Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09812g50249426220.0
Kwal_33.1543450550021240.0
Sklu_2014.150649920930.0
Scas_647.251150320880.0
YJR010W (MET3)51150320490.0
CAGL0B03839g50750120340.0
AGR322W50049617550.0
KLLA0B02827g94242740.67
YJL187C (SWE1)81961711.3
CAGL0J06248g1764204711.4
AFR405W24441682.3
KLLA0D18029g24454646.9
CAGL0L04400g987135658.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09812g
         (494 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09812g complement(870664..872172) highly similar to sp|P08...  1014   0.0  
Kwal_33.15434                                                         822   0.0  
Sklu_2014.1 YJR010W, Contig c2014 195-1715                            810   0.0  
Scas_647.2                                                            808   0.0  
YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase (su...   793   0.0  
CAGL0B03839g 380291..381814 highly similar to sp|P08536 Saccharo...   788   0.0  
AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH] complement(...   680   0.0  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    33   0.67 
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    32   1.3  
CAGL0J06248g complement(589039..594333) similar to sp|P53886 Sac...    32   1.4  
AFR405W [3597] [Homologous to ScYDR405W (MRP20) - SH] complement...    31   2.3  
KLLA0D18029g join(1521909..1521950,1522143..1522835) highly simi...    29   6.9  
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    30   8.0  

>KLLA0E09812g complement(870664..872172) highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3 sulfate
           adenylyltransferase singleton, start by similarity
          Length = 502

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/494 (100%), Positives = 494/494 (100%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL
Sbjct: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
           NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV
Sbjct: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR
Sbjct: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
           LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK
Sbjct: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPAQLKTALLSTFLQYG 420
           LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPAQLKTALLSTFLQYG
Sbjct: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPAQLKTALLSTFLQYG 420

Query: 421 GGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNASSLKGTNVFKIGEESGSDIPLETED 480
           GGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNASSLKGTNVFKIGEESGSDIPLETED
Sbjct: 421 GGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNASSLKGTNVFKIGEESGSDIPLETED 480

Query: 481 KNILHIVQRVVLFL 494
           KNILHIVQRVVLFL
Sbjct: 481 KNILHIVQRVVLFL 494

>Kwal_33.15434
          Length = 505

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/500 (78%), Positives = 437/500 (87%), Gaps = 9/500 (1%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           MP+PHGG+LQDL+ARDA  K +LLE A    +T W LTARQICDLELI NGGFSPL GFL
Sbjct: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKIT-WDLTARQICDLELIQNGGFSPLSGFL 59

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
           NQ+DY+SVV  SRL N LVWTIPITLDVDAEFA QL P+ R+ LLQDNE P+AILTV+DV
Sbjct: 60  NQKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDV 119

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           Y+PDK VEAKKVFRGDPEHPAVKYL E AGE+YVGG ++AIQ PVHYDYPG RKTPAQLR
Sbjct: 120 YKPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLR 179

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
           LEFESKQWDR+VAFQTRNPMHRAHRELTVRAAR +N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 180 LEFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVR 239

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPGKNS 
Sbjct: 240 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSA 299

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           GVDFYG YDAQELVE+YK+ELDIEVVPFRMVTYLPDEDRYAPID+ID   T+TLNISGTE
Sbjct: 300 GVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTE 359

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLP--AQLKTALLSTFLQ 418
           LRNRLR GG IP WFSYPEVVKILRESNP RP+QGFA+VLS  L    QL TALLSTFLQ
Sbjct: 360 LRNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQ 419

Query: 419 YGGGRHYKVLEHGNNEEILALVPDFVRSGTGLIL----QNASSLKGTNVFKIGEESGSDI 474
           +GGGRHYKVLEH +   +L LVPDF+RSG GLI+    +NAS+   TN +++G   G+DI
Sbjct: 420 FGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASAT--TNAYQVGTSDGADI 477

Query: 475 PLETEDKNILHIVQRVVLFL 494
            LE+ D+++LH+VQ+VVLFL
Sbjct: 478 KLESNDESVLHVVQKVVLFL 497

>Sklu_2014.1 YJR010W, Contig c2014 195-1715
          Length = 506

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/499 (78%), Positives = 436/499 (87%), Gaps = 6/499 (1%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           MP+PHGGVLQDL+ARDAS K +LL+ A    LT WSLT RQICDLELILNGGFSPL GFL
Sbjct: 1   MPAPHGGVLQDLIARDASIKPQLLQEASDSKLT-WSLTGRQICDLELILNGGFSPLTGFL 59

