Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14784g37937319010.0
Sklu_1484.137634411391e-156
Kwal_23.347538233610021e-135
ADL282W3723439611e-129
YDL107W (MSS2)3513376913e-88
CAGL0H10296g3733436498e-82
Scas_613.123483276279e-79
YPR189W (SKI3)1432124770.17
Scas_631.41398192730.61
YHR166C (CDC23)62646701.1
CAGL0F05577g66640701.2
Kwal_47.17329150370672.9
KLLA0E07315g66543663.4
KLLA0D10802g671122637.9
KLLA0A04015g1343101639.1
Scas_584.1350238629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14784g
         (373 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14784g complement(1321041..1322180) similar to sp|P40990 S...   736   0.0  
Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement         443   e-156
Kwal_23.3475                                                          390   e-135
ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH] complement(...   374   e-129
YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...   270   3e-88
CAGL0H10296g complement(1004900..1006021) similar to sp|P40990 S...   254   8e-82
Scas_613.12                                                           246   9e-79
YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein w...    34   0.17 
Scas_631.4                                                             33   0.61 
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    32   1.1  
CAGL0F05577g 559705..561705 similar to sp|P15424 Saccharomyces c...    32   1.2  
Kwal_47.17329                                                          30   2.9  
KLLA0E07315g 664145..666142 similar to sp|P42843 Saccharomyces c...    30   3.4  
KLLA0D10802g complement(920627..922642) similar to sp|P32569 Sac...    29   7.9  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    29   9.1  
Scas_584.13                                                            28   9.9  

>KLLA0E14784g complement(1321041..1322180) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase singleton, start by similarity
          Length = 379

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/373 (95%), Positives = 358/373 (95%)

Query: 1   MLGFXXXXXXXXXXXXXXXANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLY 60
           MLGF               ANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLY
Sbjct: 1   MLGFRSCILVSSRRLISSLANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLY 60

Query: 61  EGLDTGNDVDIPNSIKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDA 120
           EGLDTGNDVDIPNSIKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDA
Sbjct: 61  EGLDTGNDVDIPNSIKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDA 120

Query: 121 ISLLCFDVLKDPDSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYM 180
           ISLLCFDVLKDPDSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYM
Sbjct: 121 ISLLCFDVLKDPDSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYM 180

Query: 181 KFLDLQNDTFLAGEVYGQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYV 240
           KFLDLQNDTFLAGEVYGQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYV
Sbjct: 181 KFLDLQNDTFLAGEVYGQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYV 240

Query: 241 NNDIFKARYLIESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYF 300
           NNDIFKARYLIESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYF
Sbjct: 241 NNDIFKARYLIESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYF 300

Query: 301 DCTMKNNELLLAKRCYESMEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTWQ 360
           DCTMKNNELLLAKRCYESMEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTWQ
Sbjct: 301 DCTMKNNELLLAKRCYESMEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTWQ 360

Query: 361 SLTPGDTTVKVSK 373
           SLTPGDTTVKVSK
Sbjct: 361 SLTPGDTTVKVSK 373

>Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement
          Length = 376

 Score =  443 bits (1139), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 206/344 (59%), Positives = 273/344 (79%), Gaps = 1/344 (0%)

Query: 20  ANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTG-NDVDIPNSIKGK 78
           A++RPP +++FPQKK+V+++LFELDSRL + KLYP+YE LY  +D   + V +P S+   
Sbjct: 17  ASRRPPFYDVFPQKKLVNKLLFELDSRLTFPKLYPLYESLYNTMDDAQSQVKVPTSVTAS 76

Query: 79  DLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDPDSNTED 138
           D+M+MKKVLEK+RH+TK+INKNLLALEN +L++AAE+G+NDAISLL FD LKD DSN+ +
Sbjct: 77  DIMVMKKVLEKLRHRTKSINKNLLALENEILNKAAEMGNNDAISLLAFDTLKDSDSNSHE 136

Query: 139 DVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDTFLAGEVYGQ 198
           D+++AK LIK LYQ+ HPLTVKLT D+  KN+D   AE YY  FL L++DTFLAGEVYGQ
Sbjct: 137 DIAYAKTLIKELYQLRHPLTVKLTGDLTFKNNDLINAEKYYKDFLALEDDTFLAGEVYGQ 196

