Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09768g40539920120.0
Sklu_2014.24153939411e-125
Kwal_33.154354104119081e-120
AGR323C4024078901e-117
YGR193C (PDX1)4103958391e-109
Scas_617.74203978051e-104
CAGL0G09361g4294317352e-93
Scas_694.104792022804e-27
YNL071W (LAT1)4822082743e-26
AER364W4532032691e-25
Kwal_23.47254722022487e-23
KLLA0F04741g4732092488e-23
Sklu_2037.44711872452e-22
CAGL0J10186g4692512415e-22
Kwal_56.23934442122860.014
KLLA0D16522g468159810.060
Sklu_2124.1183045810.080
YDR148C (KGD2)463123770.16
Kwal_27.11951186945740.51
AGL200W436110720.62
YBR208C (DUR1,2)183545720.78
Scas_693.2944293710.96
KLLA0E08107g182945701.6
Sklu_2172.143268654.5
CAGL0E01287g413123654.6
ADR051C181945656.1
Scas_532.434367636.9
Kwal_23.6157223066639.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09768g
         (399 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...   779   0.0  
Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement        367   e-125
Kwal_33.15435                                                         354   e-120
AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...   347   e-117
YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate d...   327   e-109
Scas_617.7                                                            314   e-104
CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces c...   287   2e-93
Scas_694.10                                                           112   4e-27
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...   110   3e-26
AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH] complement(...   108   1e-25
Kwal_23.4725                                                          100   7e-23
KLLA0F04741g complement(463107..464528) similar to sp|P12695 Sac...   100   8e-23
Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement         99   2e-22
CAGL0J10186g complement(995223..996632) highly similar to sp|P12...    97   5e-22
Kwal_56.23934                                                          38   0.014
KLLA0D16522g complement(1394850..1396256) similar to sp|P19262 S...    36   0.060
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement           36   0.080
YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutar...    34   0.16 
Kwal_27.11951                                                          33   0.51 
AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH] complement(...    32   0.62 
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...    32   0.78 
Scas_693.29                                                            32   0.96 
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...    32   1.6  
Sklu_2172.1 YDR148C, Contig c2172 307-1605                             30   4.5  
CAGL0E01287g 120567..121808 highly similar to sp|P19262 Saccharo...    30   4.6  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...    30   6.1  
Scas_532.4                                                             29   6.9  
Kwal_23.6157                                                           29   9.7  

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, start by similarity
          Length = 405

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/399 (96%), Positives = 384/399 (96%)

Query: 1   MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE 60
           MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE
Sbjct: 1   MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE 60

Query: 61  VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKE 120
           VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKE
Sbjct: 61  VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKE 120

Query: 121 SKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLFPSVLSLLEENNISTAD 180
           SKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLFPSVLSLLEENNISTAD
Sbjct: 121 SKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLFPSVLSLLEENNISTAD 180

Query: 181 ALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETXXX 240
           ALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARET   
Sbjct: 181 ALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETAAA 240

Query: 241 XXXXXXXXXXXXLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASE 300
                       LPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASE
Sbjct: 241 AAAAQAAKPAKPLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASE 300

Query: 301 LYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQELQQEAS 360
           LYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQELQQEAS
Sbjct: 301 LYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQELQQEAS 360

Query: 361 AVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFVAQLS 399
           AVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFVAQLS
Sbjct: 361 AVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFVAQLS 399

>Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement
          Length = 415

 Score =  367 bits (941), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 205/393 (52%), Positives = 257/393 (65%), Gaps = 21/393 (5%)

Query: 13  RQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEA 72
           R  H   T+ KAQAF MPAMSPTME+GGVV+WK+K G+ FSAGDVLLEVETDKA IDVEA
Sbjct: 25  RGFHSAATLYKAQAFTMPAMSPTMEKGGVVEWKYKVGEPFSAGDVLLEVETDKAQIDVEA 84

Query: 73  QDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKKEEA- 131
           QDDGKLA I+ +NG+KDI VGE IAY+A+VDDDLATLE PK  +     KP   K+E A 
Sbjct: 85  QDDGKLAAIIIDNGSKDIKVGETIAYLAEVDDDLATLEIPK--QEPAAPKPTPKKQETAP 142

