Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09746g58057129380.0
Sklu_2014.363157316470.0
Scas_617.558157816340.0
Kwal_33.1543858057416130.0
YGR194C (XKS1)60058715530.0
CAGL0G09339g58258114960.0
AGR324C56457414900.0
Kwal_26.927845569692.7
AFL112W1194104674.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09746g
         (571 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces c...  1136   0.0  
Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement        639   0.0  
Scas_617.5                                                            634   0.0  
Kwal_33.15438                                                         625   0.0  
YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...   602   0.0  
CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces c...   580   0.0  
AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH] (1335916..1...   578   0.0  
Kwal_26.9278                                                           31   2.7  
AFL112W [3083] [Homologous to ScYGL133W (ITC1) - SH; ScYPL216W -...    30   4.8  

>KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase singleton, start by
           similarity
          Length = 580

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/571 (95%), Positives = 545/571 (95%)

Query: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60
           MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP
Sbjct: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60

Query: 61  VAMWLEAIDLCFERLGKCIDLKKVKSMSGSCQQHGTVFWNCDHLPKDLQPSSNLVKQLAS 120
           VAMWLEAIDLCFERLGKCIDLKKVKSMSGSCQQHGTVFWNCDHLPKDLQPSSNLVKQLAS
Sbjct: 61  VAMWLEAIDLCFERLGKCIDLKKVKSMSGSCQQHGTVFWNCDHLPKDLQPSSNLVKQLAS 120

Query: 121 CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPEVY 180
           CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPEVY
Sbjct: 121 CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPEVY 180

Query: 181 ANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIKRK 240
           ANTKKI            GDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIKRK
Sbjct: 181 ANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIKRK 240

Query: 241 LFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVXXXXXX 300
           LFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDV      
Sbjct: 241 LFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVLISLGT 300

Query: 301 XXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDWTK 360
                   DQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDWTK
Sbjct: 301 STTILLITDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDWTK 360

Query: 361 FNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFPDKRLDA 420
           FNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFPDKRLDA
Sbjct: 361 FNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFPDKRLDA 420

Query: 421 KNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRAFFV 480
           KNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRAFFV
Sbjct: 421 KNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRAFFV 480

Query: 481 GGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDRWLN 540
           GGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDRWLN
Sbjct: 481 GGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDRWLN 540

Query: 541 AFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           AFFNWERDCEFVCNSDAAKWENYNNKIRTLS
Sbjct: 541 AFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/573 (55%), Positives = 386/573 (67%), Gaps = 10/573 (1%)

Query: 4   SGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAPVAM 63
           SGY+LGFDLSTQQLKCL +D QL +V +  ++FD+D P Y+T KGVY  D+G I+APVAM
Sbjct: 57  SGYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAM 116

Query: 64  WLEAIDLCFERLGK--CIDLKKVKSMSGSCQQHGTVFWNCD--HLPKDLQPSSNLVKQLA 119
           W +A+D  F  L       L +V  +SGSCQQHG+V+W+ D     ++L     L+ QLA
Sbjct: 117 WCDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNLDAQQTLLTQLA 176

Query: 120 -SCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPE 178
              FSR VAPNWQDHST  +C       GGPQ LA ITGS +HYRF+G QI KV   EPE
Sbjct: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236

Query: 179 VYANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIK 238
           VYANT  I            G I PLEEADACGMNLY I   +++  LL  +D D+ SIK
Sbjct: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDVESIK 296

Query: 239 RKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVXXXX 298
           RKL   PT +D    L  VS+Y+  +YG+NP CQ++PFTGDNLATICSLPL+KNDV    
Sbjct: 297 RKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLVSL 356

Query: 299 XXXXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDW 358
                     DQY+ SPNYHLFIHPT+P  YMGMICYCNGSLARE +RD ++ +   H W
Sbjct: 357 GTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSAD---HSW 413

Query: 359 TKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFPDKRL 418
             FN+ALLD+S+ N +EIG+YFPL EIVP++ + TKR  F   DN + L  V  F D + 
Sbjct: 414 DPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIKH 473

