Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E11341g28928514950.0
Sklu_2177.42882859331e-127
Kwal_27.125772882859161e-125
ADL319W2892858971e-122
YBR101C (FES1)2902878841e-120
Scas_718.82922898341e-112
CAGL0K12144g2912867493e-99
AFR269W1018165790.078
CAGL0M13871g109180750.20
YPL243W (SRP68)599103681.3
ADL022C3392120663.1
Scas_693.1121657635.8
ADR064C783103627.2
Kwal_26.9550109283628.0
YHR107C (CDC12)40745618.2
ADR368W50143618.4
ABL124W48591618.7
CAGL0A00385g106965628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E11341g
         (285 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E11341g 999242..1000111 similar to sp|P38260 Saccharomyces ...   580   0.0  
Sklu_2177.4 YBR101C, Contig c2177 5523-6389 reverse complement        363   e-127
Kwal_27.12577                                                         357   e-125
ADL319W [1422] [Homologous to ScYBR101C - SH] complement(135162....   350   e-122
YBR101C (FES1) [290] chr2 complement(443778..444650) Protein inv...   345   e-120
Scas_718.8                                                            325   e-112
CAGL0K12144g complement(1187185..1188060) similar to sp|P3826 Sa...   293   3e-99
AFR269W [3461] [Homologous to ScYGL241W (KAP114) - SH] complemen...    35   0.078
CAGL0M13871g complement(1368745..1372020) highly similar to sp|P...    33   0.20 
YPL243W (SRP68) [5207] chr16 (88517..90316) Signal recognition p...    31   1.3  
ADL022C [1720] [Homologous to ScYLL021W - SH; ScYLR313C - SH] (6...    30   3.1  
Scas_693.1                                                             29   5.8  
ADR064C [1805] [Homologous to ScYPR029C (APL4) - SH] (818939..82...    28   7.2  
Kwal_26.9550                                                           28   8.0  
YHR107C (CDC12) [2395] chr8 complement(326815..328038) Septin, c...    28   8.2  
ADR368W [2109] [Homologous to ScYAL038W (CDC19) - SH; ScYOR347C ...    28   8.4  
ABL124W [468] [Homologous to ScYML115C (VAN1) - SH] complement(1...    28   8.7  
CAGL0A00385g complement(37162..40371) similar to sp|P32767 Sacch...    28   8.8  

>KLLA0E11341g 999242..1000111 similar to sp|P38260 Saccharomyces
           cerevisiae YBR101c singleton, start by similarity
          Length = 289

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60
           MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN
Sbjct: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60

Query: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120
           KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ
Sbjct: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120

Query: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180
           NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV
Sbjct: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180

Query: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240
           LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV
Sbjct: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240

Query: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ
Sbjct: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285

>Sklu_2177.4 YBR101C, Contig c2177 5523-6389 reverse complement
          Length = 288

 Score =  363 bits (933), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 225/285 (78%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60
           MEKLLHWSIANA GD EA  +AGQPDPKLL+QLFG GPDEP LMK A+ VI+NPEA LEN
Sbjct: 1   MEKLLHWSIANANGDKEAIEKAGQPDPKLLQQLFGSGPDEPALMKQAILVITNPEAELEN 60

Query: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120
           KL+AFDNFEMLIENLDNANNIEN+KLWEPLI+VL   E ELRAFALSV GTAVQNN +SQ
Sbjct: 61  KLIAFDNFEMLIENLDNANNIENLKLWEPLISVLKSNEEELRAFALSVIGTAVQNNTKSQ 120

Query: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180
            NF KY+  L  VI++A    E   VRTKAFY LSNLIRHN  +Y++F  L GL+II+PV
Sbjct: 121 ENFLKYEDGLPGVIEIAGNAKEVPAVRTKAFYALSNLIRHNSDVYEKFVSLGGLEIISPV 180

Query: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240
           L D  +++KLK+R +ALL+ VLT  + NA F  +LR   IIE+TL+FL P+  LY+IDRV
Sbjct: 181 LGDETSNDKLKMRVLALLAAVLTAVEFNASFVEVLRKDGIIESTLDFLVPDGGLYIIDRV 240

