Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E14762g60159230560.0
YGL142C (GPI10)61658615990.0
Scas_669.1159658815740.0
ADL281C59558615460.0
Kwal_23.347861858115320.0
CAGL0F07843g61259814770.0
AAR043C5371931141e-05
CAGL0K09548g4962271033e-04
KLLA0C08591g541214950.002
Kwal_47.18842508181930.004
Sklu_1475.2508183830.059
YOR149C (SMP3)516235810.096
Scas_606.6571182780.20
Scas_714.36514196750.46
Kwal_23.4476552146740.75
Sklu_1894.355149730.93
KLLA0D19404g553173721.3
KLLA0C06567g530212711.5
YNL219C (ALG9)55541702.1
ABL185C55243702.2
Scas_562.571248674.5
Scas_610.14462108666.8
CAGL0K05005g55862657.5
Sklu_2173.454385658.4
CAGL0M10769g562153649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E14762g
         (592 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces...  1181   0.0  
YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein i...   620   0.0  
Scas_669.11                                                           610   0.0  
ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH] (207452..2...   600   0.0  
Kwal_23.3478                                                          594   0.0  
CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces c...   573   0.0  
AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH] (418301..41...    49   1e-05
CAGL0K09548g complement(940088..941578) similar to sp|Q04174 Sac...    44   3e-04
KLLA0C08591g complement(752256..753881) similar to sp|P53730 Sac...    41   0.002
Kwal_47.18842                                                          40   0.004
Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement          37   0.059
YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein r...    36   0.096
Scas_606.6                                                             35   0.20 
Scas_714.36                                                            33   0.46 
Kwal_23.4476                                                           33   0.75 
Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement         33   0.93 
KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces...    32   1.3  
KLLA0C06567g complement(573595..575187) similar to sp|Q04174 Sac...    32   1.5  
YNL219C (ALG9) [4385] chr14 complement(235995..237662) Mannosylt...    32   2.1  
ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH] (60000..6165...    32   2.2  
Scas_562.5                                                             30   4.5  
Scas_610.14                                                            30   6.8  
CAGL0K05005g 484817..486493 similar to sp|P53868 Saccharomyces c...    30   7.5  
Sklu_2173.4 YNR030W, Contig c2173 5182-6813 reverse complement         30   8.4  
CAGL0M10769g 1074047..1075735 similar to sp|P53730 Saccharomyces...    29   9.9  

>KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis singleton, hypothetical
           start
          Length = 601

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/592 (97%), Positives = 578/592 (97%)

Query: 1   MSNQVPLKRLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLR 60
           MSNQVPLKRLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLR
Sbjct: 1   MSNQVPLKRLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLR 60

Query: 61  SYAFPLIFQIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEE 120
           SYAFPLIFQIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEE
Sbjct: 61  SYAFPLIFQIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEE 120

Query: 121 IRGFIEYQGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMXXXXXXXXXXXXXXTVINF 180
           IRGFIEYQGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTM              TVINF
Sbjct: 121 IRGFIEYQGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMDKSDDSKGSDKKHSTVINF 180

Query: 181 TLVATVSNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVL 240
           TLVATVSNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVL
Sbjct: 181 TLVATVSNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVL 240

Query: 241 QRPTNAFIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITI 300
           QRPTNAFIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITI
Sbjct: 241 QRPTNAFIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITI 300

Query: 301 PVLKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLV 360
           PVLKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLV
Sbjct: 301 PVLKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLV 360

Query: 361 NPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTME 420
           NPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTME
Sbjct: 361 NPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTME 420

Query: 421 FFSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFH 480
           FFSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFH
Sbjct: 421 FFSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFH 480

Query: 481 RNDVKELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRS 540
           RNDVKELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRS
Sbjct: 481 RNDVKELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRS 540

Query: 541 PGKQYTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592
           PGKQYTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG
Sbjct: 541 PGKQYTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592

>YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein
           involved in glycosylphosphatidylinositol (GPI)
           synthesis, transfers the third core mannose to the GPI
           core structure [1851 bp, 616 aa]
          Length = 616

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/586 (50%), Positives = 407/586 (69%), Gaps = 7/586 (1%)

Query: 9   RLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIF 68
           ++F V L  R + A+LTRTFFQADEFWQ+LEPAH+ AF YGELTWEW FG+RSY FP+IF
Sbjct: 16  QIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPMIF 75

Query: 69  QIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEYQ 128
           ++ Y LV  ++I     +   +      +  ++P  E  W++ ++++  P ++    EY 
Sbjct: 76  ELTYRLVSLSSILLHYALLLLSTIGSDLLILLLPKYELSWQVAEDLKRLPFDVTRSFEYY 135