Query: 199 LGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIESSATQG 258
           LGQI FRKPNL +AE  FLKSIKLCP++YSV SYF LGQMY+N+   KAR L+ES+ATQG
Sbjct: 197 LGQISFRKPNLFKAEDYFLKSIKLCPLEYSVHSYFYLGQMYMNSQPLKARALLESTATQG 256

Query: 259 FKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELLLAKRCYES 318
           FKESF+ LG LEMNYF++Y KAQEWFKLGMEL++ ECFVGYFDC +K  E + AKRC+ S
Sbjct: 257 FKESFKILGFLEMNYFEDYSKAQEWFKLGMELFEMECFVGYFDCCVKLEEWVNAKRCFNS 316

Query: 319 MEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTWQSL 362
           M  L ++N +   ++ +F + R   ++K+++YS N  +++  ++
Sbjct: 317 MTTLLQSNTNYEPVYSNFVTTRKDKLEKLEKYSTNVVMDSMHAV 360

>Kwal_23.3475
          Length = 382

 Score =  390 bits (1002), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 251/336 (74%), Gaps = 1/336 (0%)

Query: 20  ANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVD-IPNSIKGK 78
           A KRPP +E+FPQKKMV++ILF+LDS+L + KLYP++E LY+     +  + IP S K  
Sbjct: 23  AKKRPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRDPSELIPTSFKAS 82

Query: 79  DLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDPDSNTED 138
           D+MIMKKVLEK+RH+TK+ NKNL+ LEN LL+ AAE+GDNDAI+LL F  LK+P  +  +
Sbjct: 83  DVMIMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFLKNPGKHAPE 142

Query: 139 DVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDTFLAGEVYGQ 198
           DV HAK LIK LYQ+ HPLT+KLTAD+A+K++    AE YY+ FL+L+++T  AGEVYGQ
Sbjct: 143 DVLHAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRAGEVYGQ 202

Query: 199 LGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIESSATQG 258
           LG I+FR+PNL EAE+CFL SI+LCP++    SY+ L Q+Y++++  KAR L+ES+A++G
Sbjct: 203 LGLIYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLMESAASEG 262

Query: 259 FKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELLLAKRCYES 318
           F+ESF+ LG LEMNYF +Y KA +WF+LGMELY  EC++GYFDC++K  +L  A+ C  S
Sbjct: 263 FRESFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKARNCLTS 322

Query: 319 MEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNA 354
           ++KL++ N      F+ F   R   I K+  +S N 
Sbjct: 323 LQKLSKTNDLFASAFKSFVDSRQETINKVNVFSVNT 358

>ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH]
           complement(206313..207431) [1119 bp, 372 aa]
          Length = 372

 Score =  374 bits (961), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 251/343 (73%), Gaps = 1/343 (0%)

Query: 21  NKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTG-NDVDIPNSIKGKD 79
           N RPPLH+IFP KK+V+R+LF+LDSRL + KL P+YE++Y  LD+   D+ +P  ++  D
Sbjct: 22  NNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRAHD 81

Query: 80  LMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDPDSNTEDD 139
           +MIMKKVLEK R +TK+ N++LLALEN LL  AA++G  DA +LL FD L +P S T  D
Sbjct: 82  VMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNPASQTAAD 141

Query: 140 VSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDTFLAGEVYGQL 199
           + +AK ++K+ Y+  HPLT+KLT D++L N D+ TAE YYMKFL  + DTFLAGEVYGQL
Sbjct: 142 MEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLAGEVYGQL 201

Query: 200 GQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIESSATQGF 259
           G+I F + +  +AE+ FL++IKL P++YSV+SYF LGQ+Y+N+D  KAR L+ES+A+QGF
Sbjct: 202 GRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLESAASQGF 261

Query: 260 KESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELLLAKRCYESM 319
           KESF+TLG LEMNYF +  KA+EWFKLGMEL + EC +G FDC +   +L LA R  +S+
Sbjct: 262 KESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALAHRASKSL 321