Query: 132 KPVEKTDKKKQTSASKTPSKN---GSVQ-ANASQTLFPSVLSLLEENNISTADALDKIKA 187
            P    + KK  + +  P K+   G +  AN SQTLFPSV SLL EN IS  DAL+ IKA
Sbjct: 143 TPAATPEPKKDNAPTSEPKKDTPSGILSTANPSQTLFPSVQSLLHENGISVEDALNNIKA 202

Query: 188 TGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETXXXXXXXXXX 247
           +GPNGRILKGDVLAYLGKIS D + KVTEYIKS E LDLTNIEL   ++           
Sbjct: 203 SGPNGRILKGDVLAYLGKISNDCVVKVTEYIKSGESLDLTNIEL---KKPELKLELGTSK 259

Query: 248 XXXXXLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASELYDPLFE 307
                 P+V +E +TL VP  V+  QLS ++ SY+ E ++L+H++P+    S+ YDP+FE
Sbjct: 260 TLLKPEPVVFTETLTLRVPSAVSSDQLSKSLRSYINEANYLSHEQPVNASTSDYYDPIFE 319

Query: 308 ELLVQEPTKPRFKVTYNIVDLEP--TPRHRTSSPQPDIFDLLSGTTTQELQQEASAVSKQ 365
           EL+  EP +PRF V+Y +  L P  +P+        DIFDLLSGT+       +S   +Q
Sbjct: 320 ELITPEPRQPRFSVSYQLTPLVPVLSPKQHD-----DIFDLLSGTSA----ATSSPQVEQ 370

Query: 366 QQTRHEYALNVSVAVDESLTDAKQRAENFVAQL 398
                EY+L+VSV V+    DA  +A+ F+  L
Sbjct: 371 PSKTTEYSLDVSVQVNGKFDDATLKAQRFIEYL 403

>Kwal_33.15435
          Length = 410

 Score =  354 bits (908), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/411 (48%), Positives = 262/411 (63%), Gaps = 34/411 (8%)

Query: 1   MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE 60
           +FR  +     +R LHQ   + KAQ F MPAMSPTME+GGVV+WKFK G+ FSAGDVLLE
Sbjct: 6   VFRRQLNRLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLE 65

Query: 61  VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKE 120
           VETDKA IDVEAQDDGKLAKIL  +GAKDI VGEPIAY+A+ +DDLATLE P+  E K+ 
Sbjct: 66  VETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQS-ENKQS 124

Query: 121 SKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGS-------------VQANASQTLFPSV 167
           +K  E K E  K V+ + +K Q S  K   +                V+A+ +QTL PSV
Sbjct: 125 TKAPEPKVE--KDVKASAQKGQGSEPKAQKQTQVSSSSGSKDVSGVMVKADPAQTLLPSV 182

Query: 168 LSLLEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLT 227
             LL  NNIS  DAL+ I+A+GPNGRILKGDVL+YLGK+SQ+++ K+T+YI+  E LDL+
Sbjct: 183 QLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLS 242

Query: 228 NIELR---PARETXXXXXXXXXXXXXXXLPLVLSEQITLHVPENVTYSQLSAAIASYVKE 284
           NIEL+   PA +                 P++ +EQ+ L V  NVT+ Q S ++ SY+ E
Sbjct: 243 NIELKKPEPASKAPESVVKKE--------PVIFTEQLHLKVEPNVTFEQFSRSLKSYIDE 294

Query: 285 CSFLAHDEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIF 344
              ++H EP++N  S+ YD LFEEL+  EP KPRF V+Y+I+ L    R   +  Q DIF
Sbjct: 295 ARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPL--NARSLNAKQQDDIF 352

Query: 345 DLLSGTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFV 395
           DLL+GT       E+  +       +E  +N+SV V +  +DAK +AE FV
Sbjct: 353 DLLAGTKNTPASTESGNLQS-----NEVLVNLSVQVSDKFSDAKLKAERFV 398

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/407 (47%), Positives = 259/407 (63%), Gaps = 28/407 (6%)

Query: 1   MFRLAIKNRACL----RQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGD 56
           MFR  +  ++      R  H          F MPAMSPTME+GG+V WKFK G+ F AGD
Sbjct: 1   MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60