Query: 129 GVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTM--XXXXXXXXXXXXXXTVINFTLVATV 186
           GVIYAPK++MAVLA+IGE++++   +KLY LT+                 +  F L+ ++
Sbjct: 136 GVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDKRNEKEEEERRSGLSEITKFALLLSL 195

Query: 187 SNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNA 246
           +NFFNCFFITR+FINSFEMILTS++LYYWDWT G+ I+   F KSLI      LQRP++ 
Sbjct: 196 TNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPSSG 255

Query: 247 FIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFI 306
            IW+I    +ILNLV  K++  LF    KV+ + F+  + N  ID YFY  +T P  +F+
Sbjct: 256 LIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFRFL 315

Query: 307 KFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQI 366
           KFN T+ LSKFYGVAPW+FH FQSLPIV G S+P      F  L+K+ F    +NPF Q+
Sbjct: 316 KFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFFQV 375

Query: 367 KTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVM 426
           K  +LLN+++YS +PHKEFRFI+PLQP FI++S F  + L + Y      + +     ++
Sbjct: 376 KLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYW-----KRLSGLKSLL 430

Query: 427 WILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHRNDVKE 486
           W++P VS+  ++LL T HESG++ VM +LH    IDS+GFIMPCHSTP QS+ HR+D+++
Sbjct: 431 WLVPFVSVFIALLLDTFHESGSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQD 490

Query: 487 LWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQYT 546
           LW+ITC+PPLHLL DP+A +KL  YMDESD+LYD+IS F+Y++FPP FRK LRSPGK Y+
Sbjct: 491 LWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKTYS 550

Query: 547 YEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592
           +EWP YLV+FE +++ F+ D+L DS YIE  RFFNSL HWD RRSG
Sbjct: 551 HEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSG 596

>Scas_669.11
          Length = 596

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/588 (52%), Positives = 413/588 (70%), Gaps = 16/588 (2%)

Query: 10  LFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIFQ 69
           LF+ ILV R   ALLTRTFFQADEFWQ+LEPAH MAFGYGELTW+W F +RSYAFP IF+
Sbjct: 9   LFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAFPFIFE 68

Query: 70  IGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEYQG 129
           + Y LV+        +++  ++     +  + P++EF   +V ++   P ++   +EY G
Sbjct: 69  LTYRLVRLVVFMSRWLMELLSELASELLLLLFPSNEFVRLVVDDLVVLPSDMANSLEYIG 128

Query: 130 VIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMXXXXXXXXXXXXXXTVINFTLVATV--- 186
           VIY PK++M ++AA GE++ I L +KLY +T               ++   T +ATV   
Sbjct: 129 VIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIATVLSL 188

Query: 187 SNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNA 246
           +NFFNC+ ITRSFINSFEM  T+V+LY+WDWT G  IES +F KSL+I  FT LQRPTNA
Sbjct: 189 TNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQRPTNA 248

Query: 247 FIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISI-STNLCIDYYFYGYITIPVLKF 305
           FIW++LG  +I N++      K + +L++ I   F+++   N+ ID+YFYG ITIP++ F
Sbjct: 249 FIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITIPLINF 308

Query: 306 IKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQ 365
           IKFN TS L+ FYG +PW+FH+FQS+PI+ GY+L   +   FC L+ K+F S   NPF Q
Sbjct: 309 IKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFATNPFFQ 368

Query: 366 IKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQV 425
           IK ++LLNV+++SL  HKEFRFIYPLQPFF+ +SVF  +  L+ Y           +S++
Sbjct: 369 IKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVF-ALHKLKWYQ----------YSRM 417

Query: 426 MWILPVVSMVASMLLSTLHESGTVAVMDYLHSIR-NIDSIGFIMPCHSTPWQSHFHRNDV 484
            WILP+ S+V S+L+S+  ESG++ VM +LH+   ++ S+GFIMPCHSTPWQS+ HR D+
Sbjct: 418 TWILPLASVVLSLLVSSFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLHRQDI 477

Query: 485 KELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQ 544
            +LWAITC PPLHLL D DA +KL  YMDESD+LY N ++F+Y++FPPVF+K LRSPGK 
Sbjct: 478 PDLWAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRSPGKV 537

Query: 545 YTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592
           YT+EWPEYL+IFE LD   M +YL DS Y+E TRFFNS  HWD RR+G
Sbjct: 538 YTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAG 585

>ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH]
           (207452..209239) [1788 bp, 595 aa]
          Length = 595

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/586 (48%), Positives = 401/586 (68%), Gaps = 6/586 (1%)

Query: 8   KRLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLI 67
           + + + + + R + AL  R+FFQADE+WQSLEPAH  AFGYG LTWEW  GLRSYAFP++
Sbjct: 4   RSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPML 63

