Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09680g30730214660.0
Kwal_33.1544630528912141e-169
Sklu_2075.334528511871e-164
CAGL0B03883g30630011201e-155
CAGL0K12210g3112923304e-36
CAGL0D01606g3052803149e-34
Sklu_1926.23052833034e-32
Scas_718.53242852992e-31
YPR058W (YMC1)3072852947e-31
Scas_667.223062872947e-31
YOR130C (ORT1)2922912884e-30
KLLA0B08503g3032972885e-30
Sklu_2398.43093072861e-29
YBR104W (YMC2)3292932819e-29
Kwal_33.129883033062772e-28
CAGL0K10362g3012892711e-27
Sklu_2127.52782742701e-27
Scas_632.92923012701e-27
KLLA0E02772g2842762561e-25
Kwal_27.125993042802534e-25
Kwal_26.86692962712482e-24
Kwal_56.230113033092483e-24
Kwal_55.213353172722474e-24
CAGL0J02002g3612942486e-24
AFR146W2812732447e-24
Sklu_1275.13113082449e-24
KLLA0F17864g3072862441e-23
Scas_714.183052942361e-22
ACR109W2992842308e-22
YIL006W3732952338e-22
YOR222W (ODC2)3073042282e-21
Kwal_47.173218812842332e-21
Scas_709.93653022267e-21
KLLA0E13453g9062922281e-20
ADL264C3292992203e-20
ADL049W9122982236e-20
Scas_640.253062902167e-20
KLLA0D07073g2972712159e-20
YPR021C (AGC1)9022792211e-19
Sklu_2431.53703022171e-19
ADL009W3793022152e-19
Kwal_55.208683803112143e-19
CAGL0K02365g9192792121e-18
Kwal_27.120813692992072e-18
Scas_721.273743062055e-18
YOR100C (CRC1)3272892036e-18
KLLA0E23705g3683432021e-17
Scas_697.473283012002e-17
KLLA0C13431g3283081992e-17
Sklu_2359.69022832032e-17
YEL006W3352901992e-17
CAGL0J04114g3032821973e-17
CAGL0B04543g3172841965e-17
Kwal_23.47313142851948e-17
Scas_589.103162851949e-17
Scas_602.88852801952e-16
Kwal_23.29133202941913e-16
YPL134C (ODC1)3102931842e-15
KLLA0D14036g4313171835e-15
CAGL0K11616g3202031799e-15
AEL253W3653001772e-14
KLLA0F04697g3073061735e-14
KLLA0B12826g3193101622e-12
AGL311C3623071613e-12
Sklu_2430.103243081595e-12
Sklu_2363.23233261586e-12
Kwal_26.76533251881552e-11
YKL120W (OAC1)3241851532e-11
YNL083W5451771553e-11
CAGL0M05225g3813071533e-11
KLLA0D15015g3171731524e-11
AER419W4931771535e-11
YBR192W (RIM2)3773211525e-11
Kwal_23.39653071631506e-11
KLLA0C11363g5171801526e-11
Sklu_2037.23102981507e-11
Sklu_2334.23192971507e-11
Scas_721.1293232901498e-11
YMR166C3682881491e-10
YMR056C (AAC1)3092021471e-10
CAGL0G08910g2892891452e-10
Scas_718.243371571453e-10
Sklu_1149.22962871443e-10
Scas_667.43082781434e-10
Kwal_27.124813041571435e-10
CAGL0J05522g5191891445e-10
Scas_489.42971851427e-10
Scas_662.123082901418e-10
Sklu_2432.52882691419e-10
CAGL0F04213g3062721419e-10
YBL030C (PET9)3181761391e-09
CAGL0K02915g3423481402e-09
KLLA0F03212g3053001392e-09
AER184W3051571382e-09
CAGL0F07711g3681681382e-09
YGR096W (TPC1)3141971373e-09
YBR085W (AAC3)3071761373e-09
AER366W2931881363e-09
CAGL0G03135g3073091373e-09
KLLA0E12353g3051571363e-09
Scas_379.23011751364e-09
Scas_578.3*5241811374e-09
CAGL0G01166g2952841355e-09
AGL065C3351871356e-09
CAGL0L02079g2971651347e-09
Scas_328.12271671311e-08
Sklu_2374.75131811341e-08
KLLA0E18810g3771841331e-08
Kwal_23.30425421771331e-08
YPR011C3263041302e-08
Scas_716.293162961302e-08
Kwal_23.35293952691303e-08
Kwal_55.213383231671293e-08
YBR291C (CTP1)2992981275e-08
YIL134W (FLX1)3112831275e-08
Sklu_2115.42991721266e-08
CAGL0J01661g3273031267e-08
CAGL0K08250g2972801268e-08
CAGL0D04774g3222791259e-08
Kwal_26.79672972711251e-07
AFR147C3152521241e-07
ACR260W3112001231e-07
Kwal_55.211063282971232e-07
KLLA0E02750g3041801232e-07
AAR036W3171541223e-07
Kwal_14.22103152931213e-07
Sklu_2433.8420821214e-07
CAGL0L05742g3052921204e-07
Scas_669.63732791214e-07
KLLA0A00979g343961204e-07
YJL133W (MRS3)3141741196e-07
AFR253W344761188e-07
Scas_691.43343231188e-07
Scas_715.453051901179e-07
Scas_717.203562331171e-06
Kwal_47.19228281911161e-06
YJR095W (SFC1)3223051161e-06
KLLA0E15532g3261921161e-06
AGR383W2931671152e-06
YKR052C (MRS4)3042811152e-06
Scas_582.73292891152e-06
AGL047C3163071143e-06
Scas_613.241771741094e-06
KLLA0B11319g3551351125e-06
Sklu_2127.43231721125e-06
CAGL0M09020g3483351117e-06
Scas_705.93232921109e-06
Scas_687.15*328921109e-06
YHR002W (LEU5)3573111109e-06
Sklu_2442.82752681081e-05
Kwal_26.79723581591072e-05
YMR241W (YHM2)3142551062e-05
Sklu_2435.23442191063e-05
CAGL0H10538g2971811044e-05
YPR128C (ANT1)3282851036e-05
Kwal_33.140503141931027e-05
AFL196W3611791028e-05
AAL014C271268991e-04
Kwal_27.11419298172992e-04
Kwal_47.18216333316983e-04
Kwal_34.15907312256983e-04
Scas_645.9391274983e-04
KLLA0D09889g364279983e-04
KLLA0D04290g188175953e-04
ABL023W309118964e-04
YLR348C (DIC1)298278964e-04
YER053C300185964e-04
AGL064W296149965e-04
YFR045W285195955e-04
ADR036C340163956e-04
AGR191W29862956e-04
CAGL0C02013g32983956e-04
AFR542W310254930.001
Scas_702.10302275910.002
Sklu_2260.5302162910.002
Scas_562.1230073910.002
AFR131C344265910.002
Kwal_23.435434382910.002
Kwal_27.1162629972880.004
KLLA0D04950g274268870.005
KLLA0F08547g308258870.005
YDL198C (YHM1)30072860.007
Sklu_2117.229872860.008
KLLA0E18788g38178850.010
YGR257C (MTM1)366269840.013
KLLA0E08877g294172830.019
YNL003C (PET8)284265820.021
Scas_558.2289268820.021
CAGL0H03839g282269820.022
CAGL0J09790g30072810.027
CAGL0K07436g307256810.033
KLLA0F13464g30062810.034
YDL119C307167790.059
KLLA0D04312g10382740.071
Scas_696.9312253780.076
CAGL0F08305g374274740.22
Sklu_1982.347635730.39
Kwal_23.5757307164720.40
Kwal_0.232274269710.51
KLLA0B14454g305146710.57
Sklu_2194.3312192700.66
KLLA0A09383g36676691.00
Scas_673.17314153691.0
Kwal_33.15597305146671.6
Sklu_1119.130765652.7
CAGL0F00231g307110643.5
YJR077C (MIR1)311111626.2
Sklu_1578.326847626.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09680g
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   569   0.0  
Kwal_33.15446                                                         472   e-169
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               461   e-164
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   436   e-155
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   131   4e-36
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   125   9e-34
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         121   4e-32
Scas_718.5                                                            119   2e-31
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   117   7e-31
Scas_667.22                                                           117   7e-31
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   115   4e-30
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   115   5e-30
Sklu_2398.4 , Contig c2398 9476-10405                                 114   1e-29
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   112   9e-29
Kwal_33.12988                                                         111   2e-28
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   108   1e-27
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        108   1e-27
Scas_632.9                                                            108   1e-27
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   103   1e-25