Query: 57  VLLEVETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPV- 115
           V+LEVETDKA IDVEAQDDGKLA I+K +G+KD+ VGE +A++A+V+DDL+ LE PK V 
Sbjct: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT 120

Query: 116 -EAKKESKPVETKKEEAKPVEKTDKKKQTSASKTPSK---NGSV-QANASQTLFPSVLSL 170
            EA KE+        EAKP  K  ++    A KTPSK   NG + QA+ +QTL PSV++L
Sbjct: 121 SEAPKEA--------EAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITL 172

Query: 171 LEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIE 230
           L  N ++  +A   IKA+GPNGRILKGDVL YLGKIS DS+ KV+EYIK  E LDL+NIE
Sbjct: 173 LHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNIE 232

Query: 231 LRPARETXXXXXXXXXXXXXXXLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAH 290
           LRPA+                     L E++ L VPE+V++ + S A+  Y++E ++ AH
Sbjct: 233 LRPAQPPKGAADKKAEPKPAPPAYRTLHERLILKVPEHVSFERFSNALKQYIREATYTAH 292

Query: 291 DEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQP--DIFDLLS 348
            E L N  S+ +DPLFEELL  +P +PRF+V+Y+++ L   P    SSP+P  DIFD+LS
Sbjct: 293 GEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVP----SSPKPKEDIFDILS 348

Query: 349 GTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFV 395
           G +     +   A S  + + HEYAL++ + V+   +D++ RA  F+
Sbjct: 349 GNSV----ESKPAPSSSEPSAHEYALDLYLKVENKFSDSETRAARFI 391

>YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate
           dehydrogenase complex protein X, the binding protein for
           Lpd1p [1233 bp, 410 aa]
          Length = 410

 Score =  327 bits (839), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 179/395 (45%), Positives = 249/395 (63%), Gaps = 13/395 (3%)

Query: 9   RACLRQLHQCR-----TMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVET 63
           ++C R L +C       +L  + F MPAMSPTME+GG+V WK+K G+ FSAGDV+LEVET
Sbjct: 12  KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVET 71

Query: 64  DKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKP 123
           DK+ IDVEA DDGKLAKILK+ G+KD+ VGEPIAYIADVDDDLAT++ P+       +K 
Sbjct: 72  DKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANT-ANAKS 130

Query: 124 VETKKEEAKPVEKTDKK-KQTSASKTPSKNGSVQANASQTLFPSVLSLLEENNISTADAL 182
           +E KK  A   E T +  K+ + +   + +GS QAN  QTL PSV  LL ENNIS   AL
Sbjct: 131 IEIKKPSADSTEATQQHLKKATVTPIKTVDGS-QANLEQTLLPSVSLLLAENNISKQKAL 189

Query: 183 DKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETXXXXX 242
            +I  +G NGR+LKGDVLAYLGKI QDS+NKVTE+IK +E+LDL+NI+    +       
Sbjct: 190 KEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQLKPKIAEQA 249

Query: 243 XXXXXXXXXXLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDASELY 302
                      P+   EQ+  H P ++ + +LS ++ S++KE    +H  PL +  S+ +
Sbjct: 250 QTKAADKPKITPVEFEEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTPLMDTNSKYF 309

Query: 303 DPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQELQQEASAV 362
           DP+FE+L+   P +PRFK +Y+++ +      + +  Q DIFDLL+G+           V
Sbjct: 310 DPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDAT--ASSVRPV 367

Query: 363 SKQQQTRHEY--ALNVSVAVDESLTDAKQRAENFV 395
            K    ++EY  ALNVSV  ++   DA+ +A+ F+
Sbjct: 368 EKNLPEKNEYILALNVSVN-NKKFNDAEAKAKRFL 401

>Scas_617.7
          Length = 420

 Score =  314 bits (805), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/397 (44%), Positives = 251/397 (63%), Gaps = 12/397 (3%)

Query: 9   RACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATI 68
           R+ +R +H  R++L AQ F MPAMSPTME+GG+V WKFK G+ FS+GDVLLEVETDKA I
Sbjct: 17  RSLIRSIHLSRSLLSAQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLLEVETDKAQI 76

Query: 69  DVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKK 128
           DVEAQDDGKLAKILK +G+KD+ VGE IAY+ADVDDDL+TL+     E + +  PV   +
Sbjct: 77  DVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKISAEEEEQVKVTPVSKVE 136

Query: 129 EEA-----KPVEKTDKKKQTSASKTPSKNGSVQ-ANASQTLFPSVLSLLEENNISTADAL 182
           E+      +P++ T K K++  +    KNG +Q A ++QTL PSV  LL  NNIS  DA+
Sbjct: 137 EKTTSGNKEPLQNTKKAKESPIAT--DKNGVLQVAKSNQTLLPSVSLLLAANNISKEDAI 194

Query: 183 DKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIELRPARETXXXXX 242
             IKA+G +G +LKGDVLAYLGKI + SL KV+EY+K+ EK D ++IEL    +      
Sbjct: 195 RNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSHIELGSLTKAEPPQS 254

Query: 243 XXXXXXXXXXL---PLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAHDEPLTNDAS 299
                     +   P++L  +ITL VP NV+  +L   + S+++E     H  PL+N  S
Sbjct: 255 EKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEGFEYTHAMPLSNINS 314

Query: 300 ELYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQPDIFDLLSGTTTQE-LQQE 358
           + +D +FE+L+   P +PRF+V Y +          T   + DIFDLL+G+ ++  L+  
Sbjct: 315 QYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFDLLAGSESRTPLRGP 374

Query: 359 ASAVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFV 395
             + S+      E+ L++ + V +  +D+KQ+AE F+
Sbjct: 375 VVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFL 411

>CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, hypothetical start
          Length = 429

 Score =  287 bits (735), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/431 (41%), Positives = 238/431 (55%), Gaps = 66/431 (15%)

Query: 9   RACL--------RQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE 60
           R CL        R     R  L    F MPAMSPTME+GG+V WKFK  D+F+AGDVLLE
Sbjct: 17  RQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLE 76

Query: 61  VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEA--- 117
           VETDKA IDVEAQDDGKLAKI++ +G+KD+ VG+ IA+ AD +DDL+TL+ P+  E+   
Sbjct: 77  VETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQ 136

Query: 118 ------KKESKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSV--QANASQTLFPSVLS 169
                 K++ KP   K EE  P+++ +  K  S SKT   +G V   A+ASQTL PSV+ 
Sbjct: 137 VSSGSGKEDQKP--AKSEEPAPLQRKE-GKNVSESKTAKSSGDVLTTADASQTLLPSVVM 193

Query: 170 LLEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNI 229
            L +N IS  DAL  IKA+G NGRILKGDVLAY GKI QDS+ KV EY+  ++KLDL+NI
Sbjct: 194 ALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSNI 253

Query: 230 ELRPARETXXXXXXXXXXXXXXXL----------------------PLVLSEQITLHVPE 267
           E R   E                                       P+ + E+I L V  
Sbjct: 254 E-RIVLEVNSEEGGDGQAQAQAQAQAQGQGQDSGKTGKLAKPAQVEPIRIQEEILLEVRR 312

Query: 268 NVTYSQLSAAIASYVKECSFLAHDEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVD 327
            V +++   A+  Y+ +     H++PL N  SE YD LFE+L+  +P   RF V Y++++
Sbjct: 313 GVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLE 372

Query: 328 LEPTPRHRTSSPQPDIFDLLSGTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDA 387
                   T+    DIFDLL     +E +Q              Y+L VSV V++   DA
Sbjct: 373 --------TTDGSEDIFDLLGPGEVKEGKQ-------------VYSLEVSVTVNDKYDDA 411

Query: 388 KQRAENFVAQL 398
            ++A+ F+  L
Sbjct: 412 VEKADRFMECL 422

>Scas_694.10
          Length = 479

 Score =  112 bits (280), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 109/202 (53%), Gaps = 22/202 (10%)

Query: 17  QCRTMLKAQ------------AFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETD 64
           Q RT L+ Q              GMP++SPTM  G +V W  + GD  + GDVL E+ETD
Sbjct: 19  QLRTQLRLQLTASYASYPAHTIIGMPSLSPTMTHGNLVAWSKQVGDQLAPGDVLAELETD 78

Query: 65  KATIDVEAQDDGKLAKILKENGAKDIPVGEPIA-YIADVDDDLATLEFP--KPVEAKKES 121
           KA +D E QDDG LAKIL   G KD+P+ +PIA Y+ D DD  A  +F      +A   +
Sbjct: 79  KAQMDFEFQDDGYLAKILVPEGTKDVPINKPIAVYVEDADDVAAFKDFKIEDSADAAATT 138