Query: 68  FQIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEY 127
           F++ Y +     ++  + +Q       L  A V+P+   G   ++ +   PE  +  +EY
Sbjct: 64  FEMSYYVAWILGVATRMALQGLAHATALCGA-VVPSGAAGVAAMKAVWELPEAAQELVEY 122

Query: 128 QGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMXXXXXXXXXXXXXXTVINFTLVATVS 187
            GV+Y P+++MA +AA GEF+ +LL  KLY   +               V    L+ T++
Sbjct: 123 YGVLYGPRVVMAAVAACGEFYSVLLVRKLY---LRVADKGDDQKGDAAPVSRLALMLTMT 179

Query: 188 NFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNAF 247
           NFFNCFF TR+FINSFEM LT+V+LY+WDW+ G  + S  F  SL +  F  LQRPTN  
Sbjct: 180 NFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVL 239

Query: 248 IWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFIK 307
           IW +LG +++LNLV S+RW+ L +L+ KV  A  +++  N+ IDYYFYG + +P+L+FI+
Sbjct: 240 IWAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAVCANIAIDYYFYGGVLLPLLRFIE 299

Query: 308 FNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIK 367
           FN T+ L+ FYG APW+FH+ QS+P++ GY+LP  + +      ++     L +P +QIK
Sbjct: 300 FNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIK 359

Query: 368 TVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMW 427
            VV+LN+ LYS I HKEFRF+YPLQP F+ LS  +    LQ + +  T   ++    +++
Sbjct: 360 CVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTA-WLKRVQSLLY 418

Query: 428 ILPVVSMVASMLLSTLHESGTVAVMDYLHS-IRNIDSIGFIMPCHSTPWQSHFHRNDVKE 486
           +LPV+S+ A+++L+T HE+G V+VMDYLHS + + +SIGFIMPCHSTPWQSH HRND+ +
Sbjct: 419 VLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGK 478

Query: 487 LWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQYT 546
           LWAI+C PPL LL   DA  +L  YMDESD+LY+NI +F++++FPPVFR+ LRSPG+QY 
Sbjct: 479 LWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYA 538

Query: 547 YEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592
           YEWPE+LV+FE +D  FM +YL DS Y+E  RFFN+L HWD RR+G
Sbjct: 539 YEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584

>Kwal_23.3478
          Length = 618

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/581 (50%), Positives = 385/581 (66%), Gaps = 7/581 (1%)

Query: 12  KVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIFQIG 71
           KV+++ R + +L   ++FQ DEFWQ+LEPAH+ AFGYG+LTWEW +GLRSYAFP IF+I 
Sbjct: 34  KVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIFEIL 93

Query: 72  YTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEYQGVI 131
           Y LV   +   E IV    D  +  V+ +IP SE  W MV EM+ FP+EI+ F+EY GVI
Sbjct: 94  YRLVSVVSTIAEQIVAITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSFLEYYGVI 153

Query: 132 YAPKLIMAVLAAIGEFHVILLAEKLYKLTMXXXXXXXXXXXXXXTVINFTLVATVSNFFN 191
            APK++MA++ A+GE +     EKLY  T                V     + + +NFFN
Sbjct: 154 IAPKVMMALIGAVGEMYAFAFIEKLY--TREFSGDEKNKMQSGKLVKMAACLLSTTNFFN 211

Query: 192 CFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNAFIWLI 251
            F ITR+F N+ EM LT  +LY+WDWT G  +   +F  SL  G F  LQRPTNA IW+ 
Sbjct: 212 NFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTNALIWVP 271

Query: 252 LGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFIKFNCT 311
           LG +++LNL   K ++ L  L+ K++      ++ NL ID+YFY  +  PV +FIKFN T
Sbjct: 272 LGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFIKFNYT 331

Query: 312 SSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIKTVVL 371
           S+LS FYG APW+FH+ QSLP++ G+S PL ++ FFCS T+K     L +  LQ + VV+
Sbjct: 332 SALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKG-REGLNSSMLQARIVVI 390

Query: 372 LNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMWILPV 431
           +N+I +SLI HKEFRF+Y L PFF++   F  I L  K   T    +      ++W  P 
Sbjct: 391 INIIAFSLISHKEFRFLYILHPFFLL---FSSIALGPKI-PTLEKMSNGPLKYLVWAPPF 446

Query: 432 VSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHRNDVKELWAIT 491
            S++AS+L+S+ HE+G   V  YLH I  I S+GFIMPCHSTPWQS+ HRND++++W+IT
Sbjct: 447 FSIIASLLVSSYHETGVTEVTKYLHHIPRIHSVGFIMPCHSTPWQSYIHRNDIQDIWSIT 506

