Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14806g40039420290.0
Kwal_23.347340937512791e-176
KLLA0E07744g53363790.10
ABR057W52038760.21
YEL047C47085710.95
ACR122C67651701.4
CAGL0L01177g46543691.4
Sklu_2411.949739672.5
Scas_717.7236341663.2
Sklu_2393.5493109663.8
CAGL0M07612g58137654.4
YGR175C (ERG1)49635655.2
AAL141C49734645.7
KLLA0F15224g50038645.7
CAGL0F01947g49344645.8
YOR356W63181647.6
CAGL0D05940g48934638.6
Scas_620.1049235638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14806g
         (394 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Cand...   786   0.0  
Kwal_23.3473                                                          497   e-176
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...    35   0.10 
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...    34   0.21 
YEL047C (YEL047C) [1381] chr5 complement(65385..66797) Cytoplasm...    32   0.95 
ACR122C [1169] [Homologous to NOHBY] (565397..567427) [2031 bp, ...    32   1.4  
CAGL0L01177g complement(134729..136126) highly similar to sp|P32...    31   1.4  
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement       30   2.5  
Scas_717.72                                                            30   3.2  
Sklu_2393.5 YEL047C, Contig c2393 6101-7582 reverse complement         30   3.8  
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...    30   4.4  
YGR175C (ERG1) [2128] chr7 complement(846936..848426) Squalene m...    30   5.2  
AAL141C [46] [Homologous to ScYGR175C (ERG1) - SH] (101503..1029...    29   5.7  
KLLA0F15224g 1403958..1405460 highly similar to sp|P32476 Saccha...    29   5.7  
CAGL0F01947g complement(189377..190858) highly similar to sp|P09...    29   5.8  
YOR356W (YOR356W) [5133] chr15 (1007217..1009112) Protein with s...    29   7.6  
CAGL0D05940g 566095..567564 highly similar to sp|P32476 Saccharo...    29   8.6  
Scas_620.10                                                            29   8.9  

>KLLA0E14806g 1322461..1323663 similar to ca|CA0218|IPF15294 Candida
           albicans unknown function, hypothetical start
          Length = 400

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/394 (96%), Positives = 382/394 (96%)

Query: 1   MVLKFQANCRSLIRPLFSRFYSAPVDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNA 60
           MVLKFQANCRSLIRPLFSRFYSAPVDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNA
Sbjct: 1   MVLKFQANCRSLIRPLFSRFYSAPVDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNA 60

Query: 61  KIGQETSSRNSEVIHAGLYYPVDSLKTKFCIEGNHIIYNELNPRKTGVDWLKCGKWVVAQ 120
           KIGQETSSRNSEVIHAGLYYPVDSLKTKFCIEGNHIIYNELNPRKTGVDWLKCGKWVVAQ
Sbjct: 61  KIGQETSSRNSEVIHAGLYYPVDSLKTKFCIEGNHIIYNELNPRKTGVDWLKCGKWVVAQ 120

Query: 121 TDFEDAYVERMYYKAKYELNLPVEILPSHKTQWQEPAVIVERSALVSPTTGIIDSHSLIE 180
           TDFEDAYVERMYYKAKYELNLPVEILPSHKTQWQEPAVIVERSALVSPTTGIIDSHSLIE
Sbjct: 121 TDFEDAYVERMYYKAKYELNLPVEILPSHKTQWQEPAVIVERSALVSPTTGIIDSHSLIE 180

Query: 181 YLSAMVDNQGGDTVIGSEVKDIQFLGSSYALQCVETLNGTAXXXXXXXXXXXXAAGLYAD 240
           YLSAMVDNQGGDTVIGSEVKDIQFLGSSYALQCVETLNGTA            AAGLYAD
Sbjct: 181 YLSAMVDNQGGDTVIGSEVKDIQFLGSSYALQCVETLNGTAEEVEIRVENVINAAGLYAD 240