Query: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           LNF SQLI+ GF+F+  E+ KL+ G +NIE ++ +LNEDDY+TV+
Sbjct: 241 LNFLSQLISFGFKFNKQEMSKLRQGYENIESLKDRLNEDDYQTVR 285

>Kwal_27.12577
          Length = 288

 Score =  357 bits (916), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 217/285 (76%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60
           MEKLLHWS+AN+QGD EA A+ GQPDPK+L+QLFGGGPDEP LMK A+ V SNPEATL+ 
Sbjct: 1   MEKLLHWSVANSQGDKEAAAKIGQPDPKVLQQLFGGGPDEPALMKQAIVVASNPEATLDA 60

Query: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120
           KLVA DNFEMLIENLDNANNIEN+KLW P++ ++ DPE E+RA ALS+ GTAVQNN++SQ
Sbjct: 61  KLVALDNFEMLIENLDNANNIENLKLWNPILELISDPEAEIRALALSIVGTAVQNNEKSQ 120

Query: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180
           NNF  Y+  L+K+IK+A    E A VR KAFY LSNL+RHNK   ++   L GL II  V
Sbjct: 121 NNFLSYEQGLSKIIKIAQDGNEKAAVRAKAFYALSNLVRHNKTSSEKLKALGGLDIITAV 180

Query: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240
           LKD +A++KLKLR +A L+ ++T  +++      LR   I+E+TL++L+ + ++Y++DRV
Sbjct: 181 LKDESATDKLKLRVLAYLTAIMTANEISESLVIALRTKEIVESTLKYLNAQSSVYVVDRV 240

Query: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           LNF S LI+ G  F+  EL  LK G+ +IE +  +LNEDDY+TV+
Sbjct: 241 LNFLSHLISSGVAFTENELTALKAGIADIEQMRERLNEDDYQTVK 285

>ADL319W [1422] [Homologous to ScYBR101C - SH]
           complement(135162..136031) [870 bp, 289 aa]
          Length = 289

 Score =  350 bits (897), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/285 (60%), Positives = 213/285 (74%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLEN 60
           M+KLLHWSIANAQGD EA A+AG PDPKLL+QLFGGGPDEP LM+ AMAVI NPEAT++N
Sbjct: 1   MDKLLHWSIANAQGDKEAAAKAGAPDPKLLQQLFGGGPDEPALMRDAMAVIMNPEATVDN 60

Query: 61  KLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQ 120
           KLVAFDNFEMLIENLDNANNIENM+LW PLI++L+  E +LR  ALSV GTAVQNN++SQ
Sbjct: 61  KLVAFDNFEMLIENLDNANNIENMRLWAPLISILESEEEQLRECALSVVGTAVQNNEKSQ 120

Query: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180
           +NF K+DGA+ K+I+LA   +E  QVRTKAFY LSN++RHNK     F    GL+I+APV
Sbjct: 121 SNFLKHDGAMKKIIELARKDSESEQVRTKAFYALSNIVRHNKDASALFVDNGGLEIMAPV 180

Query: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDRV 240
           LK  N  EK+K+RA+ALL++VLT    +  F   +R   I+E +LE L P  N YLIDRV
Sbjct: 181 LKHQNTGEKMKIRALALLTSVLTSLSADEKFSDRIREDKILEASLEHLAPSANPYLIDRV 240

Query: 241 LNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           LN    +   G +F   EL K++    ++ PV+ QLNEDDY  V+
Sbjct: 241 LNLLVLMKGSGAKFDTDELSKIRKSFASLYPVKDQLNEDDYNAVK 285

>YBR101C (FES1) [290] chr2 complement(443778..444650) Protein
           involved in resistance to H2O2 [873 bp, 290 aa]
          Length = 290

 Score =  345 bits (884), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 178/287 (62%), Positives = 218/287 (75%), Gaps = 2/287 (0%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGG-PDEPTLMKHAMAVISNPEATLE 59
           MEKLL WSIAN+QGD EA ARAGQPDPKLL+QLFGGG PD+PTLMK +MAVI NPE  LE
Sbjct: 1   MEKLLQWSIANSQGDKEAMARAGQPDPKLLQQLFGGGGPDDPTLMKESMAVIMNPEVDLE 60