Query: 122 KPVETKKEEAKPVEKTDKKKQ-TSASKTPSKNGSVQANASQTLFPSVLS--LLEENNIST 178
              E K+E+ +  EK + ++Q T  SK    +   Q + +  +  S L+  +  EN +  
Sbjct: 139 TTTEVKEEKPQQPEKINAQQQPTQKSKEQKSSPVTQEDTTGRIIASPLAKKIALENGV-- 196

Query: 179 ADALDKIKATGPNGRILKGDVL 200
             AL   K +GP+GRI+K DVL
Sbjct: 197 --ALKGFKGSGPHGRIVKDDVL 216

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score =  110 bits (274), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 113/208 (54%), Gaps = 15/208 (7%)

Query: 3   RLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVE 62
           R ++  R+   QL    +  +    GMPA+SPTM +G +  W  K GD  S G+V+ E+E
Sbjct: 13  RSSVLTRSLRLQLRCYASYPEHTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIE 72

Query: 63  TDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIA-YIADVDDDLATLEFPKPVEAKKES 121
           TDKA +D E Q+DG LAKIL   G KDIPV +PIA Y+ D  D  A  +F K  ++  +S
Sbjct: 73  TDKAQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFKDF-KLEDSGSDS 131

Query: 122 KPVETKKEEAKPVEKTDKKKQTSASKT----PSKNGSVQANASQTLFPSVL--SLLEENN 175
           K   TK + A+P  + +KK++  A +T    P    S  A     +F S L  ++  E  
Sbjct: 132 K-TSTKAQPAEP--QAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKG 188

Query: 176 ISTADALDKIKATGPNGRILKGDVLAYL 203
           IS  D    +  TGP GRI K D+ +YL
Sbjct: 189 ISLKD----VHGTGPRGRITKADIESYL 212

>AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH]
           complement(1312487..1313848) [1362 bp, 453 aa]
          Length = 453

 Score =  108 bits (269), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 104/203 (51%), Gaps = 6/203 (2%)

Query: 27  FGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            GMPA+SPTM +G +  W  K GD  S G+VL EVETDKA +D E Q++G LAKIL   G
Sbjct: 34  IGMPALSPTMTQGNLAVWTKKEGDKLSPGEVLAEVETDKAQMDFEFQEEGFLAKILVPEG 93

Query: 87  AKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKKEEAKPVEKTDKKKQTSAS 146
           AKD+PV +PIA   + + D+A  +  K  E+  ESK  +   +E     K        A 
Sbjct: 94  AKDVPVNKPIAVYVEEEGDVAAFKDFKVEESAAESK--DAPAKEEAAPAKAAPAAAAPAK 151

Query: 147 KTPSKNGSVQANASQTLFPSVLSLLEENNISTADALDKIKATGPNGRILKGDVLAYLGKI 206
                 GS  +       P   ++  E  IS    L ++  TGPNGRI K DV  YL K 
Sbjct: 152 AAKKSTGSAASGGRIMASPLAKTIALEKGIS----LKEVTGTGPNGRITKEDVEKYLAKA 207

Query: 207 SQDSLNKVTEYIKSHEKLDLTNI 229
            + + +       ++E + ++N+
Sbjct: 208 PKKTESAAAPAAATYEDVPISNM 230

>Kwal_23.4725
          Length = 472

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 104/202 (51%), Gaps = 13/202 (6%)

Query: 15  LHQCRTMLKAQA-------FGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKAT 67
           L   R  L+A A        GMPA+SPTM +G +  W  KAGD    G+ + E+ETDKA 
Sbjct: 16  LRSARLQLRAYASYPPHTVIGMPALSPTMTQGNLAVWLKKAGDKLEPGEAIAEIETDKAQ 75

Query: 68  IDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETK 127
           ++ E Q+DG LAKIL   G+KD+PVG+PIA   + + D+         EA  E      +
Sbjct: 76  MEFEFQEDGYLAKILVPEGSKDLPVGKPIAVYVEEEGDVGAFADFTAEEAAPEKPAAAPE 135