Query: 241 KIANMILPPERQVKQYYAKGNYFTSKTQVPAVRRLIYPVPPRNGKSLGTHLTIDLNHQVR 300
           KIANMILPPERQVKQYYAKGNYFTSKTQVPAVRRLIYPVPPRNGKSLGTHLTIDLNHQVR
Sbjct: 241 KIANMILPPERQVKQYYAKGNYFTSKTQVPAVRRLIYPVPPRNGKSLGTHLTIDLNHQVR 300

Query: 301 FGPDLEYVDSADDLIPNPLNIEDAAKTITRYFPHLQPGELEASYCGIRPKLAAPGDTEFK 360
           FGPDLEYVDSADDLIPNPLNIEDAAKTITRYFPHLQPGELEASYCGIRPKLAAPGDTEFK
Sbjct: 301 FGPDLEYVDSADDLIPNPLNIEDAAKTITRYFPHLQPGELEASYCGIRPKLAAPGDTEFK 360

Query: 361 DFYIKEEEGFPGFVNLLGIESPGLTSSIPIGRYV 394
           DFYIKEEEGFPGFVNLLGIESPGLTSSIPIGRYV
Sbjct: 361 DFYIKEEEGFPGFVNLLGIESPGLTSSIPIGRYV 394

>Kwal_23.3473
          Length = 409

 Score =  497 bits (1279), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 242/375 (64%), Positives = 291/375 (77%), Gaps = 2/375 (0%)

Query: 22  SAPVDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQETSSRNSEVIHAGLYYP 81
           +  VDYSHAVIG GVVGLA+A+EL+K+ GNKV+++EKN   G ETSSRNSEVIHAGLYYP
Sbjct: 29  AGSVDYSHAVIGGGVVGLAVASELSKIAGNKVVLIEKNPSTGLETSSRNSEVIHAGLYYP 88

Query: 82  VDSLKTKFCIEGNHIIYNELNPRKTGVDWLKCGKWVVAQTDFEDAYVERMYYKAKYELNL 141
             SLKTK C+EG+ IIYNEL P KTGV+W KCGKW+VAQTD +DAY+E +Y KA  +L L
Sbjct: 89  PSSLKTKLCLEGSSIIYNELTPFKTGVNWSKCGKWIVAQTDADDAYLESLYQKATKDLGL 148

Query: 142 PVEILPSHKTQWQEPAVIVERSALVSPTTGIIDSHSLIEYLSAMVDNQGGDTVIGSEVKD 201
           PVE++P+HKT+W EPAV+V RSAL SPT+GIIDSHSL++YLS   DN  G+  IG+EV D
Sbjct: 149 PVEMIPAHKTKWIEPAVMVRRSALSSPTSGIIDSHSLMQYLSTGFDNNDGELAIGTEVID 208

Query: 202 IQFL-GSSYALQCVETLNGTAXXXXXXXXXXXXAAGLYADKIANMILPPERQVKQYYAKG 260
           IQ   G SY + C  T+N +             AAGLYA  +ANM+LP ER +KQY+AKG
Sbjct: 209 IQHQEGRSYNILCQSTVNDSNEQVEIQVENIVNAAGLYAHNVANMLLPKERHLKQYFAKG 268

Query: 261 NYFT-SKTQVPAVRRLIYPVPPRNGKSLGTHLTIDLNHQVRFGPDLEYVDSADDLIPNPL 319
           NYF+ S +    VRRLIYPVPP+NGKSLGTHLTIDLN Q+RFGPDLEYVDS  D   N  
Sbjct: 269 NYFSLSGSAFAPVRRLIYPVPPKNGKSLGTHLTIDLNGQMRFGPDLEYVDSPSDYDVNTS 328

Query: 320 NIEDAAKTITRYFPHLQPGELEASYCGIRPKLAAPGDTEFKDFYIKEEEGFPGFVNLLGI 379
           N+  A + IT+Y+PH+Q  +L+ +Y GIRPKLA PGDT+FKDFYI+EE+G PGFVNL GI
Sbjct: 329 NLVPAYEAITKYYPHIQLTDLQPAYSGIRPKLAGPGDTKFKDFYIREEDGLPGFVNLQGI 388