Kwal_27.12599                                                         102   4e-25
Kwal_26.8669                                                          100   2e-24
Kwal_56.23011                                                         100   3e-24
Kwal_55.21335                                                         100   4e-24
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...   100   6e-24
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    99   7e-24
Sklu_1275.1 , Contig c1275 314-1249                                    99   9e-24
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    99   1e-23
Scas_714.18                                                            96   1e-22
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    93   8e-22
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    94   8e-22
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    92   2e-21
Kwal_47.17321                                                          94   2e-21
Scas_709.9                                                             92   7e-21
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    92   1e-20
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    89   3e-20
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    91   6e-20
Scas_640.25                                                            88   7e-20
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    87   9e-20
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    90   1e-19
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            88   1e-19
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    87   2e-19
Kwal_55.20868                                                          87   3e-19
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    86   1e-18
Kwal_27.12081                                                          84   2e-18
Scas_721.27                                                            84   5e-18
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    83   6e-18
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    82   1e-17
Scas_697.47                                                            82   2e-17
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    81   2e-17
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          83   2e-17
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    81   2e-17
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    80   3e-17
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    80   5e-17
Kwal_23.4731                                                           79   8e-17
Scas_589.10                                                            79   9e-17
Scas_602.8                                                             80   2e-16
Kwal_23.2913                                                           78   3e-16
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    75   2e-15
KLLA0D14036g complement(1203522..1204817) some similarities with...    75   5e-15
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    74   9e-15
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    73   2e-14
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    71   5e-14
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    67   2e-12
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    67   3e-12
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         66   5e-12
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          65   6e-12
Kwal_26.7653                                                           64   2e-11
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    64   2e-11
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    64   3e-11
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    64   3e-11
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    63   4e-11
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    64   5e-11
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    63   5e-11
Kwal_23.3965                                                           62   6e-11
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    63   6e-11
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         62   7e-11
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         62   7e-11
Scas_721.129                                                           62   8e-11
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    62   1e-10
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    61   1e-10
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    60   2e-10
Scas_718.24                                                            60   3e-10
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         60   3e-10
Scas_667.4                                                             60   4e-10
Kwal_27.12481                                                          60   5e-10
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    60   5e-10
Scas_489.4                                                             59   7e-10
Scas_662.12                                                            59   8e-10
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       59   9e-10
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    59   9e-10
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    58   1e-09
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    59   2e-09
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    58   2e-09
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    58   2e-09
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    58   2e-09
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    57   3e-09
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    57   3e-09
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    57   3e-09
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    57   3e-09
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    57   3e-09
Scas_379.2                                                             57   4e-09
Scas_578.3*                                                            57   4e-09
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    57   5e-09
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    57   6e-09
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    56   7e-09
Scas_328.1                                                             55   1e-08
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       56   1e-08
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    56   1e-08
Kwal_23.3042                                                           56   1e-08
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    55   2e-08
Scas_716.29                                                            55   2e-08
Kwal_23.3529                                                           55   3e-08
Kwal_55.21338                                                          54   3e-08
