY 207
                    H T               AVD+WS+G+IF+ +ML R P+
Sbjct: 362 ADGDESEEPHQTIKIDKKTGLSLYDPQAVDVWSIGIIFSCMMLKRFPW 409

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 76.6 bits (187), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 20/162 (12%)

Query: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK 65
           ++ DY   K   +G Y  VYL  K+ TG   A+K +K S      DM A  +V  ++  +
Sbjct: 698 SIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKS------DMIAKNQVTNVKSER 751

Query: 66  HVNVIE--------LVDVFMANDNLNLVLEFLPA-DLEIIIKDTSIMFSPAD--IKSWIL 114
            + +++        L   F   +NL LV+++L   D+  +IK   +M +  +   K +I 
Sbjct: 752 AIMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIK---MMGNLPEKWAKQYIC 808

Query: 115 MTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKIADFGLARL 156
             + GV   H+N I+H DLKP+NLL+   G +K+ DFGL+R+
Sbjct: 809 EVISGVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRM 850

>Scas_580.6
          Length = 1015

 Score = 76.6 bits (187), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 97/196 (49%), Gaps = 13/196 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHV-NVIELVDV 75
           G G + +VY G    T +  A+K +     +D ++    REV+FL  LK + N+      
Sbjct: 44  GRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVE-DVQREVQFLSSLKQIPNITRYYGS 102

Query: 76  FMANDNLNLVLEFLPADLEIIIKDTSIMFSPADI-KSWILMTLR----GVHHCHRNFILH 130
           ++ + +L +++E+              +  P  I + +I + +R     + + H++ ++H
Sbjct: 103 YLKDTSLWIIMEYCAGG------SLRSLLRPGKIDEKYIGVIMRELLVALKYIHKDNVIH 156

Query: 131 RDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHYTSAVD 190
           RD+K  N+L+  +G +K+ DFG+A  +        +   T ++ APE++    +Y + VD
Sbjct: 157 RDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDTKVD 216

Query: 191 IWSVGVIFAELMLRIP 206
           IWS+G+   E+    P
Sbjct: 217 IWSLGITAYEIATGNP 232

>Scas_619.5*
          Length = 510

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 105/216 (48%), Gaps = 41/216 (18%)

Query: 17  GEGTYAVVYLGTKKS--------TGRSIAVKEIKTSQFKDGLDMSALREVKFLQELKHVN 68
           G GT+  V +  KKS        +  + AVK IK  ++K        +E K L +L H N
Sbjct: 175 GNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYK------VDKEAKILLKLNHAN 228

Query: 69  VIELVDVF--MANDNLNLVLEFLPA-DLEIIIKDTSIMFSPADIKSWILM--TLRGVHHC 123
           +I++   F  + N+NL +  + +P  DL   +     + + ++ ++ I++   L+ +H+ 
Sbjct: 229 IIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILKALHYI 288

Query: 124 HRNFILHRDLKPNNLLLA---PDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLF 180
           H   I+HRDLK +N+LL    P  ++ +ADFG+A+ ++     + + V T  Y APE+ F
Sbjct: 289 HGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLKNTRMNTIVGTPEYCAPEVGF 348

Query: 181 GAKH-------------------YTSAVDIWSVGVI 197
            A                     Y S  DIWS+GVI
Sbjct: 349 KATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVI 384

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 113/252 (44%), Gaps = 17/252 (6%)

Query: 17  GEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALR---EVKFLQELKHVNVIELV 73
           G G    V +  + S G   AVK+ ++ +  + +   A +   E      L H N+IE +
Sbjct: 223 GSGAGGSVKVLVRPSDGAMFAVKQFRSRKPNEPIRDYARKCTSEFCVGSMLHHPNIIETL 282

Query: 74  DVFMANDNLNL--VLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHRNFILHR 131
           D+F          V+E+ P D   ++   S   S  +I       +  V++ H     HR
Sbjct: 283 DIFSDAKQTQYYQVMEYCPVDFFAVV--MSGEMSRGEINCCFKQLVEAVNYLHSKGYAHR 340

Query: 132 DLKPNNLLLAPDGQLKIADFGLARLMASPQE---ILTSNVV-TRWYRAPELLFGAKHYTS 187
           DLK +N ++  +G LK+ DFG A +     E    L   +V +  Y APE+L  +  Y +
Sbjct: 341 DLKLDNCVMTKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAPEVLVHSNGYDA 400

Query: 188 A-VDIWSVGVIFAELML-RIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQ 245
             VDIWS+G+IF  +ML R P+   KD     +V F     P D +   V S   +  + 
Sbjct: 401 PMVDIWSMGIIFCCMMLKRFPWKVPKDS----DVNFSLYCMPDDVEHDYVKSAQEHEALM 456

Query: 246 IYPPPSREELRR 257
                 R+++++
Sbjct: 457 KTKREERQKVKQ 468

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,024,938
Number of extensions: 415474
Number of successful extensions: 2845
Number of sequences better than 10.0: 650
Number of HSP's gapped: 1799
Number of HSP's successfully gapped: 699
Length of query: 305
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 204
Effective length of database: 13,099,691
Effective search space: 2672336964
Effective search space used: 2672336964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)