Query: 419 DAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRAF 478
           D KNIVESQALSCRVRISPLLS+   A +      +   VKFDYD FP++ Y KRP RAF
Sbjct: 474 DVKNIVESQALSCRVRISPLLSDNCAAASNNS--STSYTVKFDYDTFPISEYRKRPRRAF 531

Query: 479 FVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDRW 538
           FVGGAS+N+AI++T A VIGA  GNY+LET NSCALGGCYKALWS +        SFD +
Sbjct: 532 FVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFTKLSFDLF 591

Query: 539 LNAFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           LN  F+W+ D EF+C+S+   WE YN KI+ LS
Sbjct: 592 LNEHFDWQHDAEFICDSETESWEYYNTKIQALS 624

>Scas_617.5
          Length = 581

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/578 (54%), Positives = 391/578 (67%), Gaps = 10/578 (1%)

Query: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60
           MSE  YYLG DLSTQQLK LAI++ L IV T  ++FDK+ PHYNT KGVYI     I+ P
Sbjct: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGND-IECP 59

Query: 61  VAMWLEAIDLCFERLGK-CIDLKKVKSMSGSCQQHGTVFW--NCDHLPKDLQPSSN--LV 115
           V MWLEA+DL FE+  K    L  V+++SGSCQQHG+V+W  N + L K+L   ++  LV
Sbjct: 60  VGMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLV 119

Query: 116 KQL-ASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHE 174
             L    FSR  APNWQDHST  QC     KVGGPQ LA ITGS +H+RF+G QI K+ E
Sbjct: 120 SHLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAE 179

Query: 175 TEPEVYANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDI 234
            EP  YANT  +            G++ PLEEAD+CGMNLY I K +FNEDLLS++D + 
Sbjct: 180 KEPGNYANTSSVSLVSSFITSLLCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSNE 239

Query: 235 ASIKRKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDV 294
            +I+ KL DPP   D+P  LG +S YF +KYG NP C I+P TGDNLATICSLPL+ NDV
Sbjct: 240 DNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTNDV 299

Query: 295 XXXXXXXXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQ 354
                         +QY  SPNYHLFIHPT+P+HYMGMICYCNG+LAREKIRD++N   +
Sbjct: 300 LVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETGE 359

Query: 355 THDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFP 414
            + W  FNEA+LD+++ N +E+G+YFPLGEIVP++ A+ KR  F     ++    V+ F 
Sbjct: 360 GNSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAI-VDEFA 418

Query: 415 DKRLDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASY-AKR 473
           +K+ DAKNIVESQALSCR+RISPLLS+E N+            VKFDY   P++ Y +KR
Sbjct: 419 NKKHDAKNIVESQALSCRIRISPLLSKEGNSNKNEMTSNENGTVKFDYAEIPISDYLSKR 478

Query: 474 PNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETP 533
           PNRAFFVGGASKN+AI+K  A +IGA+ GNYRLET NSCALGGCYKA+WS L        
Sbjct: 479 PNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGETKE 538

Query: 534 SFDRWLNAFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           SFD +L+  F W  + E +C  D   WE YN KI  +S
Sbjct: 539 SFDVYLDKHFPW-GEVERICEPDEKAWELYNKKIVPMS 575

>Kwal_33.15438
          Length = 580

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/574 (53%), Positives = 393/574 (68%), Gaps = 17/574 (2%)

Query: 7   YLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAPVAMWLE 66
           YLGFDLSTQQLKCL ID  L ++ + +IEFDKD   Y T KGVY++D+G ++ PVAMWLE
Sbjct: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68

Query: 67  AIDLCFERLG--KCIDLKKVKSMSGSCQQHGTVFWNCDHLPKDLQPSSNLVKQLAS---- 120
           A+DL F+R+   K +DL  V++MSGSCQQHG+V+W  +  PK L P+ +  + L      
Sbjct: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYW-AEEGPK-LLPTLDFKQSLKDQLFP 126