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
           N++DY SVV  SRL NGLVWT+PITLDVD+EFAS+L  D RI+LLQ+NE PLA LTV+DV
Sbjct: 60  NEKDYTSVVNDSRLSNGLVWTMPITLDVDSEFASKLQIDDRILLLQENEIPLAFLTVTDV 119

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           Y+PDK+VEAKKVFRGDPEHPA+ YL   AGE+YVGG L+AIQLP HYDYPG R+TPAQLR
Sbjct: 120 YKPDKSVEAKKVFRGDPEHPAISYLNNIAGEYYVGGELQAIQLPQHYDYPGLRRTPAQLR 179

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
           LEF+SKQWDR+VAFQTRNPMHRAHRELTVRAAR  N+KILIHPVVGLTKPGDIDHHTRVR
Sbjct: 180 LEFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREQNAKILIHPVVGLTKPGDIDHHTRVR 239

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNGMA LSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPGKNSK
Sbjct: 240 VYQEIIKRYPNGMAHLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSK 299

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           GVDFYG YDAQELVESYKNEL+IEVVPFRMVTYLPDEDRYAPID+ID   T+TLNISGTE
Sbjct: 300 GVDFYGAYDAQELVESYKNELEIEVVPFRMVTYLPDEDRYAPIDQIDLATTKTLNISGTE 359

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLP--AQLKTALLSTFLQ 418
           LRNRLRDGGEIPAWFSYPEVVKILRES+P RP QGFA+VL ++L    QL  ALLSTFLQ
Sbjct: 360 LRNRLRDGGEIPAWFSYPEVVKILRESSPPRPNQGFAVVLDDSLKNNKQLSIALLSTFLQ 419

Query: 419 YGGGRHYKVLEH-GNNEEILALVPDFVRSGTGLIL--QNASSLKGTNVFKIGEESGSDIP 475
           +GGGRHYK+  H  NNEE++ L+PDF+RSG GLI+  Q   S   TNVF +G    ++I 
Sbjct: 420 FGGGRHYKIFNHSNNNEELVELIPDFIRSGAGLIVPGQFNGSSDATNVFTVGVADDAEIK 479

Query: 476 LETEDKNILHIVQRVVLFL 494
           LE+ED+ ILH+VQ+VVLFL
Sbjct: 480 LESEDEPILHVVQKVVLFL 498

>Scas_647.2
          Length = 511

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/503 (76%), Positives = 438/503 (87%), Gaps = 9/503 (1%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           MP+PHGG+LQDLVARDASKKA L + AQSG L  W+LTARQICD+ELILNGGFSPL GFL
Sbjct: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
            ++DY SVV+ SRL +G +WT+PITLDVD  FA  ++P+ RI LLQD E P+AILTV+DV
Sbjct: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           Y+PDKA+EAK+VFRGDPEHPA++YL   AGE+Y+GGSLEAIQLP HYDYPG RK PAQLR
Sbjct: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDR+VAFQTRNPMHRAHRELTVRAAR  N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKNELDI+VVPFRMVTYLPDEDRYAPID+IDT KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPA---QLKTALLSTFL 417
           LR RLR GGEIP WFSYPEVVKILRESNP RPKQGFA+VL ++L A   QL  ALLSTFL
Sbjct: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420

Query: 418 QYGGGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNASSLKGT------NVFKIGEESG 471
           Q+GGGRHYKV EH NN+++L L+PDF+++G+GLI+ N  + K        NV+ +G  + 
Sbjct: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480

Query: 472 SDIPLETEDKNILHIVQRVVLFL 494
           SDI L++ D+ I HIVQ+VVLFL
Sbjct: 481 SDIKLDSVDETIFHIVQKVVLFL 503

>YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase
           (sulfate adenylyltransferase), catalyzes incorporation
           of inorganic sulfate into ATP to form adenosine
           5'-phosphosulfate (APS) [1536 bp, 511 aa]
          Length = 511

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/503 (75%), Positives = 429/503 (85%), Gaps = 9/503 (1%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           MP+PHGG+LQDL+ARDA KK ELL  AQS D+  W+LT RQ+CD+ELILNGGFSPL GFL
Sbjct: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
           N+ DY SVV  SRL +G +WTIPITLDVD  FA+Q+ PD RI L QD+E P+AILTV DV
Sbjct: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           Y+P+K +EA+KVFRGDPEHPA+ YLF  AG++YVGGSLEAIQLP HYDYPG RKTPAQLR
Sbjct: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDRVVAFQTRNPMHRAHRELTVRAAR  N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRM GDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           GVDFYGPYDAQELVESYK+ELDIEVVPFRMVTYLPDEDRYAPID+IDT KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPA---QLKTALLSTFL 417
           LR RLR GGEIP WFSYPEVVKILRESNP RPKQGF++VL  +L     QL  ALLSTFL
Sbjct: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420