Query: 60  NKLVAFDNFEMLIENLDNANNIENMKLWEPLITVL-DDPEPELRAFALSVTGTAVQNNDQ 118
            KLVAFDNFEMLIENLDNANNIEN+KLWEPL+ VL    + ELRA ALS+ GTAVQNN  
Sbjct: 61  TKLVAFDNFEMLIENLDNANNIENLKLWEPLLDVLVQTKDEELRAAALSIIGTAVQNNLD 120

Query: 119 SQNNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIA 178
           SQNNF KYD  L  +I++AS + +   VRTKAFY LSNLIR++K I ++F +LNGL  IA
Sbjct: 121 SQNNFMKYDNGLRSLIEIASDKTKPLDVRTKAFYALSNLIRNHKDISEKFFKLNGLDCIA 180

Query: 179 PVLKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLID 238
           PVL D  A  KLK+RA+ALL+  L+   ++ +  ++LR   +IE+T+E L  E NL +ID
Sbjct: 181 PVLSDNTAKPKLKMRAIALLTAYLSSVKIDENIISVLRKDGVIESTIECLSDESNLNIID 240

Query: 239 RVLNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           RVL+F S LI+ G +F+  EL KL  G K+IEP++ +LNEDDY  V+
Sbjct: 241 RVLSFLSHLISSGIKFNEQELHKLNEGYKHIEPLKDRLNEDDYLAVK 287

>Scas_718.8
          Length = 292

 Score =  325 bits (834), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 161/289 (55%), Positives = 216/289 (74%), Gaps = 4/289 (1%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGG----GPDEPTLMKHAMAVISNPEA 56
           MEKLLHWSIANAQGD EA A+AGQPDP+LL+QLFGG    GPD+PTLMK  M VI NP+ 
Sbjct: 1   MEKLLHWSIANAQGDKEAIAKAGQPDPRLLQQLFGGAGSSGPDDPTLMKEQMEVIMNPDV 60

Query: 57  TLENKLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNN 116
            L+ KLVA DNFEMLIENLDNANNIEN+KLW+P++ +L+  E EL + ALS+ GT+VQNN
Sbjct: 61  ELDIKLVAIDNFEMLIENLDNANNIENLKLWDPILKILEFEEDELVSQALSIIGTSVQNN 120

Query: 117 DQSQNNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQI 176
             SQ+ F K++  L KVI+LA+ +++  +VRTKA Y LSNL+R+++ +  +F +LNGL I
Sbjct: 121 TNSQDKFLKHENGLNKVIQLANDKSQSFEVRTKALYALSNLVRNHEHMATKFRELNGLDI 180

Query: 177 IAPVLKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYL 236
           I P+L D  A  KLK+RA+ALL+  LT  +++    + +R    IE T++ L+ E +L L
Sbjct: 181 IPPILNDPKAKTKLKMRAIALLTAFLTSTEISESLISDMRKDGTIEATIDCLNSETDLNL 240

Query: 237 IDRVLNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           IDRVLN  +QLI+ G +F+  E+EKLK G + +EP++ +LNEDDY TV+
Sbjct: 241 IDRVLNLLAQLISAGIKFNQVEMEKLKTGFQKVEPLKDRLNEDDYLTVK 289

>CAGL0K12144g complement(1187185..1188060) similar to sp|P3826
           Saccharomyces cerevisiae YBR101c, start by similarity
          Length = 291

 Score =  293 bits (749), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 202/286 (70%), Gaps = 2/286 (0%)

Query: 1   MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGG-PDEPTLMKHAMAVISNPEATLE 59
           MEKLLHWSIANAQGD EA  +AG PDPKLLEQLFGGG PD+PTLMK AMAVI NPEA LE
Sbjct: 1   MEKLLHWSIANAQGDKEAIEKAGAPDPKLLEQLFGGGGPDDPTLMKEAMAVIMNPEADLE 60

Query: 60  NKLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQS 119
           NKL+A+DNFEMLIENLDNANNIENMKLWEP++  L+D E +LRA  LSV GTAVQNN  S
Sbjct: 61  NKLIAYDNFEMLIENLDNANNIENMKLWEPILKTLEDNEADLRASGLSVIGTAVQNNTDS 120