Query: 121 -CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPEV 179
             FSR VAPNWQDHST  +C +  D VGGP ELAR+TGS +H+RF+G Q+ K+ + EPEV
Sbjct: 127 DAFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEV 186

Query: 180 YANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIKR 239
           Y  T KI            G+   LEEADACGMNLY I+K ++ ++LL  +D+D++ ++ 
Sbjct: 187 YRKTAKISLVSSFLASVLAGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSGLRE 246

Query: 240 KLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVXXXXX 299
           KL   P + D+P  +G +S+YF +KYG+N DCQ++PFTGDNLATICSL L+ NDV     
Sbjct: 247 KLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSLG 306

Query: 300 XXXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDWT 359
                    DQYH SPNYHLFIHPT+P HYMGMICYCNG+LAREKIRD +   S +HDW 
Sbjct: 307 TSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQL---SDSHDWE 363

Query: 360 KFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYID--NKVVLTNVNMFPDKR 417
            FN A+   ++ NDNEI  YFPLGEIVPN+ +V +R  F+  +  + V L  +  F +  
Sbjct: 364 PFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVA 423

Query: 418 LDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRA 477
            DA+NIVESQALSCRVRISPLLS +    N       + KV FDYD FPL+ Y KRP RA
Sbjct: 424 HDARNIVESQALSCRVRISPLLSSDCTDTNSEM---GDSKVLFDYDNFPLSEYRKRPRRA 480

Query: 478 FFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDR 537
           FFVGGASKN+AI+   A V+GA +GN+RLET NSCALGGCY+ALWS L   N  +  FD+
Sbjct: 481 FFVGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSPFDQ 540

Query: 538 WLNAFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           +LN  F W+ D + +  +D   W++YN KI+ LS
Sbjct: 541 FLNEAFRWDFDVQSLGLTDEKDWKHYNTKIQALS 574

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/587 (53%), Positives = 402/587 (68%), Gaps = 26/587 (4%)

Query: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60
           MS   YYLGFDLSTQQLKCLAI+  L IV +  +EF+KD PHY+T+KGVYI  +  I+ P
Sbjct: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGD-TIECP 75

Query: 61  VAMWLEAIDLCFERLGKC-IDLKKVKSMSGSCQQHGTVFWN--CDHLPKDL--QPSSNLV 115
           VAMWLEA+DL   +  +    L KV ++SGSCQQHG+V+W+   + L + L  +P  +L+
Sbjct: 76  VAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLL 135

Query: 116 KQLAS-CFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHE 174
             ++S  F+R  APNWQDHST KQC E  + +GGP+++A++TGS +H+RF+G QI K+ +
Sbjct: 136 HYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQ 195

Query: 175 TEPEVYANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDI 234
            EPE Y  TK I            G +V LEEADACGMNLY I + +F+++LL ++D   
Sbjct: 196 LEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSS 255

Query: 235 A--SIKRKLFDPPTSSDEPKSL--GPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQ 290
              +I++KL   P      K+L  G +  YF EKYG N +C++ P TGDNLATICSLPL+
Sbjct: 256 KDKTIRQKLMRAPM-----KNLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLR 310

Query: 291 KNDVXXXXXXXXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDIN 350
           KNDV              D+YH SPNYHLFIHPT+PNHYMGMICYCNGSLARE+IRD++N
Sbjct: 311 KNDVLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELN 370

Query: 351 GESQ-----THDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKV 405
            E +     T+DWT FN+A+LD+S S++NE+G+YFPLGEIVP++ A+ KR  F      +
Sbjct: 371 KERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFN-PKTGM 429

Query: 406 VLTNVNMFPDKRLDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFF 465
           +   V  F DKR DAKNIVESQALSCRVRISPLLS ++NA ++ Q L  +  VKFDYD  
Sbjct: 430 IEREVAKFKDKRHDAKNIVESQALSCRVRISPLLS-DSNASSQ-QRLNEDTIVKFDYDES 487

Query: 466 PLASYA-KRPNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSL 524
           PL  Y  KRP R FFVGGASKN+AI+K  A VIGA  GN+RLET NSCALGGCYKA+WSL
Sbjct: 488 PLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSL 547