Query: 380 ESPGLTSSIPIGRYV 394
           ESPGLTSS+ IGRYV
Sbjct: 389 ESPGLTSSLAIGRYV 403

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
          Saccharomyces cerevisiae YMR020w FMS1 suppressor of
          fenpropimorph resistance mutation FEN2 singleton, start
          by similarity
          Length = 533

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 12 LIRPLFSRFYSAPV-----DYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQET 66
          L    +SR + A +     DYS  VIGAG+ GL   ++L K     VI +E   ++G   
Sbjct: 16 LTTVCWSRSHCASLRIIMTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRL 75

Query: 67 SSR 69
          ++R
Sbjct: 76 NTR 78

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
          complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 26 DYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIG 63
          +Y+  V+GAG+ GL  A EL      K +VLE  A+ G
Sbjct: 9  EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTG 46

>YEL047C (YEL047C) [1381] chr5 complement(65385..66797) Cytoplasmic
           soluble fumarate reductase, involved with Osm1p in the
           reoxidation of NADH and the production of succinate
           during anaerobic growth [1413 bp, 470 aa]
          Length = 470

 Score = 32.0 bits (71), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 36/85 (42%), Gaps = 13/85 (15%)

Query: 31  VIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQETSSRNSEVIHAGLYYPVDSLKTKFC 90
           VIG G+ GLA ANEL       V +LEK + IG  +   +S +  A             C
Sbjct: 8   VIGTGLAGLAAANELVNKYNIPVTILEKASSIGGNSIKASSGINGA-------------C 54

Query: 91  IEGNHIIYNELNPRKTGVDWLKCGK 115
            E     + E +PR    D +K  K
Sbjct: 55  TETQRHFHIEDSPRLFEDDTIKSAK 79

>ACR122C [1169] [Homologous to NOHBY] (565397..567427) [2031 bp, 676
           aa]
          Length = 676

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 31  VIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQETSSR-NSEVIHAGLYY 80
           ++G G  GLA+A  L K  G   +++EKNA++G    +R    V+H  ++Y
Sbjct: 268 IVGGGQGGLAVAARL-KSFGISSLIIEKNARVGDNWRNRYKFLVLHDPIWY 317

>CAGL0L01177g complement(134729..136126) highly similar to
          sp|P32614 Saccharomyces cerevisiae YEL047c FRDS1
          soluble fumarate reductase, hypothetical start
          Length = 465

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 31 VIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQETSSRNSEV 73
          ++G G+ GL  AN+L ++  + VI+L+K   IG  ++  +S +
Sbjct: 5  IVGTGLAGLTCANQLLELGKSPVILLDKTGTIGGNSTKASSGI 47

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 25 VDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIG 63
          ++ S  +IGAG+ GL  A++L     +  +VLE   +IG
Sbjct: 3  IEKSVVIIGAGIAGLKAASDLYAKNCHSCVVLESRDRIG 41

>Scas_717.72
          Length = 363

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 51  NKVIVLEKNAKIGQETSSRNS-EVIHAGLYYPVDSLKTKFC 90
           N+V+VLEK A   +  SSRNS +++  G  YP D L  KF 
Sbjct: 211 NRVLVLEKEAIFSKLVSSRNSDQILITGKGYP-DFLTRKFL 250

>Sklu_2393.5 YEL047C, Contig c2393 6101-7582 reverse complement
          Length = 493

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 23/109 (21%)

Query: 21  YSAPVDYSHAVIGAGVVGLAIANELT---KVPGNKVIVLEKNAKIG----QETSSRNSEV 73
           ++APV     ++G+G+ GL+  N+L    KVP   +++L+K + IG    + +S  N  V
Sbjct: 31  FTAPV----VIVGSGLAGLSTGNQLVTKYKVP---IVLLDKASSIGGNSIKASSGINGAV 83

Query: 74  IHAGLYYPVDSLKTKFCIE--------GNHIIYNELNPRKT-GVDWLKC 113
                   VD    KF  +        GN  + ++L+   +  + WL+ 
Sbjct: 84  TTTQKTLKVDDSVDKFYQDTFKSAKGLGNSALMSKLSQDSSAAISWLQS 132