Query: 418 QYGGGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNA------SSLKGTNVFKIGEESG 471
           Q+GGGR+YK+ EH N  E+L+L+ DF+ SG+GLI+ N       S +   NV+ +   S 
Sbjct: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480

Query: 472 SDIPLETEDKNILHIVQRVVLFL 494
           +DI LE+ D+ I HIVQ+VVLFL
Sbjct: 481 ADIQLESADEPISHIVQKVVLFL 503

>CAGL0B03839g 380291..381814 highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3, start by
           similarity
          Length = 507

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/501 (74%), Positives = 429/501 (85%), Gaps = 9/501 (1%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           MP+PHGGVLQDLVARDASK+  LL  ++S  L+ W+LTARQICD+ELILNGGFSPL GFL
Sbjct: 1   MPAPHGGVLQDLVARDASKRDSLL--SESQQLSQWTLTARQICDIELILNGGFSPLTGFL 58

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
            Q+DY  VV  SRL +G +WT+PITLDV  +FA+ + P+QRI LLQD   P+AILTV D+
Sbjct: 59  AQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDI 118

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           Y+PDK+VEA+KVFRGDPEHPA+ YLF  AG++Y+GG+L+AIQLP HYDYPG RKTPAQLR
Sbjct: 119 YKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLR 178

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDRVVAFQTRNPMHRAHRELTVRAAR  N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 179 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVR 238

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPG NSK
Sbjct: 239 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSK 298

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKNELDI+VVPFRMVTYLPDEDRYAPIDEIDT KTRTLNISGTE
Sbjct: 299 GVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTE 358

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPA---QLKTALLSTFL 417
           LR RLRDGGEIP WFSYPEVVKILRESNP RPKQGFALV ++ +     QL  ALLSTFL
Sbjct: 359 LRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFL 418

Query: 418 QYGGGRHYKVLEHGNNEEILALVPDFVRSGTGLILQN----ASSLKGTNVFKIGEESGSD 473
           Q+GGGRHYK+ +H +  E L L+ DFV++G+GLI+ +    ++ +   NV+ IG    +D
Sbjct: 419 QFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDAD 478

Query: 474 IPLETEDKNILHIVQRVVLFL 494
           I L + ++ I HIVQ+VVLFL
Sbjct: 479 IKLASTEETIFHIVQKVVLFL 499

>AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH]
           complement(1332643..1334145) [1503 bp, 500 aa]
          Length = 500

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/496 (65%), Positives = 400/496 (80%), Gaps = 6/496 (1%)

Query: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60
           M SPHGG+LQDLVARDA KK  LL  AQ   L  W+LTARQ+CD+ELILNGGFSPL GFL
Sbjct: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQG--LPQWNLTARQLCDIELILNGGFSPLTGFL 58

Query: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120
            ++DY+SVV+ SRL +GL+WTIPITLDVD EFA  ++  +RI LLQD++  +AI+TVSD+
Sbjct: 59  GKEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDI 118

Query: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180
           Y PDK VEA KVFRGD EHPA++YL E AG+ Y+GG LEAIQLP HYDY   RK+PA LR
Sbjct: 119 YTPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALR 178

Query: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240
            +F ++QWDRVVAFQTRNPMHRAHRELT+RAA+ +N+K+L+HPVVGLTKPGDID+HTR++
Sbjct: 179 ADFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIK 238

Query: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VY+EI+KRYP G+AQL+LLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 239 VYKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSK 298

Query: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360
           G DFYGPYDAQ LVESYKNEL IEVVPF+++TYLPD+D Y P+DEID    +TL ISGTE
Sbjct: 299 GDDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEID-GSVKTLTISGTE 357

Query: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPAQLKTALLSTFLQYG 420
           LR RLR+G +IP WF+YPE+V+ILR+ NP R +QGF +V++   P ++  ALLSTFLQ G
Sbjct: 358 LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHENPKRIANALLSTFLQVG 417

Query: 421 GGRHYKVLEHGNNEEILALVPDFVRSGTGLILQN--ASSLKGTNVFKIGEESGSDIPLET 478
           GGR YK+ +H    ++L L+PDFV+SGTGLI+ +   SS+   N++++     + I +  
Sbjct: 418 GGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKVSA 477