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    54   5e-08
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    54   5e-08
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            53   6e-08
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    53   7e-08
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    53   8e-08
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    53   9e-08
Kwal_26.7967                                                           53   1e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    52   1e-07
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    52   1e-07
Kwal_55.21106                                                          52   2e-07
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    52   2e-07
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    52   3e-07
Kwal_14.2210                                                           51   3e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       51   4e-07
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    51   4e-07
Scas_669.6                                                             51   4e-07
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    51   4e-07
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    50   6e-07
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    50   8e-07
Scas_691.4                                                             50   8e-07
Scas_715.45                                                            50   9e-07
Scas_717.20                                                            50   1e-06
Kwal_47.19228                                                          49   1e-06
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    49   1e-06
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    49   1e-06
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    49   2e-06
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    49   2e-06
Scas_582.7                                                             49   2e-06
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    49   3e-06
Scas_613.24                                                            47   4e-06
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    48   5e-06
Sklu_2127.4 , Contig c2127 6322-7293                                   48   5e-06
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    47   7e-06
Scas_705.9                                                             47   9e-06
Scas_687.15*                                                           47   9e-06
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    47   9e-06
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          46   1e-05
Kwal_26.7972                                                           46   2e-05
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    45   2e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         45   3e-05
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    45   4e-05
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    44   6e-05
Kwal_33.14050                                                          44   7e-05
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    44   8e-05
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    43   1e-04
Kwal_27.11419                                                          43   2e-04
Kwal_47.18216                                                          42   3e-04
Kwal_34.15907                                                          42   3e-04
Scas_645.9                                                             42   3e-04
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    42   3e-04
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    41   3e-04
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    42   4e-04
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    42   4e-04
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    42   4e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    42   5e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    41   5e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    41   6e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    41   6e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    41   6e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    40   0.001
Scas_702.10                                                            40   0.002
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         40   0.002
Scas_562.12                                                            40   0.002
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    40   0.002
Kwal_23.4354                                                           40   0.002
Kwal_27.11626                                                          39   0.004
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    38   0.005
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    38   0.005
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    38   0.007
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            38   0.008
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    37   0.010
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    37   0.013
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    37   0.019
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    36   0.021
Scas_558.2                                                             36   0.021
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    36   0.022
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    36   0.027
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    36   0.033
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    36   0.034
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    35   0.059
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    33   0.071
Scas_696.9                                                             35   0.076
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    33   0.22 
Sklu_1982.3 YDL238C, Contig c1982 3793-5223                            33   0.39 
Kwal_23.5757                                                           32   0.40 
Kwal_0.232                                                             32   0.51 
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    32   0.57 
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            32   0.66 
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    31   1.00 
Scas_673.17                                                            31   1.0  
Kwal_33.15597                                                          30   1.6  
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             30   2.7  
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    29   3.5  
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    28   6.2  
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            28   6.6  