Query: 320 EKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTWQSL 362
           E LA+ ++    L+  F+ +R   +  ++EY    +++   S+
Sbjct: 322 EALAKTDKIYQALYTQFADYRHEKLSLLEEYKAEKALDVSGSI 364

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score =  270 bits (691), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 222/337 (65%), Gaps = 19/337 (5%)

Query: 24  PPL----HEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVDIPNS----- 74
           PP+     EIFP+K+ V++ILF+LD+RL Y+++YP++ ++ +     N+ +IP       
Sbjct: 12  PPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQN---TNEENIPWRKKYPY 68

Query: 75  IKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVL----- 129
           I+  D+M M+ VL  +R + K ++K+LLA+E+ LL+ AAE+G+NDAIS+L F+V+     
Sbjct: 69  IRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSFNVIHEYKK 128

Query: 130 KDPDSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDT 189
           ++  S+ E D+  A + IK LY  NH LTVKL  D+  +N     AE YY +FL L+N T
Sbjct: 129 ENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQEFLKLENST 188

Query: 190 FLAGEVYGQLGQIHFRKPN-LIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKAR 248
            LAGEV+G+LG+I  ++ N  ++AEK +L  I+L  I+ S R YFLL ++Y++++  KA+
Sbjct: 189 KLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYMSSEPMKAK 248

Query: 249 YLIESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNE 308
            L+E+ A+ GFKE F+TLG LE+NYF NY +A+EWFK GME+ D ECF G+FDC +K   
Sbjct: 249 ALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFFDCCVKEEN 308

Query: 309 LLLAKRCYESMEKLAENNQDVNRLFEDFSSHRASDIQ 345
              A+ C ES++KL  N++D   +   F   R   I+
Sbjct: 309 FKGARDCLESVKKLG-NDKDKKTMINVFLESRKDSIK 344

>CAGL0H10296g complement(1004900..1006021) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase, hypothetical start
          Length = 373

 Score =  254 bits (649), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 138/343 (40%), Positives = 228/343 (66%), Gaps = 23/343 (6%)

Query: 28  EIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVDIPNSIKGKDLMIMKKVL 87
           E FP+KK ++++LF+L+SRL Y KLYP+Y  LY G+       + + +KG DL++M+ VL
Sbjct: 26  EHFPKKKTINKLLFDLNSRLTYKKLYPIYVGLYHGVPVPQQQKLLDGVKGSDLIVMRNVL 85

Query: 88  EKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKD-------PDSNTEDDV 140
           EKVR++T+    ++L LE+ LL+ AAE+G+NDAI++L F  +++        ++N E+ V
Sbjct: 86  EKVRNRTRYARPDMLKLEDKLLELAAELGNNDAIAILSFRSIRENMGTNSAAEANNEE-V 144

Query: 141 SHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLD---------LQNDTFL 191
           + AKKL K+LY +NH L +KL  D+AL+ ++   A  +Y K+++         L  +  L
Sbjct: 145 TIAKKLFKDLYNINHLLAIKLLGDLALEANNWEEALTFYNKYINIAVKDNGHLLTGNDDL 204

Query: 192 AGEVYGQLGQIHFRK-PNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYL 250
            GEVYG+LG+I F    N+ +AE+ + K ++L  ++ SVR YFL  Q+Y++++  K+R L
Sbjct: 205 TGEVYGKLGEIEFTYLANMTKAEEYWQKCLELTSVEDSVRWYFLAAQIYMSSEPLKSRIL 264

Query: 251 IESSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELL 310
           +E +A+QGFKES  +LG LEMNYF++Y +A+EWFKLGME+++ + ++G+FDC +KN + +
Sbjct: 265 LEKAASQGFKESLTSLGFLEMNYFRDYGRAKEWFKLGMEVFELQSYIGFFDCCVKNEDWI 324

Query: 311 LAKRCYESMEKLAE----NNQDVNR-LFEDFSSHRASDIQKIK 348
            A +C +S+EK+       + + N+    +F + RA  I K++
Sbjct: 325 AALKCLKSIEKIGTMESFGSDNTNKATVSNFMNSRAEFIDKVR 367

>Scas_613.12
          Length = 348

 Score =  246 bits (627), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 127/327 (38%), Positives = 201/327 (61%), Gaps = 13/327 (3%)