Query: 120 QNNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAP 179
           Q NF KY+G L  +I +A    E + VR KAFY LSNL+R++     +F  L GL +   
Sbjct: 121 QTNFLKYEGGLKILIAIAKSSEEPSDVRIKAFYALSNLLRNHIEAGKKFQALGGLDVFPV 180

Query: 180 VLKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIETTLEFLHPECNLYLIDR 239
            L D  A+ KLK+RA++ LS  L+ + ++      LR   ++ + +E L  + N+ +IDR
Sbjct: 181 ALNDPKATPKLKMRAISALSAFLSSSKIDEQLLDTLRKDGVLVSVIENLGTD-NVNVIDR 239

Query: 240 VLNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQLNEDDYKTVQ 285
           VL+  S LI+ G +F+ +ELE L+   + I+ ++ +LNEDDY  V+
Sbjct: 240 VLSVLSHLISSGIKFNDSELEMLQKEFEKIDSLKDRLNEDDYLAVK 285

>AFR269W [3461] [Homologous to ScYGL241W (KAP114) - SH]
           complement(916449..919505) [3057 bp, 1018 aa]
          Length = 1018

 Score = 35.0 bits (79), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 72/165 (43%), Gaps = 15/165 (9%)

Query: 19  KARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLENK------LVAFDNFEMLI 72
           + R     P+LLE+     P+   L++  + +  N   T EN+      L+AF  +   +
Sbjct: 472 RCRVAMTVPRLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFV 531

Query: 73  E-----NLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQNNFAK-Y 126
           +      +  A  +E + L   +  +LD  + +   F L V       N +S+N   K Y
Sbjct: 532 DFGSVLGVQTAEELEKLVL-STIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLY 590

Query: 127 DGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQL 171
           +  L  V  +A+    + QV  +A   L NL++++   Y Q+ +L
Sbjct: 591 E--LQLVQNVATADPSNIQVVVEAQECLKNLLQYDPENYLQYAEL 633

>CAGL0M13871g complement(1368745..1372020) highly similar to
           sp|P32337 Saccharomyces cerevisiae YMR308c PSE1 beta
           karyopherin, start by similarity
          Length = 1091

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 86  LWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQNNFAKYDGALAKVIKLASGRAEDAQ 145
           LW  +IT L+D E     FAL V G  VQ   +   NF   D    K+++     + DA 
Sbjct: 862 LWPLIITFLNDSESMNIIFALVVVGDMVQYGGEKSANFK--DSIAPKIVEYLV--SPDAS 917

Query: 146 VRTKAFYTLSNLIRHNKLIY 165
           VR  A + L     +    Y
Sbjct: 918 VRQAAAFVLGTCAEYAPTTY 937

>YPL243W (SRP68) [5207] chr16 (88517..90316) Signal recognition
           particle core subunit [1800 bp, 599 aa]
          Length = 599

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 10/103 (9%)

Query: 118 QSQNNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQII 177
           ++ ++FAKY   L K ++    R       TK + + +     N   YD   +L G+ I+
Sbjct: 20  ETDSDFAKYHAKLNKKLQHLRSRCHLVTKDTKKYSSKNKYGEINSEDYDNKTKLIGVLIL 79

Query: 178 APVLKDANASEKLKLRAM----------ALLSTVLTVADMNAD 210
               +D   +E LKLRA            +LST L  A   AD
Sbjct: 80  LHAERDLALAETLKLRARQRGKLKKSEEKVLSTRLKKACKTAD 122

>ADL022C [1720] [Homologous to ScYLL021W - SH; ScYLR313C - SH]
           (660330..670508) [10179 bp, 3392 aa]
          Length = 3392

 Score = 30.0 bits (66), Expect = 3.1,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 169 NQLNGLQIIAPVLKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNI-IETTLEF 227
           NQLN L I    LK +NA   LKL+ +    + +T + +N    +  ++ N+ IE+  +F
Sbjct: 533 NQLNDLSIENETLKQSNAELTLKLKRI----SNITASPLNIFIPSSSKSTNVAIESISKF 588

Query: 228 LHPE------------CNLYLIDRVLNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQ 275
           + PE              L L+ + LN   Q  NV FE  A   E ++  +  + P + Q
Sbjct: 589 ISPEGSIPLPLIKSFNSKLELVFKHLNQGEQTGNVLFEDIAQVSEVVEHMLNLVSPSDYQ 648

