Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09702g21120811021e-155
AFR532W422118790.027
AGR326C20254740.098
CAGL0J08591g119687661.7
Sklu_1951.448263651.9
AEL171C412118642.1
YCL045C760143642.7
KLLA0C13860g117352643.1
KLLA0D15631g117064633.5
CAGL0L11506g105634634.1
AER411W118990624.4
CAGL0A02046g77655616.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09702g
         (208 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09702g 861812..862447 no similarity, hypothetical start         429   e-155
AFR532W [3724] [Homologous to ScYOR301W (RAX1) - SH] complement(...    35   0.027
AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)...    33   0.098
CAGL0J08591g complement(847505..851095) similar to tr|Q12466 Sac...    30   1.7  
Sklu_1951.4 YMR034C, Contig c1951 4379-5827                            30   1.9  
AEL171C [2335] [Homologous to ScYJL059W (YHC3) - SH] (316606..31...    29   2.1  
YCL045C (YCL045C) [500] chr3 complement(44623..46905) Protein of...    29   2.7  
KLLA0C13860g 1189822..1193343 similar to sgd|S0005612 Saccharomy...    29   3.1  
KLLA0D15631g 1319185..1322697 similar to sp|P40851 Saccharomyces...    29   3.5  
CAGL0L11506g 1224624..1227794 highly similar to sp|P12683 Saccha...    29   4.1  
AER411W [2911] [Homologous to ScYOR086C - SH; ScYNL087W - SH] co...    28   4.4  
CAGL0A02046g 211076..213406 similar to sp|Q02805 Saccharomyces c...    28   6.5  

>KLLA0E09702g 861812..862447 no similarity, hypothetical start
          Length = 211

 Score =  429 bits (1102), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%)

Query: 1   MARQTRPAVTRELCEQCIGNTKNAQRMVLLMAQMAAAYEKLGNLRHSDEDKKQSEIIISN 60
           MARQTRPAVTRELCEQCIGNTKNAQRMVLLMAQMAAAYEKLGNLRHSDEDKKQSEIIISN
Sbjct: 1   MARQTRPAVTRELCEQCIGNTKNAQRMVLLMAQMAAAYEKLGNLRHSDEDKKQSEIIISN 60

Query: 61  LESHVIVTTLTLRKLSQRSEQEDLQLLVLYNSTKNAWTRTQYYEIYQLKQFLEEAIISNQ 120
           LESHVIVTTLTLRKLSQRSEQEDLQLLVLYNSTKNAWTRTQYYEIYQLKQFLEEAIISNQ
Sbjct: 61  LESHVIVTTLTLRKLSQRSEQEDLQLLVLYNSTKNAWTRTQYYEIYQLKQFLEEAIISNQ 120

Query: 121 DYDILPQAENVLNGFLFNEDYVKNLPALNEDVKLSQWEIFAREVTQINKTYRIQLDHFGN 180
           DYDILPQAENVLNGFLFNEDYVKNLPALNEDVKLSQWEIFAREVTQINKTYRIQLDHFGN
Sbjct: 121 DYDILPQAENVLNGFLFNEDYVKNLPALNEDVKLSQWEIFAREVTQINKTYRIQLDHFGN 180

Query: 181 SVQRVMNRAKLNTNYPHIEALNIMLNDL 208
           SVQRVMNRAKLNTNYPHIEALNIMLNDL
Sbjct: 181 SVQRVMNRAKLNTNYPHIEALNIMLNDL 208

>AFR532W [3724] [Homologous to ScYOR301W (RAX1) - SH]
           complement(1390773..1392041) [1269 bp, 422 aa]
          Length = 422

 Score = 35.0 bits (79), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 8/118 (6%)

Query: 7   PAVTRELCEQCIGNTKNAQRMVLLMAQMAAAYEKLGNLRHSDEDKKQSEIIISNLESHVI 66
           P ++  L E  +   K +QR  L   Q+ A+   + +     +D  +SE +++ +  H+ 
Sbjct: 154 PHLSLMLDEFLVRQMKESQRPKLTTKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMR 213