Query: 25  PLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVDIPNSIKGKDLMIMK 84
           P HEIFP+K++++RILFELDS   Y  LYP +E LY         ++P+++ G  L++M 
Sbjct: 19  PFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYL------KHELPSTVSGPQLLLMD 72

Query: 85  KVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDPDSNTEDDVSHAK 144
           +VL +V  + K IN+ L+ +   LL+ AA  G+NDAIS +C+++L  P  +++ D   A 
Sbjct: 73  RVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSPKDDSKGDAEDAS 132

Query: 145 KLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQN-------DTFLAGEVYG 197
           +LI  L +  + LT K   D++    D   A+++Y KF++  +       D  + G+V  
Sbjct: 133 RLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETRVSDVSIIGQVLE 192

Query: 198 QLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIESSATQ 257
           +LG+I F +  ++ AEK +L +I    ++ SV+SYF L ++Y+N++  K+R L+E+ ATQ
Sbjct: 193 RLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPLKSRVLLENCATQ 252

Query: 258 GFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELLLAKRCYE 317
           GF+ESF+ LG LE+NYFKN  KA EWF+LGMEL++ ECF G+FD   +  E     +C +
Sbjct: 253 GFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQLKEYKSCSKCLK 312

Query: 318 SMEKLAENNQDVNRLFEDFSSHRASDI 344
           S+E     N+    +  +F SHR + I
Sbjct: 313 SLETFKNINESYKNMVSEFVSHRENKI 339

>YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein with
           tetratricopeptide (TPR) repeats, part of a system to
           protect cells from double-stranded RNA (dsRNA) viruses
           [4299 bp, 1432 aa]
          Length = 1432

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 19/124 (15%)

Query: 188 DTFLAGEVYGQLGQI--HFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIF 245
           DTF  G  +  LG I  H+ K +L  A KC+ K+  L   DY+   Y  + + Y +   +
Sbjct: 624 DTFAPG--FSTLGDIYCHYYKDHL-RAFKCYFKAFDLDAGDYTAAKY--ITETYASKPNW 678

Query: 246 KARYLIESSATQGFKES---------FRTLGLLEMNYFKNYPKAQEWFKLGMEL--YDTE 294
           +A   I S   +G K           FR +G+  +   +    + EWF+  + +   D E
Sbjct: 679 QAASSIASRLIKGEKAKAELRSNNWPFRVVGIAHLEK-QEESDSIEWFQSALRVDPNDVE 737

Query: 295 CFVG 298
            +VG
Sbjct: 738 SWVG 741

>Scas_631.4
          Length = 1398

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 89/192 (46%), Gaps = 8/192 (4%)

Query: 79   DLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLC-FDVLKDPDSNTE 137
            D + ++ ++E    K     K++  +++V L       D D I++ C F +L    +   
Sbjct: 837  DCLPVESLVEIFSSKGLIGTKDVDQIDDVELKTILASSDEDNITIGCQFLILAAKYAIPS 896

Query: 138  DDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVY-YMKFLDLQNDTFLAGEVY 196
            ++++     +++    N  +T +LTA + LK      A ++ + + +  Q++T    E +
Sbjct: 897  ENLTEYAATVRSALWCNIGVT-ELTASLVLKEAKFRDAAIFSFKRSIKYQSNT---TEAW 952

Query: 197  GQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIESSAT 256
              LG I     N   ++ CF+K++ L P D  + S+ L      NND+  A  ++  S +
Sbjct: 953  IGLG-IATMDVNYRVSQHCFIKAVALAPKDIEI-SFNLAMLALKNNDLEFAEQILMRSQS 1010

Query: 257  QGFKESFRTLGL 268
               ++S   LGL
Sbjct: 1011 VAPQDSSPWLGL 1022

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 195 VYGQLGQIHFRKPNLIEAEKCFLKSIKLC-PIDYSVRSYFLLGQMY 239
           ++  LG+ + +  N +EA KC+ +SIK    +D +   Y+ L Q+Y
Sbjct: 501 IWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYYRLAQLY 546

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 38/86 (44%), Gaps = 5/86 (5%)