>Scas_693.1
          Length = 1216

 Score = 28.9 bits (63), Expect = 5.8,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 46  HAMAVISNPEATLENKLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELR 102
           H ++  S PE  L N+ +    F M +EN   +   EN +   PL+ V+++ E  LR
Sbjct: 494 HQLSQQSKPEPQLRNESITEPIFHMKLENTSGSQE-ENTQT-APLVPVIEEVEENLR 548

>ADR064C [1805] [Homologous to ScYPR029C (APL4) - SH]
           (818939..821290) [2352 bp, 783 aa]
          Length = 783

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 121 NNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQLNGLQIIAPV 180
           +N ++Y G L  V+      AE ++  T            N ++Y+    +  L++    
Sbjct: 272 DNVSRYSGKLVSVLSSLCSHAEQSKNGT------------NAILYEAVRTIFALKL---- 315

Query: 181 LKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAYNIIET 223
                   KL+++A+ +L+  LT  D+N  + AL     ++ T
Sbjct: 316 ------EHKLRIQAIDILAIFLTSKDINNKYVALNMLTQVVST 352

>Kwal_26.9550
          Length = 1092

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 85  KLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQNNFAKYDGALAKVIKLASGRAEDA 144
            LW  + T L D E  L  FAL   G  V+    +   F   D  + +V +     + +A
Sbjct: 862 SLWPLISTYLRDSEVILTLFALCAIGDMVETAGPATEMFK--DSFINEVKEYLV--SPEA 917

Query: 145 QVRTKAFYTLSNLIRHNKLIYDQ 167
            +R  A Y +    +H++ +Y Q
Sbjct: 918 SIRQAASYVIGVCAQHSRSVYAQ 940

>YHR107C (CDC12) [2395] chr8 complement(326815..328038) Septin,
           component of 10 nm filaments of mother-bud neck;
           involved in cytokinesis [1224 bp, 407 aa]
          Length = 407

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 55  EATLENKLVAFDNFEMLIENLDN---ANNIENMKLWEPLITVLDD 96
           E  +   L+   +FE+ +  +D     +N+ N K W+PL+  +DD
Sbjct: 77  EIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDD 121

>ADR368W [2109] [Homologous to ScYAL038W (CDC19) - SH; ScYOR347C
           (PYK2) - SH] complement(1360707..1362212) [1506 bp, 501
           aa]
          Length = 501

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 6/43 (13%)

Query: 75  LDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNND 117
           +DNA   E +    PL   LD   PE+R      TGT V N D
Sbjct: 65  IDNARKSEELYPGRPLAIALDTKGPEIR------TGTTVDNVD 101

>ABL124W [468] [Homologous to ScYML115C (VAN1) - SH]
           complement(162891..164348) [1458 bp, 485 aa]
          Length = 485

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 6/91 (6%)

Query: 42  TLMKHAMAVISNPEATLENKLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPEL 101
           TL+   +      E  L ++ V  +  E+ ++  D+    E    WEP   VLDDPE   
Sbjct: 19  TLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAE----WEP--QVLDDPEYYD 72

Query: 102 RAFALSVTGTAVQNNDQSQNNFAKYDGALAK 132
             FA +      + ++  ++ F   DG +++
Sbjct: 73  YEFAAASAERLAKYDEGFEHYFVTRDGQISR 103

>CAGL0A00385g complement(37162..40371) similar to sp|P32767
           Saccharomyces cerevisiae YGL016w PDR6, start by
           similarity
          Length = 1069

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 106 LSVTGTAVQNNDQSQNNF-AKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLI 164
           LS+   ++ NN+ S+N+F A ++  L  +I L+   ++ +  +   +Y  +N    +K+I
Sbjct: 119 LSILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDKII 178

Query: 165 YDQFN 169
            D  N
Sbjct: 179 LDTIN 183

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,260,416
Number of extensions: 384301
Number of successful extensions: 1332
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1327
Number of HSP's successfully gapped: 37
Length of query: 285
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 185
Effective length of database: 13,134,309
Effective search space: 2429847165
Effective search space used: 2429847165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)