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/302 (92%), Positives = 279/302 (92%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF 60
           MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF
Sbjct: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF 60

Query: 61  KGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP 120
           KGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP
Sbjct: 61  KGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP 120

Query: 121 LSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLY 180
           LSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLY
Sbjct: 121 LSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLY 180

Query: 181 KGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDV 240
           KGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAIN               AYPSDV
Sbjct: 181 KGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDV 240

Query: 241 VKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVL 300
           VKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP        FEFVL
Sbjct: 241 VKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVL 300

Query: 301 RT 302
           RT
Sbjct: 301 RT 302

>Kwal_33.15446
          Length = 305

 Score =  472 bits (1214), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 217/289 (75%), Positives = 246/289 (85%)

Query: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72
           N+++ NE YSR+MGFV+G+FSG+AKNAVGHPFDTIKVRLQTSQ+  RFKGPLDCVY+T R
Sbjct: 8   NAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMR 67

Query: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132
            QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRML+ KYVY ++EKLPLSGCI+SGVLAG
Sbjct: 68  QQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAG 127

Query: 133 WSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH 192
           WSVSFIA P+ELAKAKLQVQYD  TTRY+GPLDVIKK+Y+A GIRG+YKGL+STLIFRTH
Sbjct: 128 WSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTH 187

Query: 193 FVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
           FVYWWGSYELLTRWF+ NT +S+ AIN               AYPSDV+KQV+LCNDKYD
Sbjct: 188 FVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYD 247

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           GS +SWR A  DI++++GI GFFKGFVPSFLRSFP        FEFVLR
Sbjct: 248 GSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLR 296

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  461 bits (1187), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 217/285 (76%), Positives = 244/285 (85%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77
           +E YSRIMGFV+G+FSG+AKNAVGHPFDTIKVRLQTSQ+ TRFKGPLDCVYKTF  QGIR
Sbjct: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIR 114

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSF 137
           GFYLGFTPPLVGWILMDSVMLGCLHNYRML+ KYVY N+EKLPLSGCIISGV+AGWSVSF
Sbjct: 115 GFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSF 174

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWW 197
           IA P+ELAKAKLQVQYD  TT+Y GP+DVIKK+YS+ G+RGLYKGL STLIFRT+FV+WW
Sbjct: 175 IAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWW 234

Query: 198 GSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKS 257
           GSYELLTRWF+E+T MS+ AIN               AYPSDV+KQVVLCNDKYDG+F+S
Sbjct: 235 GSYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYDGTFRS 294

Query: 258 WRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 302
           W+ A KDI++++G  GFFKGFVPSFLRSFP        FEFVLRT
Sbjct: 295 WKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRT 339

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  436 bits (1120), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 241/300 (80%), Gaps = 12/300 (4%)