Query: 492 CSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQYTYEWPE 551
           C PPL LL DPDA   L  YMDESD LYDN+ KF+YQ+ PPVFRK LRSP K+Y++EWPE
Sbjct: 507 CEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYSHEWPE 566

Query: 552 YLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592
           YL+IF+ LD  FM D+L DS Y EE RFFN+  HWD RRSG
Sbjct: 567 YLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSG 607

>CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis, hypothetical start
          Length = 612

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/598 (48%), Positives = 396/598 (66%), Gaps = 34/598 (5%)

Query: 10  LFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLIFQ 69
           +F V++  R + +LLTRT+FQADEFWQSLEPAHY AFGYGELTWEW  GLRSYAFP++F+
Sbjct: 25  IFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPMLFE 84

Query: 70  IGYTLVKYAAISCE----LIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFI 125
           I Y LVK  AI+ +    +I       +LL      P S+   E+ +++ + P E    +
Sbjct: 85  IIYRLVKLLAIASKEALSIICSIGAGLMLL----CFPQSKLATEVARDLLTIPNEYSETV 140

Query: 126 EYQGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMXXXXXXXXXXXXXXTVINFTLVAT 185
           EY GVIYAPKL MA+LAA GE+  I L +K+Y  T+               +    L+ T
Sbjct: 141 EYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQLPKLS---NITKIALLLT 197

Query: 186 VSNFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTN 245
           ++NFFNCFFITR+FINSFEMILTS++LY WDW+ G  I +  F KSL    F  +QRP+N
Sbjct: 198 LTNFFNCFFITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSN 257

Query: 246 AFIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKF 305
           A IW++LG ++ +NL+L + +  +  L  K++    I++  N+ ID+YFY  I  PV KF
Sbjct: 258 AIIWIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKF 317

Query: 306 IKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFC--SLTKK--RFLSPLVN 361
           I FN TS LS+FYGVAPW+FH+ QSLPI+ GYSLPL I+  F   S TK   RF      
Sbjct: 318 INFNFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRF-----G 372

Query: 362 PFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEF 421
              QIK V++LN+I YS + HKEFRFIYPLQP F +LS    + L  K       +   +
Sbjct: 373 ALRQIKFVLILNIIFYSYLKHKEFRFIYPLQPLFCLLSALGALKLAGK------VQNYRY 426

Query: 422 FSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHR 481
             + +WI+P++SM+ S+ ++T  ESG + VM  LH+ ++IDS+GF+MPCHSTPWQS+ HR
Sbjct: 427 LKEYVWIIPLMSMIVSIFITTFQESGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLHR 486

Query: 482 NDVKELWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSL--- 538
           ND+++LWAI+C PPLHLL   +A+ +L  YMDESDYLY+NIS F+ ++FP  F  S+   
Sbjct: 487 NDIRQLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPK-FTNSMDME 545

Query: 539 ----RSPGKQYTYEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592
                +   Q+ +EWP++L+IFE LD++FM+ YL+DS Y++  + FNS  HWD RR+G
Sbjct: 546 NVNNNASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRNG 603

>AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH]
           (418301..419914) [1614 bp, 537 aa]
          Length = 537

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 88/193 (45%), Gaps = 17/193 (8%)

Query: 254 GYMILNLVLSKRWRKLFSLLIKV---ICASFISISTNLCIDYYFYGYITIPVLKFIKFNC 310
           G M + L L+    +  S++  +   I  S + +  +  ID YF+G   +P +    FN 
Sbjct: 201 GAMCIGLALAALVARKVSVMEIIRFGIIGSGVGLGLSATIDSYFWGRSCVPEMDAFVFNV 260

Query: 311 TSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIKTVV 370
               S  +G  P   +  + LP +  +  P++  + FC +   R  S    PF  +    
Sbjct: 261 IGGQSAKWGTEPLLAYFTRYLPRL--FFPPMV--TVFC-IAGVRIAS---TPFRIVFAAS 312

Query: 371 LLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMWIL- 429
           L++++L SL PHKE+RFI    P   +L      +L     S A  R    FS  + IL 
Sbjct: 313 LIHIMLLSLQPHKEWRFIIYSVPAITLLGSMGAAYLF----SLANWRQANGFSMRILILI 368

Query: 430 -PVVSMVASMLLS 441
            P++ ++ S+L+S
Sbjct: 369 SPLLMLMHSVLMS 381

>CAGL0K09548g complement(940088..941578) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein, hypothetical start
          Length = 496

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 107/227 (47%), Gaps = 34/227 (14%)