Query: 525 LKEQNPETPSFDRWLNAFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           L + N     FD++LN  F W    E + + D   W+ YN+KI  LS
Sbjct: 548 LYDSNKIAVPFDKFLNDNFPWHV-MESISDVDNENWDRYNSKIVPLS 593

>CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase, start by
           similarity
          Length = 582

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/581 (51%), Positives = 382/581 (65%), Gaps = 16/581 (2%)

Query: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60
           M   GYYLG DLSTQQLKCLAID  + I  T  ++FD+D PHYNT KGVY   + V++ P
Sbjct: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECP 59

Query: 61  VAMWLEAIDLCFERL-GKCIDLKKVKSMSGSCQQHGTVFWNC---DHLPKDLQPSSNLVK 116
           V MWLEAIDL FE+  G   DL +VK++SGSCQQHG+V+W     D L      + NLV 
Sbjct: 60  VGMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVD 119

Query: 117 QL-ASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHET 175
           QL    FSR  APNWQDHST KQC ++  K GGP++LA ITGS +H+RF+G QI K+ E 
Sbjct: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179

Query: 176 EPEVYANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIA 235
           E + Y NT+ I              +VP+EEADACGMN+Y I+   +++ LL V+     
Sbjct: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239

Query: 236 S--IKRKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKND 293
              + +KL    T  + P+ +G ++ YF  KYG + +C IYPFTGDNLATICSLPL+KND
Sbjct: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299

Query: 294 VXXXXXXXXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGES 353
           +              DQYH SPNYHLF HP + N YM MICYCNGSLAREK+RD +N E+
Sbjct: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLN-EN 358

Query: 354 QTHDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMF 413
           Q+  WT F+EA+LD SL    E+ +YFPLGEIVP++DA+TKR  +    N  ++  V+ F
Sbjct: 359 QSTSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYD-PKNCEIVKYVDKF 417

Query: 414 PDKRLDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASY-AK 472
            + R DAK IVESQALS RVR++PLLS     ++E+   KSE  V FDYD    + Y +K
Sbjct: 418 DNNRHDAKIIVESQALSARVRVAPLLS---GTVDESNDEKSETMVHFDYDSMKFSEYSSK 474

Query: 473 RPNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLL--KEQNP 530
           RPNR +FVGGASKN+AI+K  + V+GAKNGN+RLET NSCALGGC+KALWS L  K++  
Sbjct: 475 RPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKID 534

Query: 531 ETPSFDRWLNAFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           E  +FD +LN +F  +   E   +    KWE Y +KI  LS
Sbjct: 535 EKVTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKIIPLS 575

>AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH]
           (1335916..1337610) [1695 bp, 564 aa]
          Length = 564

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/574 (50%), Positives = 370/574 (64%), Gaps = 19/574 (3%)

Query: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60
           M+ES  YLGFDLSTQQLKCLAID+ L I  TA ++FD+D   Y T KGVY +++ V+++P
Sbjct: 1   MAESKLYLGFDLSTQQLKCLAIDEDLAIKCTAVVDFDRDLAGYETVKGVYTREDNVVESP 60

Query: 61  VAMWLEAIDLCFERLGKCIDLKKVKSMSGSCQQHGTVFWNCD--HLPKDLQPSSNLVKQL 118
           V MWLEA+DLCFERL + +DL  V+++SGSCQQH +V+W  D     ++L   S L  QL
Sbjct: 61  VEMWLEALDLCFERLAREVDLGAVEAISGSCQQHASVYWTEDVKTRIRELDSRSGLRAQL 120

Query: 119 ASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHETEPE 178
             C SR  APNWQDHST  Q ++     GGPQELA++TGS +H+RF+G QI K+ +TEP 
Sbjct: 121 GPCLSRANAPNWQDHSTEAQREQFEAHCGGPQELAQLTGSKAHFRFTGLQIKKIRDTEPA 180