Query: 128 KEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLFPSVL--SLLEENNISTADALDKI 185
           K++ +P ++  +K+++      S   +  A +   +  S L  ++  +  IS    L  +
Sbjct: 136 KKQDEPQQQAAQKEESGKPAKKSSGATSAAPSGDRIIASPLAKTIALDKGIS----LKAV 191

Query: 186 KATGPNGRILKGDVLAYLGKIS 207
             TGP GRI K DV  YL K S
Sbjct: 192 TGTGPRGRITKADVEEYLSKSS 213

>KLLA0F04741g complement(463107..464528) similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 473

 Score =  100 bits (248), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 107/209 (51%), Gaps = 12/209 (5%)

Query: 3   RLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVE 62
           R+++   A   QL    +       GMPA+SPTM +GG+ +W    GD    GDVL EVE
Sbjct: 11  RMSVLACAARLQLRTYASYPPYTIIGMPALSPTMVQGGLTEWSKNVGDRLEPGDVLAEVE 70

Query: 63  TDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIA-YIADVDDDLATLEFPKPVEAKKES 121
           TDKA +D E Q++G LAKIL   G KDIPV +P+A Y+ +  D  A   F         +
Sbjct: 71  TDKAQMDFEFQEEGYLAKILVPAGTKDIPVNKPLAVYVEEESDVPAFANFTAADAESATA 130

Query: 122 KPVETKKEEAKPVEKTDKKKQTSASKTPSK-----NGSVQANASQTLFPSVL--SLLEEN 174
                K    +P ++  K++    +K  SK     +    A++   +F S L  S+  E+
Sbjct: 131 AKEAAKNGAKQPAKEESKEESKEGAKPASKPAAKKSSGSSASSGTRIFASPLAKSIALEH 190

Query: 175 NISTADALDKIKATGPNGRILKGDVLAYL 203
            +S    L +++ TGP GRI K DV A+L
Sbjct: 191 GVS----LKEVEGTGPRGRITKDDVEAFL 215

>Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement
          Length = 471

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 102/187 (54%), Gaps = 16/187 (8%)

Query: 27  FGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            GMPA+SPTM +G +  W  K GD+ S G+V+ E+ETDKA +D E Q++G LAKIL   G
Sbjct: 35  IGMPALSPTMTQGNLAVWSKKVGDSLSPGEVIAEIETDKAQMDFEFQEEGFLAKILVPEG 94

Query: 87  AKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKKEEAKPVEKTDKKKQTSAS 146
            KDIPV +PIA   + + D+      K       + P + +  + +  ++ ++     AS
Sbjct: 95  TKDIPVNKPIAVYVEEEGDVEAF---KDFTVDDSASPAKKEAPKEEAPKEEEQAATKPAS 151

Query: 147 KTPSKN------GSVQANASQTLFPSVL--SLLEENNISTADALDKIKATGPNGRILKGD 198
            TPS+N       S  A+A + +F S L  ++  E  I    AL  +  TGP+GRI K D
Sbjct: 152 STPSQNKSSSSSSSSSAHAGR-IFASPLAKTIALEKGI----ALKNVTGTGPHGRITKAD 206

Query: 199 VLAYLGK 205
           +  +L K
Sbjct: 207 IETFLAK 213

>CAGL0J10186g complement(995223..996632) highly similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 469

 Score = 97.4 bits (241), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 120/251 (47%), Gaps = 36/251 (14%)

Query: 10  ACLRQLHQC-RTMLKAQ-----------------AFGMPAMSPTMERGGVVDWKFKAGDT 51
           A LR L Q  RT L+ +                   GMPA+SPTM +G +  W  K GD+
Sbjct: 3   ALLRALPQVSRTALRGRLVTPMTLRLYASFPPHTVIGMPALSPTMSQGNLAVWSKKEGDS 62

Query: 52  FSAGDVLLEVETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIA-YIADVDDDLATLE 110
            + GDVL E+ETDKA +D E QD+G LAKIL   G KD+ V  PIA Y+ D  D  A  +
Sbjct: 63  LAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVAVSRPIAVYVEDEADVAAFKD 122

Query: 111 FPKPVE----AKKESKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLF-P 165
           F   VE    ++  S P   +++E    E+  ++K    +   +   S  A+  + +  P
Sbjct: 123 F--TVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKKAAKSNSTPSSVASGDRIIASP 180