Query: 178 INFTLVATVSNFFNCFFITRSFINSFEMILTSVSL-YYWDWTSGE----HIESFDFLKSL 232
           +N  LV  +S++    +   SF NS E IL  + L  Y D  S +     + S  FL S 
Sbjct: 120 VNEALVFILSSYITWCYQCHSFSNSLETILLLLVLSNYTDILSNKAGLLQLVSTGFLIS- 178

Query: 233 IIGTFTVLQRPTNAFIWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCI-- 290
            +GTFT +  P     +L+L    +   VL ++W ++      V+ A  +++ST++ +  
Sbjct: 179 -VGTFTRISFPA----FLLLPSIQVFLKVLYRKWIQM------VVIAVSMTLSTSIIVYF 227

Query: 291 DYYFY--GYITIPVLKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFC 348
           D + Y    I I  LK + +N        +G+ P   H+  ++P++ G  L L+I +   
Sbjct: 228 DTFMYESDEIIIAPLKNVVYNLNVDNLAKHGLHPRYTHLLVNIPLILGPGL-LMIRN--- 283

Query: 349 SLTKKRFLSPLVNPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFF 395
             TK  FL+    P L I +    ++   S + H+E RF+ P+ P F
Sbjct: 284 --TKNDFLNL---PLLSIIS----SLFFLSALRHQELRFLLPVVPLF 321

>KLLA0C08591g complement(752256..753881) similar to sp|P53730
           Saccharomyces cerevisiae YNR030w ECM39 involved in cell
           wall biogenesis and architecture singleton, start by
           similarity
          Length = 541

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 92/214 (42%), Gaps = 16/214 (7%)

Query: 248 IWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFIK 307
           + + LG +    + L+   R  F   I      F+SI     +D YF+  +T+P ++   
Sbjct: 207 VGVALGAFFYEKISLTSIVRTGF---IGAGAGIFLSIQ----VDSYFWNRLTVPEIEAFI 259

Query: 308 FNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIK 367
           FN     S  +G  P+  ++   LP++      LL++     +          N F  + 
Sbjct: 260 FNVVHGESSKWGTQPFFAYLTGYLPMMFIPPTALLLNHLGFKIGP--------NSFRVVG 311

Query: 368 TVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTR-TMEFFSQVM 426
                +V++ SL PHKE+RFI    P   +L      +L +   + + T   + F   + 
Sbjct: 312 IAAYFHVLVMSLQPHKEWRFIIYSNPPITLLGATAAAYLFKNIDNKSVTGVAVRFVLLLT 371

Query: 427 WILPVVSMVASMLLSTLHESGTVAVMDYLHSIRN 460
            +L +   +A   +ST++  G VA+ ++   I++
Sbjct: 372 PLLSLFISIAFSYISTMNYPGGVALENFNEIIKS 405

>Kwal_47.18842
          Length = 508

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 82/181 (45%), Gaps = 36/181 (19%)

Query: 278 CASFISISTNLCIDYYFYGYITIPVLKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGY 337
           CA FI + T L   Y    +   P +  + +N  +S    +G+ P   H+  ++P + G 
Sbjct: 222 CAFFIYVDTTL---YGTNDWCVAP-MNNLAYNLKNSNLAEHGLHPRYTHLLLNVPQMLG- 276

Query: 338 SLPLLIHSFFCSLTKKRFLSPLVNPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFII 397
             PLLI  FF S  ++  LS L           +  +I+ S+  H+E RF+ PL P F +
Sbjct: 277 --PLLI--FFVSRRQRINLSFLA---------CISGIIVLSMFQHQELRFLIPLLPLFCV 323

Query: 398 ---LSVFDGIWLLQKYGSTATTRTMEFFSQVMWILPVVSMVASMLLSTLHESGTVAVMDY 454
              LS FD      K+ S+             W+    +++  +++ +LH+ G V V++ 
Sbjct: 324 SVDLSNFD------KFVSSQLVNK-------AWL--AFNVIFGVIMGSLHQRGVVTVIEE 368

Query: 455 L 455
           L
Sbjct: 369 L 369

>Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement
          Length = 508

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 79/183 (43%), Gaps = 32/183 (17%)

Query: 303 LKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNP 362
           L    +N   S    +G+ P   H+  ++P + G   P LI  FF S   K  L PL++ 
Sbjct: 243 LNNFSYNMDESNLATHGLHPRYTHILFNVPQILG---PALI--FFFSRRYKLAL-PLLS- 295

Query: 363 FLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFII---LSVFDGIWLLQKYGSTATTRTM 419
                   +  +++ SL  H+E RF+ PL P F I   LS FD +   +           
Sbjct: 296 -------CISGLVILSLFKHQELRFLVPLLPLFCISMNLSNFDKVIKWEHVIK------- 341