Query: 15  LISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET----RFKGPLDCVYKT 70
           ++S ETYSR+MGFVAG+FSGVAKN VGHPFDT+KVRLQTSQ  +    +FKGPLDCVYKT
Sbjct: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
            +NQGIRG YLGFTPPL GWI+MDS +LG LHNYRML+HKYVYP  +KLPLSGCIISGV+
Sbjct: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSA--------QGIRGLYKG 182
           AGW+VSFIA P+ELAKAKLQVQYD  TT+Y GP+DV++K++           G+R LYKG
Sbjct: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 183 LISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK 242
           LISTLIFR++FV+WWGSYEL+T+WF++NT +S  AIN               AYPSDVVK
Sbjct: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240

Query: 243 QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 302
           QVVLCNDKYDGSFKSWRTAV DIY+ +GI+GFFKGF+PSFLRSFP        FEFVLRT
Sbjct: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVLRT 300

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  131 bits (330), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 142/292 (48%), Gaps = 17/292 (5%)

Query: 21  YSRIMGFV-AGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGF 79
           Y R++  + AG   GVA+  VG PFDT KVRLQTS+ +    G ++ V    RN+G   F
Sbjct: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---GVIEVVQNLLRNEGALAF 79

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKY----VYPNDE-KLPLSGCIISGVLAGWS 134
           Y G   PL+G  +  SV  G   + +     Y    V P     LPL    + G+  G  
Sbjct: 80  YKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVV 139

Query: 135 VSFIAPPIELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF 193
            SF+A PIE  + +LQ Q  +   R +KGP D IKK+  A   + L +GL+ T+I   H 
Sbjct: 140 NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHG 196

Query: 194 V-YWWGSYE-LLTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDK 250
           +  ++ +YE L+ + F + T  ++  A                  YP DVVK V+  +  
Sbjct: 197 LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSI 256

Query: 251 YDGSFK-SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
            +  +K S   A + +Y+  GI  FFKGFVP+ +R+ P        FE  +R
Sbjct: 257 ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMR 308

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  125 bits (314), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 131/280 (46%), Gaps = 11/280 (3%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG   G+A+  +G PFDT KVRLQTS+  T      + V    +N+G +GFY G   P
Sbjct: 29  LLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAA---EVVKNLLKNEGPKGFYKGTLTP 85

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146
           LVG     S+  G     +   H     ++  L LS   + G+  G + SF+A PIE  +
Sbjct: 86  LVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVR 145

Query: 147 AKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH--FVYWWGSYELL 203
            +LQ Q        +KGP+D IKK+ S    +GL +GLI T++   H    Y+     L+
Sbjct: 146 IRLQTQTGSGAQAEFKGPIDCIKKLRSQ---KGLMRGLIPTMLREGHGCGTYFLVYEALV 202

Query: 204 TRWFRENTKMSEAAI-NXXXXXXXXXXXXXXXAYPSDVVKQVVLCND-KYDGSFKSWRTA 261
           ++   +  K +E                     YP DVVK V+  ++     + K+    
Sbjct: 203 SKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQV 262

Query: 262 VKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
            +++Y  +G+  FFKGF P+ LR+ P        FE  +R
Sbjct: 263 ARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMR 302

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  121 bits (303), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 126/283 (44%), Gaps = 15/283 (5%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG   GV++  +G PFDT KVRLQTS   T     LD V K  +N+G RGFY G   P
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT---ALDVVKKLVKNEGFRGFYKGTLTP 83

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKY---VYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
           LVG     SV  G     +   H       PN E L L    + G   G + SF+A PIE
Sbjct: 84  LVGVGACVSVQFGVNEAMKRFFHSRNGNSGPN-ETLGLLQYYLCGFAGGTANSFLASPIE 142

Query: 144 LAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF--VYWWGSY 200
             + +LQ Q       ++ GPLD IKK+ +      L +GL  T++  +H   VY+    
Sbjct: 143 HVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNS---LMRGLTPTMLRESHGCGVYFLTYE 199

Query: 201 ELLTRWFRENTKMSEAAI-NXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD-GSFKSW 258
            L+     +    SE                     YP DV+K V+  +        K+ 
Sbjct: 200 ALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNM 259

Query: 259 RTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
               K IY ++G++ FFKGF P+ LR+ P        FE  +R
Sbjct: 260 LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMR 302