Query: 67  VTTLTLRKLSQRSEQEDLQLLVLYNSTKNAWTRTQYYEIYQLKQFLEEAIISNQDYDI 124
           +  + L K  QR + +  + L + +         Q+ EIY   +FL    + N  YDI
Sbjct: 214 LEVINLVKGEQRYDPDVFEPLKIIS--------FQFLEIYCFPKFLSSVALHNLHYDI 263

>AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)
           [609 bp, 202 aa]
          Length = 202

 Score = 33.1 bits (74), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 130 NVLNGFLFNEDYVKNLPALNE----DVKLSQWEIFAREVTQINKTYRIQLDHFG 179
           N  NGF+    +++ LP  N     ++   QW++   E   +N  ++ QL  FG
Sbjct: 117 NCYNGFVHTLQFMRKLPVGNGQVSYEIPAHQWKVLLDEQESMNSNWKAQLKKFG 170

>CAGL0J08591g complement(847505..851095) similar to tr|Q12466
           Saccharomyces cerevisiae YOR086c or sp|P48231
           Saccharomyces cerevisiae YNL087w, hypothetical start
          Length = 1196

 Score = 30.0 bits (66), Expect = 1.7,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 21/87 (24%)

Query: 140 DYVKNLPALNEDVKLSQW----------EIFAREVTQ-INKTYRIQLDHFGNSV------ 182
           DY K  P  + DV +  W          ++ A+++   +N+   ++   FG ++      
Sbjct: 255 DYAKTFPNTDSDVVVMDWGLSFTPHDLSDLNAKQMKNYVNQKILVKAKLFGMTIPVTVAN 314

Query: 183 ----QRVMNRAKLNTNYPHIEALNIML 205
                +   R KL T +PH+E +NI L
Sbjct: 315 VAFKAKTRIRFKLMTPFPHVETINIQL 341

>Sklu_1951.4 YMR034C, Contig c1951 4379-5827
          Length = 482

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 46  HSDEDKKQSEIIISNLESHVIVTTLTLRKLSQR-SEQEDLQ--LLVLYNSTKNAWTRTQY 102
            S    +Q E   SN++ H+IV  L   + +QR S  E L+  L +LYN+T   +  +Q+
Sbjct: 18  FSGRGIRQDEKCDSNIKDHMIVRNLCYIRWAQRCSTMEKLKRGLKILYNNTVTQFVISQW 77

Query: 103 YEI 105
           + I
Sbjct: 78  FFI 80

>AEL171C [2335] [Homologous to ScYJL059W (YHC3) - SH]
           (316606..317844) [1239 bp, 412 aa]
          Length = 412

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 50/118 (42%), Gaps = 6/118 (5%)

Query: 85  QLLVLYNSTKNAWTRTQYYEIYQLKQFLEEAIISNQDYDILPQAENVL------NGFLFN 138
           QL V  + +  +W R +   +  + QFL   I+  Q +  +  +  V+       G L  
Sbjct: 290 QLGVFISRSSGSWVRIRGLYLLSVLQFLNLVILLIQSWYYVIHSVWVIMAIVLYEGLLGG 349

Query: 139 EDYVKNLPALNEDVKLSQWEIFAREVTQINKTYRIQLDHFGNSVQRVMNRAKLNTNYP 196
             YV +   ++EDV L++ E     V+  + +  +     G  ++ V+   ++ T  P
Sbjct: 350 ASYVNSFLNISEDVPLAEREFSLGAVSISDSSGTLVAAFIGILLEPVLCSHQVKTGRP 407

>YCL045C (YCL045C) [500] chr3 complement(44623..46905) Protein of
           unknown function [2283 bp, 760 aa]
          Length = 760

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 58/143 (40%), Gaps = 27/143 (18%)

Query: 80  EQEDLQLLVLYNSTKNAWTRTQYYEIYQLKQFLEEAIISNQDYDILPQAENVLNGFLFNE 139
           +  D   +V  NS+ N W +   ++ +     LEE + +     ILPQ+      +L ++
Sbjct: 95  DSNDHNAMVCVNSSSNHWQKYDLHDWF----LLEEGVDNAPSTTILPQS-----SYLNDQ 145