Query: 420 EFFSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHF 479
                 +W+L   ++ + +++  LH+ G +  +D+L +  +   +      +S P   + 
Sbjct: 342 ------LWLL--FNICSGIIMGGLHQRGVILAIDHLRTSSDTAGVHVWWKTYSPPTWMYM 393

Query: 480 HRN 482
           ++N
Sbjct: 394 NKN 396

>YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein
           required for addition of the fourth mannose in
           glycosylphosphotidylinositol biosynthesis, functions in
           the protein kinase C pathway and required for plasmid
           maintenance [1551 bp, 516 aa]
          Length = 516

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 100/235 (42%), Gaps = 44/235 (18%)

Query: 196 TRSFINSFE-MILTSVSLYYWDWTSGEHIESFDFLKSLIIG---TFTVLQRPT-NAFIWL 250
           T +F NS E + L S      D  + ++I+  +F  S+I+G   +F V  R T  AFI+L
Sbjct: 138 THTFSNSIETLALISTLTVMEDMVNEKNIQRSNFKNSVILGLIFSFGVFNRVTFPAFIFL 197

Query: 251 ILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFY----GYITIPVLKFI 306
                +IL     K +R  +     ++ +   S    + ID   Y    G++  P L  +
Sbjct: 198 ---PCLIL---FWKFYRVHWKSFSLLLLSFSFSSCLFVLIDTNIYNNGKGFVITP-LNNL 250

Query: 307 KFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQI 366
           K+N      + +G+ P   H+  +LP + G   P+L+ + F      +           +
Sbjct: 251 KYNLNVQNLQVHGLHPRYTHLLVNLPQIVG---PVLLLAIFSGYKLDK-----------L 296

Query: 367 KTVVLLNVILY-SLIPHKEFRFIYPLQPFFII-------------LSVFDGIWLL 407
            T  +++ +L+ S   H+E RF+ PL P  +                +F G WLL
Sbjct: 297 STYAIISGLLFLSFFQHQELRFLVPLVPLLVTNLNWTPLSSTLVNKKIFKGTWLL 351

>Scas_606.6
          Length = 571

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 84/182 (46%), Gaps = 23/182 (12%)

Query: 281 FISISTNLCIDYYFYGYITIPVLKFIKFNCTSSLSK----FYGVAPWNFHVFQSLPIVAG 336
           FI  +  + +D  FYG  T      + +N  ++ ++     +GV  W++++   L +   
Sbjct: 227 FIITTIVIVVDSVFYGKFTPVSWNILFYNVINATNESGPNIFGVESWDYYI---LNLTIN 283

Query: 337 YSLPLLIHSFFCSLTKKRFLSPLVNPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFI 396
           + LP+L    F SL     LS        + T +L  +I++   PHKE RF+YP+ P  I
Sbjct: 284 FPLPVL----FASLIGIFHLS-----LWPLWTSLLTWMIIFINQPHKEERFLYPIYP-LI 333

Query: 397 ILSVFDGIWLLQKYGSTATTRTM----EFFSQVMWILPVVSMVASMLLSTLHESGTVAVM 452
            L    G++    +G  ++  ++     FF  V  +L  +++ A+  +  L E+ T  + 
Sbjct: 334 SLCGSVGLYHCFHFGKKSSHHSLRHIRRFFKWVTMLL--IALQATSRIVALIENYTAPIK 391

Query: 453 DY 454
            Y
Sbjct: 392 LY 393

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 30 QADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAF 64
            DE +   EP + +  G+G+ TWE+S  + +RS+AF
Sbjct: 35 DCDETFNYWEPLNLLLRGFGKQTWEYSPEYSIRSWAF 71

>Scas_714.36
          Length = 514

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 85/196 (43%), Gaps = 51/196 (26%)

Query: 306 IKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQ 365
           +K+N   S  + +G+ PW  H+  +LP + G   P++I           FL PL+   L+
Sbjct: 254 LKYNFDISNLESHGLHPWYTHILVNLPQLLG---PMII-----------FL-PLI--LLK 296

Query: 366 IKTVVLLNVILYSLI-----PHKEFRFIYPLQPFFII-LSVFDGIWLLQKYGSTATTRTM 419
             T +    I+ S++      H+EFRF+ PL P  +I L+      + Q     +  R  
Sbjct: 297 TSTTIPTLSIMSSMVTLSYFKHQEFRFLTPLVPLLLIQLAACIPNSIQQSSFKRSVIR-- 354

Query: 420 EFFSQVMWILPVVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHF 479
                ++W+L   +++ ++++   H+SG +       S+ N  S     P    P  +H 
Sbjct: 355 -----LLWVL--FNIIFAVIVGVFHQSGVI------QSLSNFSS-----PSTLEPITTH- 395

Query: 480 HRNDVKELWAITCSPP 495
                  LW  T SPP
Sbjct: 396 -------LWWKTYSPP 404

>Kwal_23.4476
          Length = 552

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 16/146 (10%)