Query: 166 SVLSLLEENNISTADALDKIKATGPNGRILKGDVLAYL------GKISQDSLNKVTEYIK 219
              ++  E  I    AL  +K TGP GRI K DV  YL         +  S    T    
Sbjct: 181 LAKTIALEKGI----ALKSVKGTGPRGRITKADVEKYLESAPKSTSTAAPSATPSTTGGA 236

Query: 220 SHEKLDLTNIE 230
           S+E L++TN+ 
Sbjct: 237 SYEDLEITNMR 247

>Kwal_56.23934
          Length = 442

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 29  MPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENGAK 88
           +P M+ ++  G + ++  + G+     ++L  +ETDK  ++V A   GK+ K L      
Sbjct: 60  VPPMAESLTEGSLKEYTKQVGEFIKQDELLATIETDKIDVEVNAPTSGKVTK-LNFQPED 118

Query: 89  DIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKKEEAK-PVEKTDKKKQTSASK 147
            + VG          DDLA +E      A  +  P ET +E+ K   E   KK+Q +A+ 
Sbjct: 119 TVTVG----------DDLAEIEAGAEAPASGQDAPKETSQEQPKQSSESAPKKEQEAAAP 168

Query: 148 TP 149
            P
Sbjct: 169 KP 170

>KLLA0D16522g complement(1394850..1396256) similar to sp|P19262
           Saccharomyces cerevisiae YDR148c KGD2 2-oxoglutarate
           dehydrogenase complex E2 component, start by similarity
          Length = 468

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 73/159 (45%), Gaps = 21/159 (13%)

Query: 24  AQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILK 83
           A +  +P M+ ++  G + ++  K GD     ++L  +ETDK  ++V +   G +AK+  
Sbjct: 79  ATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDKIDVEVISPISGTIAKL-- 136

Query: 84  ENGAKD--IPVGEPIAYI--------------ADVDDDLATLEFPKPVEAKKESKPVETK 127
            N + D  + VGE IA I              +      A  E  +    KKE +P   K
Sbjct: 137 -NFSPDDTVTVGEEIAQIEPGEAPAGGAAASESSSASAPAAEEQQQQAAPKKEEQPATPK 195

Query: 128 KEEAKPVEKTDKKKQTSASKTPSKNGSVQANASQTLFPS 166
           KEE K      KK++  A+  P K   V ++A+++  PS
Sbjct: 196 KEE-KAAAPAPKKEEKPAAAAPKKT-EVDSSATESSTPS 232

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 44   WK--FKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            WK    AGDT + GD L+ VE  K  + V A+  GK+ KI+ +NG
Sbjct: 1773 WKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNG 1817

>YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutarate
           dehydrogenase (alpha-ketoglutarate dehydrogenase)
           complex KE2 component dihydrolipoamide
           S-succinyltransferase [1392 bp, 463 aa]
          Length = 463

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 12/123 (9%)

Query: 22  LKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKI 81
            K+ +  +P M+ ++  G + ++    GD     ++L  +ETDK  I+V +   G + K 
Sbjct: 71  FKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTK- 129

Query: 82  LKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVETKKEEAKPVEKTDKKK 141
           L       + VGE +A +   +          P E   ESKP  T  E+A+P +    ++
Sbjct: 130 LNFKPEDTVTVGEELAQVEPGE---------APAEGSGESKPEPT--EQAEPSQGVAARE 178

Query: 142 QTS 144
            +S
Sbjct: 179 NSS 181

>Kwal_27.11951
          Length = 1869

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 44   WK--FKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            WK     GD   AGD L+ VE  K  + V A   GK+ K++ +NG
Sbjct: 1812 WKPLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNG 1856

>AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH]
           complement(321080..322390) [1311 bp, 436 aa]
          Length = 436

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 4/110 (3%)

Query: 16  HQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDD 75
           H C     + +  +P M+ ++  G + ++  + G+     ++L  +ETDK  I+V A   
Sbjct: 52  HLCGLRYASTSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVS 111

Query: 76  GKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEAKKESKPVE 125
           G + K L       + VGE +A I   ++  A     KP   ++ S P E
Sbjct: 112 GTVTK-LNFKPEDTVTVGEELAQI---EEGAAPAGGQKPAAKEETSAPQE 157