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 17/179 (9%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQN---ETRFKGPLDCVYKTFRNQ 74
           NET   +  ++ G   G A + +  P + +++RLQT        +F GPLDC+ K   N 
Sbjct: 115 NETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN 174

Query: 75  GIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRML----MHKYVYPNDEKLPLSGCIISGV 129
            +     G TP +    L +S   G     Y  L    +HK V  +  ++P     + G 
Sbjct: 175 SL---MRGLTPTM----LRESHGCGVYFLTYEALIANELHKGV--SRSEIPTWKLCLFGA 225

Query: 130 LAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
            +G ++  +  P+++ K+ +Q        + K  L V K IYS +G+   +KG   T++
Sbjct: 226 TSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTML 284

>Scas_718.5
          Length = 324

 Score =  119 bits (299), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 133/285 (46%), Gaps = 16/285 (5%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG   G+++  VG PFDT KVR+QTS       G LD + K  +N+G+  FY G   P
Sbjct: 43  ILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---GALDIIRKLVKNEGVWAFYKGSLIP 99

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKY-----VYPNDEKLPLSGCIISGVLAGWSVSFIAPP 141
           +VG     SV  G     +    ++         D  L L    I G+  G   SF+A P
Sbjct: 100 IVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASP 159

Query: 142 IELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV-YWWGS 199
           IE  + +LQ Q      R +KGPLD I+K+      + L +GL   ++   H +  ++ +
Sbjct: 160 IEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216

Query: 200 YE-LLTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK- 256
           YE L+    ++    SE A+                  YP DVVK ++  +   +  FK 
Sbjct: 217 YEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKN 276

Query: 257 SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           S +  +  +Y+ +GI+ FFKGF P+ LR+ P        FE V+R
Sbjct: 277 SMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMR 321

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  117 bits (294), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 120/285 (42%), Gaps = 19/285 (6%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG   G+A+  VG PFDT KVRLQTS   T     ++ V K   N+G RGFY G   P
Sbjct: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVVRKLLANEGPRGFYKGTLTP 85

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146
           L+G     S+  G     +   H         L L      GV  G   SF+A PIE  +
Sbjct: 86  LIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVR 145

Query: 147 AKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTR 205
            +LQ Q    T   +KGPL+ IKK+      + L +GL  T++   H     G+Y L+  
Sbjct: 146 IRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGH---GCGTYFLVYE 199

Query: 206 WFRENTKMSEAAINXXXX--------XXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSF-K 256
               N       +                         YP DV+K V+  ++     F  
Sbjct: 200 ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN 259

Query: 257 SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           S  +  K +Y + GI  FFKGF P+ LR+ P        FE  +R
Sbjct: 260 SISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMR 304

>Scas_667.22
          Length = 306

 Score =  117 bits (294), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 129/287 (44%), Gaps = 18/287 (6%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           I   +AG   G+A+  VG PFDT KVRLQTS   T     ++ + K  +N+G +GFY G 
Sbjct: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVIRKLLKNEGPKGFYKGT 82

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMH-KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPI 142
             PL+G     S+  G     +   H +      + L L    I G+  G + SF+A PI
Sbjct: 83  LTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLASPI 142

Query: 143 ELAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH--FVYWWGS 199
           E  + +LQ Q        +KGPLD I+K+  AQG  G  +GL  T++   H    Y+   
Sbjct: 143 EHVRIRLQTQTGSGPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLREGHGCGTYFLVY 199

Query: 200 YELLTRWFRENTKMSEA-AINXXXXXXXXXXXXXXXAYPSDVVKQVVLCND----KYDGS 254
             ++     +  K +E  A                  YP DV+K V+  ++    KY  S
Sbjct: 200 EAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS 259

Query: 255 FKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
             S     K +Y   G+  FFKGF P+ LR+ P        FE  +R
Sbjct: 260 ISS---VAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMR 303

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  115 bits (288), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 131/291 (45%), Gaps = 34/291 (11%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLG 82
           I+  + G  +G     +  PFDT+KVRLQT Q    F     C+  T++N+GI RGF+ G
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQT-QASNVFPTTWSCIKFTYQNEGIARGFFQG 72

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMH-----KYVYPNDEKLPLSGCIISGVLAGWSVSF 137
              PLVG          CL N  + +      K++  +    PL   +ISG +AG   S 
Sbjct: 73  IASPLVG---------ACLENATLFVSYNQCSKFLEKHTNVFPLGQILISGGVAGSCASL 123