Query: 250 LILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFIKFN 309
           L+LG  ++++ V S R         + + A  + + +   +DY FYG  T      + +N
Sbjct: 192 LVLGVPVVIHYVYSHRIMSTMKAGFRALMALALVLGSVFAVDYIFYGRFTPVAWNIVMYN 251

Query: 310 CTSSLSK----FYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQ 365
              +  K     +GV PW +++      +  + LP+L+ SF      +  L P+    + 
Sbjct: 252 VIGADEKSGPNIFGVEPWYYYILNL---LLNFPLPVLLGSFLGIANLR--LWPIWGGLVT 306

Query: 366 IKTVVLLNVILYSLIPHKEFRFIYPL 391
              +           PHKE RF+YP+
Sbjct: 307 WMAIFFQQ-------PHKEERFLYPV 325

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 10 LFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAF 64
          LF  +L  R     +       DE +   EP +++  G+G+ TWE+S  + +RS+AF
Sbjct: 11 LFSALLASRLYLQPVFSLISDCDETFNYWEPLNFLLRGFGKQTWEYSPEYSIRSWAF 67

>Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement
          Length = 551

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%)

Query: 30 QADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAFPLIFQIGYTLVK 76
            DE +   EP + +  G+G+ TWE+S  + +RS+AF L F   YT++K
Sbjct: 30 DCDETFNYWEPLNVLVRGFGKQTWEYSPEYSIRSWAFLLPF---YTILK 75

>KLLA0D19404g 1632929..1634590 similar to sp|P53868 Saccharomyces
           cerevisiae YNL219c ALG9 mannosyltransferase singleton,
           start by similarity
          Length = 553

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 23/173 (13%)

Query: 289 CIDYYFYGYITIPVLKFIKFNCTS----SLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIH 344
            ID +FYG +++     + +N  S    S    +GV PW +++   L       L   I 
Sbjct: 231 AIDSFFYGKLSVVPFNIVMYNIISANEDSGPNIFGVEPWYYYIQNLL-------LNFPIT 283

Query: 345 SFFCSLTKKRFLS--PLVNPFLQIKTVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFD 402
           + F  +     LS  PL          + LNV L    PHKE RF+YP+   + I+S+  
Sbjct: 284 TLFFGVIGFTQLSIWPLSGSLF-----IWLNVFLAQ--PHKEERFLYPI---YGIISLLA 333

Query: 403 GIWLLQKYGSTATTRTMEFFSQVMWILPVVSMVASMLLSTLHESGTVAVMDYL 455
            + L     S    +  +    +++ + ++   + +L  T + +  + V  +L
Sbjct: 334 AVGLFNITVSIRWKKLRKLVRGIVFFVTLLQAASRILALTNNYTSPIQVYSHL 386

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 30 QADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAFPL 66
            DE +   EP + +  G+G+ TWE+S  + +RS+AF L
Sbjct: 35 DCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLL 73

>KLLA0C06567g complement(573595..575187) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein singleton, start by similarity
          Length = 530

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 79/212 (37%), Gaps = 64/212 (30%)

Query: 318 YGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIKTVVLL----- 372
           +G+ P   H+  +LP++ G                     P++  F+  K V+ L     
Sbjct: 285 HGLHPRYTHLLINLPLICG---------------------PIILLFISQKAVLKLPALSC 323

Query: 373 --NVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMWILP 430
              +++ SL  H+E RFI P+ P        D      +  +  T+          W+  
Sbjct: 324 ISGILMLSLFRHQELRFIIPVLPLLCASMNLDNFDTFFQAETIITS----------WL-- 371

Query: 431 VVSMVASMLLSTLHESGTVAVMDYLHSIRNIDSIGFIMPCHSTPWQSHFHRNDVKELWAI 490
           V ++V  +++   H++G + ++ Y          G   P H               +W  
Sbjct: 372 VFNIVMGLIMGVFHQAGIIPLISYFS--------GEEFPVH---------------IWWK 408

Query: 491 TCSPPLHLLTDPDANAKLPFYMDESDYLYDNI 522
           T SPP  + ++PD       + +  +++ DNI
Sbjct: 409 TYSPPTWMYSNPDLTVSTTNFKENVEFV-DNI 439

>YNL219C (ALG9) [4385] chr14 complement(235995..237662)
          Mannosyltransferase involved in N-glycosylation,
          catalyzes transfer of mannose from Dol-P-Man to
          lipid-linked oligosaccharides [1668 bp, 555 aa]
          Length = 555

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 30 QADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAFPLIF 68
            DE +   EP + +  G+G+ TWE+S  + +RS+AF L F
Sbjct: 30 DCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLLPF 70