Query: 140 DYVKN--LPALNEDVKLSQW-----------EIFARE-----VTQINKTYRIQLDHFGNS 181
             +KN  L  L+E  KL++W           E F RE     V  +N T  +     G  
Sbjct: 146 VSIKNNELHILDEQSKLAEWKLELPQGFNKVEYFHREDPLALVLNVNDTQYMGFSANGTE 205

Query: 182 VQRVMNRAKLNTNYPHIEALNIM 204
           +  V  R +  TN      L++ 
Sbjct: 206 LIPVWQRDEWLTNVVDYAVLDVF 228

>KLLA0C13860g 1189822..1193343 similar to sgd|S0005612 Saccharomyces
           cerevisiae YOR086c, start by similarity
          Length = 1173

 Score = 29.3 bits (64), Expect = 3.1,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 10/52 (19%)

Query: 167 INKTYRIQLDHFGNSV----------QRVMNRAKLNTNYPHIEALNIMLNDL 208
           +N+T  ++   FG +V           RV  R KL T +PHIE +NI   D+
Sbjct: 269 VNQTVVLKAKLFGLTVPVVVADIAFKARVRVRMKLMTPFPHIETVNIQFLDV 320

>KLLA0D15631g 1319185..1322697 similar to sp|P40851 Saccharomyces
           cerevisiae YPR122w AXL1 protease, start by similarity
          Length = 1170

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 10/64 (15%)

Query: 46  HSDEDKKQSEIIISNLESHVIVTTLTLRKLSQRSEQEDLQLLVLYNSTKNAWTRTQ---- 101
           H+D D+      +++L  H+I+++ + +K  +RS   DL  L+ YN  +NA+T  +    
Sbjct: 57  HNDPDEVPG---LAHLCEHMIISSES-KKFPKRSHYHDL--LIEYNGNQNAFTTGEQTSF 110

Query: 102 YYEI 105
           Y+EI
Sbjct: 111 YFEI 114

>CAGL0L11506g 1224624..1227794 highly similar to sp|P12683
           Saccharomyces cerevisiae YML075c HMG1 or sp|P12684
           Saccharomyces cerevisiae YLR450w HMG2, start by
           similarity
          Length = 1056

 Score = 28.9 bits (63), Expect = 4.1,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 108 LKQFLEEAIISNQDYDILPQAENVLNGFLFNEDY 141
           +KQ LEE  I +   DI+ ++EN     LFN +Y
Sbjct: 371 IKQTLEEDGIVSTTADIISKSENKSRNLLFNSNY 404

>AER411W [2911] [Homologous to ScYOR086C - SH; ScYNL087W - SH]
           complement(1425883..1429452) [3570 bp, 1189 aa]
          Length = 1189

 Score = 28.5 bits (62), Expect = 4.4,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 42/90 (46%), Gaps = 21/90 (23%)

Query: 140 DYVKNLPALNEDVKLSQW----------EIFAREVTQ-INKTYRIQLDHFGNSVQRVMN- 187
           D+V+ L   + DV +  W          ++ A+++   +N+   ++   FG ++   ++ 
Sbjct: 244 DFVRTLQNTDPDVAVMDWGLSFTPRDLNDLDAKQLKNFVNQKVIVKAKLFGITIPVAVHD 303

Query: 188 ---------RAKLNTNYPHIEALNIMLNDL 208
                    R K+ T +PHIE +NI L D+
Sbjct: 304 IAFKVHARVRMKMMTAFPHIETVNIQLMDV 333

>CAGL0A02046g 211076..213406 similar to sp|Q02805 Saccharomyces
           cerevisiae YOR018w ROD1, start by similarity
          Length = 776

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%)

Query: 141 YVKNLPALNEDVKLSQWEIFAREVTQINKTYRIQLDHFGNSVQRVMNRAKLNTNY 195
           Y +NL   N +   +  + FA E+T ++  +  +  H    ++R  +RA LN+N+
Sbjct: 706 YGQNLGVNNYNKGSTASKKFAFEMTPVDSNHNFEESHSSIPMERASSRASLNSNH 760

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,701,850
Number of extensions: 283657
Number of successful extensions: 1013
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1011
Number of HSP's successfully gapped: 27
Length of query: 208
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 111
Effective length of database: 13,238,163
Effective search space: 1469436093
Effective search space used: 1469436093
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)