Query: 179 VYANTKKIXXXXXXXXXXXXGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIASIK 238
               T  I            G +VP EEADACGM LY I +H + E LL +VD+   ++ 
Sbjct: 181 TLTATPSISLASSFLASVLVGKLVPPEEADACGMILYNIAQHRYVEGLLQMVDD---ALF 237

Query: 239 RKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKNDVXXXX 298
            KL   P   D  + LG VS YF+EKYG+N  C IY  TGDNLATICSLPLQKND+    
Sbjct: 238 DKLCGNPVRCDNVRPLGTVSRYFKEKYGINTSCNIYQLTGDNLATICSLPLQKNDLLVSL 297

Query: 299 XXXXXXXXXXDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGESQTHDW 358
                     ++Y  SPNYH+FIHPT+P +YMGM+CYCNG+LARE+I+D +  ES    W
Sbjct: 298 GTSTTVLAVTEKYSPSPNYHMFIHPTIPGNYMGMVCYCNGALARERIKDTLGDES---GW 354

Query: 359 TKFNEALLDNSLSNDNEIGLYFPLGEIVPNMD-AVTKRCYFKYIDNKVVLTNVNMFPDKR 417
             F++AL D+S+    E+G+YFPL EIVP++D  + KR       +   L  V  F    
Sbjct: 355 AAFSKALEDDSVDTSAELGVYFPLPEIVPSVDHPLVKRVRI----SPKGLQEVESFASPA 410

Query: 418 LDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNRA 477
            DAKNIVESQALSCRVR++PLLS         ++  +     FD     +A + +RPNR 
Sbjct: 411 HDAKNIVESQALSCRVRVAPLLS------TPPEISDTGGHAAFDGQQRDVAEFTRRPNRV 464

Query: 478 FFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLLKEQNPETPSFDR 537
           FFVGGASKN+AI++ M N++GAK GNYRLET+NSCALGGCYKA WS L  +     SF  
Sbjct: 465 FFVGGASKNDAIVRAMPNILGAKGGNYRLETSNSCALGGCYKAFWSDLLYKQKTNASFAD 524

Query: 538 WLNAFFNWERDCEFVCNSDAAKWENYNNKIRTLS 571
           WL++ F W+RDC+ +C +D  KW     KI  LS
Sbjct: 525 WLDSVFKWDRDCKMLCKTDNRKWAASLGKIAALS 558

>Kwal_26.9278
          Length = 455

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 216 GIEKHEFNEDLLSVVDEDIASIKRKLFDPPTSSDE---------PKSLGPVSTYFQEKYG 266
           G+++HE +E  L+++++ I  IKR L D     DE            +  +     E +G
Sbjct: 324 GLKEHELDEMTLTLINKTIPPIKRALKDAEVQPDEIDEVILVGGMTRMPKIRAVVSETFG 383

Query: 267 VNPDCQIYP 275
            +P+  + P
Sbjct: 384 QDPNTSVNP 392

>AFL112W [3083] [Homologous to ScYGL133W (ITC1) - SH; ScYPL216W -
           SH] complement(227409..230993) [3585 bp, 1194 aa]
          Length = 1194

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 41/104 (39%), Gaps = 3/104 (2%)

Query: 374 NEIGLYF-PLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMFPDKRLDAKNIVESQALSCR 432
           NE G +F    E +  +D  T+  +   I     LT  +    +    KN+ E   L  R
Sbjct: 29  NETGEWFLTYQEYLERLDFYTRHYFTCEITGTSCLTFFDALNSEESQFKNVEERFPLKLR 88

Query: 433 VRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASYAKRPNR 476
             ++  L    N +    +L  ++  KF  DFFP      R NR
Sbjct: 89  EPVARFL--HFNEVRRLDLLVEQVYAKFKTDFFPGEVVYLRKNR 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,607,091
Number of extensions: 863850
Number of successful extensions: 2061
Number of sequences better than 10.0: 11
Number of HSP's gapped: 2061
Number of HSP's successfully gapped: 11
Length of query: 571
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 464
Effective length of database: 12,891,983
Effective search space: 5981880112
Effective search space used: 5981880112
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)