>ABL185C [407] [Homologous to ScYNL219C (ALG9) - SH]
          (60000..61658) [1659 bp, 552 aa]
          Length = 552

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 30 QADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAFPLIFQI 70
            DE +   EP + +  G+G+ TWE+S  + +RS+AF +  Q+
Sbjct: 30 DCDETFNYWEPLNLLVRGFGKQTWEYSPEYSIRSWAFLMPLQV 72

>Scas_562.5
          Length = 712

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 51  LTWEWSFGLRSYAFPLIFQIGYTLVKYAAIS--CELIVQTATDWVLLF 96
           L W W +G+  Y   +I  +G+ ++    IS    L+VQT T WV +F
Sbjct: 529 LIWRWKYGIVKYNSEIISIMGF-IMSLVTISYQVHLVVQTLTKWVEMF 575

>Scas_610.14
          Length = 462

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query: 441 STLHESGTVAVMDYLH-SIRNIDSIGFIMPCHSTPWQSHFH---RNDVKELWAITCSPPL 496
           S  +E+ T A  D     I+  ++   + P   T     F    R+ +K+LW +  S   
Sbjct: 187 SNDNENDTDADKDRKDLPIKKGNAASAVSPKQKTRTIQTFPPEIRDILKKLWNLRSSQ-- 244

Query: 497 HLLTDPDANAKLPFY-MDESDYLYDNISKFMYQHFPPVFRKSLRSPGK 543
            L+  P+ ++   FY MD + Y  DNI +   + + P  +  LRS  K
Sbjct: 245 KLINSPERSS---FYLMDSAKYFMDNIDRITEKDYVPTLQDILRSRQK 289

>CAGL0K05005g 484817..486493 similar to sp|P53868 Saccharomyces
          cerevisiae YNL219c ALG9, start by similarity
          Length = 558

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 6/62 (9%)

Query: 13 VILVIRCVQALLTRTFF----QADEFWQSLEPAHYMAFGYGELTWEWS--FGLRSYAFPL 66
          V++V+     L  + F+      DE +   EP + +  G+G+ TWE+S  + +RS++F L
Sbjct: 9  VLVVLLVATRLYIQPFYSLISDCDETFNYWEPLNLLLRGFGKQTWEYSPEYSIRSWSFLL 68

Query: 67 IF 68
           F
Sbjct: 69 PF 70

>Sklu_2173.4 YNR030W, Contig c2173 5182-6813 reverse complement
          Length = 543

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 374 VILYSLIPHKEFRF-IYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMWILPVV 432
           + + S+ PHKE+RF IY + P  ++ S  +G   L  Y  T + ++ +F    + + PVV
Sbjct: 320 IFILSIQPHKEWRFIIYSVPPITLLGS--NGASHLFGYLDTKSFKS-KFICFCLALSPVV 376

Query: 433 SMVASML---LSTLHESGTVAVMDY 454
           S   SM+   +S+L+ +G  A+  +
Sbjct: 377 SFAISMIFLYISSLNYAGGNALQQF 401

>CAGL0M10769g 1074047..1075735 similar to sp|P53730 Saccharomyces
           cerevisiae YNR030w involved in cell wall biogenesis and
           architecture, start by similarity
          Length = 562

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 62/153 (40%), Gaps = 36/153 (23%)

Query: 279 ASFISISTNLCIDYYFYGYITIPVLKFIKFNCTSSLSKFYGVAPWNFHVFQSLPIVAGYS 338
            + I+I  ++ ID YF+G   IP +    FN     S     A W            G  
Sbjct: 239 GAGIAIGISMSIDSYFWGDWGIPEVDAFIFNVVYGKS-----AQW------------GTE 281

Query: 339 LPLLIHSFFCSLTKKRFLSP--LVNPFL-------QIKTVVL---LNVILYSLIPHKEFR 386
            PL   ++F +  +  FL P  LV  ++        +K V L    +++  S  PHKE+R
Sbjct: 282 SPL---AYFTNYLRMLFLPPTVLVLNYIGYRAAPKNLKIVTLAGYFHILAMSTQPHKEWR 338

Query: 387 FIYPLQPFFIILSVFDGIWLLQKYGSTATTRTM 419
           FI    P  I+L      +L + +      RTM
Sbjct: 339 FIIYSVPPIIMLGSAGAAYLWENF----KVRTM 367

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.142    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,953,969
Number of extensions: 819674
Number of successful extensions: 2434
Number of sequences better than 10.0: 35
Number of HSP's gapped: 2460
Number of HSP's successfully gapped: 41
Length of query: 592
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 485
Effective length of database: 12,891,983
Effective search space: 6252611755
Effective search space used: 6252611755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)