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
          Saccharomyces cerevisiae YMR020w FMS1 suppressor of
          fenpropimorph resistance mutation FEN2, hypothetical
          start
          Length = 581

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 27 YSHAVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIG 63
          Y   V+GAG+ GL  A+ LT+  G   +V+E   +IG
Sbjct: 5  YDVVVVGAGIAGLKAASVLTQ-SGKSCLVIESRDRIG 40

>YGR175C (ERG1) [2128] chr7 complement(846936..848426) Squalene
          monooxygenase (squalene epoxidase), an enzyme of the
          ergosterol biosynthesis pathway [1491 bp, 496 aa]
          Length = 496

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 25 VDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKN 59
          + Y   VIGAGV+G  +A  L +  G KV+++E++
Sbjct: 17 ITYDAIVIGAGVIGPCVATGLAR-KGKKVLIVERD 50

>AAL141C [46] [Homologous to ScYGR175C (ERG1) - SH]
          (101503..102996) [1494 bp, 497 aa]
          Length = 497

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 25 VDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEK 58
          V Y   V+GAGVVG  +A  L +  G KV+++E+
Sbjct: 18 VVYDAIVVGAGVVGPCVATALAR-KGKKVLIVER 50

>KLLA0F15224g 1403958..1405460 highly similar to sp|P32476
          Saccharomyces cerevisiae YGR175c ERG1 squalene
          monooxygenase singleton, start by similarity
          Length = 500

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 22 SAPVDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKN 59
          S+ + Y   V+G GVVG  IA  L +  G KV+++E++
Sbjct: 18 SSEIVYDAIVVGCGVVGPCIATGLAR-KGKKVLIVERD 54

>CAGL0F01947g complement(189377..190858) highly similar to sp|P09624
           Saccharomyces cerevisiae YFL018c LPD1 dihydrolipoamide
           dehydrogenase precursor, hypothetical start
          Length = 493

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 30  AVIGAGVVGLAIANELTKVPGNKVIVLEKNAKIGQETSSRNSEV 73
           AVIG G++GL + +  +++ G+KV VLE   KIG   +S + EV
Sbjct: 204 AVIGGGIIGLEMGSVYSRL-GSKVTVLEFQPKIG---ASMDGEV 243

>YOR356W (YOR356W) [5133] chr15 (1007217..1009112) Protein with
           similarity to human electron transfer
           flavoprotein-ubiquinone oxidoreductase [1896 bp, 631 aa]
          Length = 631

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 13/81 (16%)

Query: 1   MVLKFQANCRSLIRPLFSRFYSAPVDYSHA-------VIGAGVVGLAIANELTKVPGN-- 51
           M  KF  +CR L +   +      ++   A       ++G G  GLA A +L ++  +  
Sbjct: 30  MTRKFSLSCRFLNKANLTEEEKELLNEPRARDYVDVCIVGGGPAGLATAIKLKQLDNSSG 89

Query: 52  ----KVIVLEKNAKIGQETSS 68
               +V+VLEK++ +G +T S
Sbjct: 90  TGQLRVVVLEKSSVLGGQTVS 110

>CAGL0D05940g 566095..567564 highly similar to sp|P32476
          Saccharomyces cerevisiae YGR175c ERG1 squalene
          monooxygenase, hypothetical start
          Length = 489

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 25 VDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEK 58
          V Y   ++GAGV+G  +A  L +  G KV+++E+
Sbjct: 10 VTYDALIVGAGVIGPCVATALAR-KGKKVLIVER 42

>Scas_620.10
          Length = 492

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 25 VDYSHAVIGAGVVGLAIANELTKVPGNKVIVLEKN 59
          + Y   V+GAGV+G  +A  L +  G KV+++E++
Sbjct: 13 ITYDAIVVGAGVIGPCVATGLAR-KGKKVLIVERD 46

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,250,300
Number of extensions: 579108
Number of successful extensions: 1281
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1297
Number of HSP's successfully gapped: 28
Length of query: 394
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 290
Effective length of database: 12,995,837
Effective search space: 3768792730
Effective search space used: 3768792730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)