Query: 479 EDKNILHIVQRVVLFL 494
            +  +  IVQ+ V FL
Sbjct: 478 TEP-VTEIVQKTVFFL 492

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 232 DIDHHTRVRVYQEIIKRYPNGMAQLSLL---PLAMRMGGDRE 270
           D+DH +RV+V + I K    G+A+ S L   P+ +  GGD +
Sbjct: 279 DLDHRSRVQVLKGIHKEVNGGVARASFLNGQPIVVTCGGDNQ 320

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 32  LTSWSLTARQICDLELILNGGFSPLDGFLNQQDYQSVVEKSRLQNGLVWTIPITLDVDAE 91
           ++SW          EL  NG    LDGFL +Q    + +K RL++  +W I + L +   
Sbjct: 514 ISSWKFQNSYYIMTELCENGN---LDGFLQEQ---VIAKKKRLEDWRIWKIIVELSLALR 567

Query: 92  F 92
           F
Sbjct: 568 F 568

>CAGL0J06248g complement(589039..594333) similar to sp|P53886
            Saccharomyces cerevisiae YNL172w APC1, hypothetical start
          Length = 1764

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 85/204 (41%), Gaps = 23/204 (11%)

Query: 57   DGFLNQQDYQSVVEKSRL-QNGLVWTIPITLDV-----DAEFASQLSPDQRIVLLQDNEF 110
            DG LN+  + S  EKS L QN  +  +   + +     +A+ A Q+ P + I   + +  
Sbjct: 1247 DGLLNKLKFHSEAEKSELPQNSYIGRLLAIMLIYLKSENADVADQVKP-KIIFGFERSSC 1305

Query: 111  PLAILTVSDVYQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYP 170
                   S+         A ++   D  H +V++L E+ G   +   L++  + ++Y   
Sbjct: 1306 RPEFYMFSEF--------AYRMIMWDSIHDSVEFLMEELGVDILDSCLKSDHMQIYYILS 1357

Query: 171  GW-------RKTPAQLRL-EFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIH 222
            G          +   LR+ EF    +D+++ F           +L V +     + I++ 
Sbjct: 1358 GRILSLGLKFASTGNLRIKEFLLSLFDQLLPFYQYPGRDSVDFKLVVTSINVLLNVIMVS 1417

Query: 223  PVVGLTKPGDIDHHTRVRVYQEII 246
              + ++  GD+D   R+R   E++
Sbjct: 1418 LSMVMSARGDLDVFKRIRYVHEVV 1441

>AFR405W [3597] [Homologous to ScYDR405W (MRP20) - SH]
           complement(1166952..1167686) [735 bp, 244 aa]
          Length = 244

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 434 EEILALVPDFVRSGTGLILQNASSLKGTNVFKIGEESGSDI 474
           EE      DF+R  T   +QN+SS  G++ FK GE  G  +
Sbjct: 153 EETKDTTQDFLREETEKYMQNSSSRLGSDKFKPGEAFGGAL 193

>KLLA0D18029g join(1521909..1521950,1522143..1522835) highly similar
           to YDR174w Saccharomyces cerevisiae YDR174w HMO1
           Non-histone protein singleton, hypothetical start
          Length = 244

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%)

Query: 348 TDKTRTLNISGTELRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLS 401
           T  T  LN   TEL N + D  EIP   +  +VVK     +P  PK+   +  +
Sbjct: 62  TSSTNQLNSISTELTNPIEDEKEIPTTDAAAKVVKKKIPRDPYAPKKPLTVFFA 115

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
           Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 59/135 (43%), Gaps = 14/135 (10%)

Query: 138 EHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLRLEFESKQWDRVVAFQTR 197
           E+ ++K +  ++  F++  SLE +   +      +RK   +  L  E++        +  
Sbjct: 664 ENNSMKNIMLRSYIFFIQISLEKVNRKIIDKVIEYRKKTEETMLRNETRPTANEYV-KDN 722

Query: 198 NPMHRA---HRELTVRAARSNNSKILIHPVVGLT----------KPGDIDHHTRVRVYQE 244
             MH +   ++ +T  +   NNSK+++  +VG             P  +  +T   V Q 
Sbjct: 723 AVMHDSATLNQSITTGSNELNNSKVMLPSIVGKDYNNNTYYKQGMPNIMGQNTNANVGQY 782

Query: 245 IIKRYPNGMAQLSLL 259
           +  R+PN + Q+ ++
Sbjct: 783 VTNRFPNNIDQVDMM 797

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,611,841
Number of extensions: 738604
Number of successful extensions: 1743
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1766
Number of HSP's successfully gapped: 17
Length of query: 494
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 388
Effective length of database: 12,926,601
Effective search space: 5015521188
Effective search space used: 5015521188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)