Query: 155 HPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDTFLAGEVYGQLGQIHFRKPNLIEAEK 214
            P T  + A+      +   + +Y+ + L L   T      +  +G       N   A +
Sbjct: 396 RPETCCIIANYYSARQEHEKSIMYFRRALTLDKKT---TNAWTLMGHEFVELSNSHAAIE 452

Query: 215 CFLKSIKLCPIDYSVRSYFLLGQMYV 240
           C+ +++ +CP D+  +++F LGQ Y 
Sbjct: 453 CYRRAVDICPRDF--KAWFGLGQAYA 476

>CAGL0F05577g 559705..561705 similar to sp|P15424 Saccharomyces
           cerevisiae YDR194c MSS116, hypothetical start
          Length = 666

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%)

Query: 32  QKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTGNDVDI 71
           +K ++SR L++  SR+ + +L P+ +K  E + T +D DI
Sbjct: 162 EKNVISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDI 201

>Kwal_47.17329
          Length = 1503

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 49   YNKLYPMYEKLYEGLDTGNDVDIPNSIK---GKDLMIMKKVLEKVRHKTKAINKNL--LA 103
            Y K +P    L++ L T    D+P+  K   GKD+  +KK++E VR   KA+ +N   ++
Sbjct: 1056 YKKNFP---DLFQKLSTAGR-DVPSISKLYPGKDINELKKLIEDVRSWLKAVRQNFVTVS 1111

Query: 104  LENVLLDRAA 113
            LE+  L +A+
Sbjct: 1112 LESESLTKAS 1121

>KLLA0E07315g 664145..666142 similar to sp|P42843 Saccharomyces
           cerevisiae YNL311c hypothetical protein singleton,
           hypothetical start
          Length = 665

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 23/43 (53%)

Query: 317 ESMEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTW 359
           E++E+    N D++   EDFS  + +D  +I  +    ++N W
Sbjct: 559 ENLERATHFNNDIDISEEDFSPRKWNDFHRINSFKDIPNVNVW 601

>KLLA0D10802g complement(920627..922642) similar to sp|P32569
           Saccharomyces cerevisiae YER022w SRB4 DNA-directed RNA
           polymerase II holoenzyme and Kornberg s mediator (SRB)
           subcomplex subunit singleton, start by similarity
          Length = 671

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 60/122 (49%), Gaps = 24/122 (19%)

Query: 77  GKDLMIMKKVLEKVRHK--TKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLK---D 131
           GKDL++++ +L K+RHK  T+ I K    + N +L++       D+I     D+     +
Sbjct: 532 GKDLVLLRAILGKIRHKKYTQLIEK---IVNNAILEKKE-----DSIMTTNTDITSNDNE 583

Query: 132 PDSNTE-----DDVSHAKKLI---KNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFL 183
           P  N E      +++   K++   +  + +N P   KL   +   NH +A   + +MK++
Sbjct: 584 PSKNKELATLQREIALFDKILSMPRTDFTINIPEKGKLELSLRSTNHCNA---IIHMKYI 640

Query: 184 DL 185
           D+
Sbjct: 641 DV 642

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 44/101 (43%), Gaps = 19/101 (18%)

Query: 58  KLYEGLDTGNDVDI-------PNSIKGKDLMIMKKVLEKV-RHKTKAINKNLLALENVLL 109
           K Y+    G+D+D+       P  ++   L+     +E +   KT  + +N++  ++V +
Sbjct: 522 KYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSI 581

Query: 110 -----------DRAAEIGDNDAISLLCFDVLKDPDSNTEDD 139
                      DR A + D   I    F+ LKD  ++ EDD
Sbjct: 582 AGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDD 622

>Scas_584.13
          Length = 502

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 128 VLKDPDSNTEDDVSHAKKLIKNLY-QMNHPLTVKLTAD 164
           VLK P S+ E DV   K+ +K L  ++NHP+ +K T +
Sbjct: 13  VLKPPSSDDELDVRDDKEQVKALRDRINHPVLIKTTQE 50

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,304,926
Number of extensions: 555022
Number of successful extensions: 1932
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1961
Number of HSP's successfully gapped: 34
Length of query: 373
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 270
Effective length of database: 13,030,455
Effective search space: 3518222850
Effective search space used: 3518222850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)