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 44   WKFKA--GDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            WK  A  GD   AG  LL +E  KA + + A   GK+ KI   NG
Sbjct: 1775 WKSIASVGDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNG 1819

>Scas_693.29
          Length = 442

 Score = 32.0 bits (71), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 29  MPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENGAK 88
           +P M+ ++  G + ++    GD     ++L  +ETDK  I+V A   G ++K L      
Sbjct: 68  VPQMAESLTEGSLKEFTKAVGDFIEQDELLATIETDKIDIEVIAPVSGTVSK-LNFKPED 126

Query: 89  DIPVGEPIAYIADVDDDLATLEFPKPVEAKKES 121
            + VGE +A I + +   +  E   P  A  E+
Sbjct: 127 TVTVGEELATIEEGEGSASKSEAETPAPAASEN 159

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 44   WKFKA--GDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            WK  A  GD   AGD ++ +E  K  + V A   GK+ KIL +NG
Sbjct: 1772 WKPVAAVGDHVEAGDGVIIIEAMKTEMVVGATKSGKVYKILHKNG 1816

>Sklu_2172.1 YDR148C, Contig c2172 307-1605
          Length = 432

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 18  CRTMLKAQ----AFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQ 73
           CR ++ A+       +P M+ ++  G + ++  + G+     ++L  +ETDK  ++V + 
Sbjct: 43  CRRIIAARYQSTVVKVPPMAESLTEGSLKEFTKQVGEFIEQDELLATIETDKIDVEVNSP 102

Query: 74  DDGKLAKI 81
             G + K+
Sbjct: 103 VSGTITKL 110

>CAGL0E01287g 120567..121808 highly similar to sp|P19262
           Saccharomyces cerevisiae YDR148c oxoglutarate
           dehydrogenase complex E2 component, hypothetical start
          Length = 413

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 18/123 (14%)

Query: 10  ACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLEVETDKATID 69
           A L Q     T +K     +P+M+ ++  G + ++  K G+     ++L  +ETDK  I+
Sbjct: 31  AYLSQYRWASTSVK-----VPSMAESLTEGSLKEFTKKVGEFVEQDELLATIETDKIDIE 85

Query: 70  VEAQDDGKLAKILKENGAKDIPVGEPIAYI----ADVDDDLATLEFPKPVEAKKESKPVE 125
           V +   G + K+  E     + VG+ +A I    A  D         KP  A +ESKP E
Sbjct: 86  VNSPVSGTVTKLNFEP-EDTVTVGDELAQIEEGGAPADGG------AKP--AAEESKPAE 136

Query: 126 TKK 128
             K
Sbjct: 137 ESK 139

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 44   WK--FKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENG 86
            WK     GD    GD L+ +E  K  + V A  DG++  IL  NG
Sbjct: 1760 WKQVVSVGDKVKEGDKLVIIEAMKTEMVVSATADGEVINILHANG 1804

>Scas_532.4
          Length = 343

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 261 ITLHVPENVTYSQLSAAIASYVKECSFL-AHDEPLTNDASELYDPLFEELLVQEPTKPRF 319
           + L  P +V  S +S     Y +   F+   DE L N+  +L     + L+ ++P K +F
Sbjct: 64  LKLDFPTSVHVSYVSRKEIIYNQYLDFIRKFDEILLNERRQLVSIYLKALVNKDPKKMKF 123

Query: 320 KVTYNIV 326
           ++ Y I+
Sbjct: 124 RIPYRIL 130

>Kwal_23.6157
          Length = 2230

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 39  GGVVDWKFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAY 98
           G +V + F++GD   AG    EVE  K  + + +Q+ G + ++LK+ G+  +  G+ +A 
Sbjct: 710 GKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESG-IIQLLKQPGST-VSAGDILAI 767

Query: 99  IADVDD 104
           +A +DD
Sbjct: 768 LA-LDD 772

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,325,867
Number of extensions: 545919
Number of successful extensions: 3432
Number of sequences better than 10.0: 175
Number of HSP's gapped: 3268
Number of HSP's successfully gapped: 190
Length of query: 399
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 295
Effective length of database: 12,995,837
Effective search space: 3833771915
Effective search space used: 3833771915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)