Query: 138 IAPPIELAKAKLQV---QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF- 193
           +  P+EL K KLQV   Q     T++   L  IK I + +G+ GL++G   T I R  F 
Sbjct: 124 VLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFI-RESFG 182

Query: 194 -VYWWGSYELLTRWFR-----ENTKMSEAAI-NXXXXXXXXXXXXXXXAYPSDVVKQVVL 246
            V W+ +YE++ +  +     ++ K  E+ I                  +P+D VK V+ 
Sbjct: 183 GVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVM- 241

Query: 247 CNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
                     S   AVK I+   G+ GF++G   +  R+ P        FE
Sbjct: 242 -----QTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  115 bits (288), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 89/297 (29%), Positives = 137/297 (46%), Gaps = 14/297 (4%)

Query: 12  VNSLISNETYSRIM-GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT 70
           ++ L S    +R++   +AG   G+A+  VG PFDT KVRLQTS+  T     +  +   
Sbjct: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN---AVKVIKDL 67

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
            +N+G  GFY G   PLVG     S+  G     +   H +     + L L    I GV 
Sbjct: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVA 127

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRG-LYKGLISTLI 188
            G++ SF+A PIE  + +LQ Q     T  +KGP+D IKK+     + G L +GL  T++
Sbjct: 128 GGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLR----VNGQLMRGLTPTML 183

Query: 189 FRTH--FVYWWGSYELLTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQVV 245
             +H   VY+     L+    +   +  +  A                  YP DV+K V+
Sbjct: 184 RESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVM 243

Query: 246 LCND-KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
             ++ K   +  +  T  + I   +G++G FKGF P+ LR+ P        FE  +R
Sbjct: 244 QTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMR 300

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  114 bits (286), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 140/307 (45%), Gaps = 18/307 (5%)

Query: 5   SNAITEP--VNSLISNETYSR-IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK 61
           S+ +T P  V+ L  +  Y R I   ++G   G+A+  VG PFD  KVR+QTS       
Sbjct: 2   SDELTAPQVVDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSAT-- 59

Query: 62  GPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPL 121
             +D V    +N+GI GFY G   PLVG     S   G     +    +      + L L
Sbjct: 60  -AVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSL 118

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLY 180
               + GV +G + +F+A PIE  + +LQ+Q        Y+G LD ++K+   QG   L 
Sbjct: 119 KQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLK-QG--ALM 175

Query: 181 KGLISTLIFRTH-FVYWWGSYE-LLTRWFRENTKMSEAAI-NXXXXXXXXXXXXXXXAYP 237
           +G  +TL+   H F  ++ +YE L+    ++     + A                  AYP
Sbjct: 176 RGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYP 235

Query: 238 SDVVKQVVLCNDKYDGSFKS---WRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXX 294
            DVVK + + +D+          W+ A K IY ++G   F KGF+P+ LRS P       
Sbjct: 236 IDVVKSI-MQSDRLVSPVHGTNVWQVA-KSIYTTRGKRAFIKGFMPAMLRSLPVNGATFA 293

Query: 295 XFEFVLR 301
            FE  +R
Sbjct: 294 TFEMTMR 300

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  112 bits (281), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 132/293 (45%), Gaps = 28/293 (9%)

Query: 29  AGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLV 88
           AG   G+A+  VG PFDT KVRLQT+   T     L+ +    +N+G+  FY G   PL+
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT---LEVLRNLVKNEGVFAFYKGALTPLL 96

Query: 89  GWILMDSVMLGCLHNYRMLMHKY---VYPN----------DEKLPLSGCIISGVLAGWSV 135
           G  +  SV  G     +     Y     PN             LPLS   + G+  G   
Sbjct: 97  GVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVN 156

Query: 136 SFIAPPIELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV 194
           SF+A PIE  + +LQ Q      R +KGP D IKK+  AQG  GL +GL  T+I   H +
Sbjct: 157 SFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKL-KAQG--GLMRGLFPTMIRAGHGL 213

Query: 195 -YWWGSYELLTRWFRE-NTKMSEAAI---NXXXXXXXXXXXXXXXAYPSDVVKQVVLCND 249
             ++  YE L    RE  T ++   I                    YP DVVK ++  +D
Sbjct: 214 GTYFLVYEALVA--REIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDD 271

Query: 250 KYDGSFK-SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
                +K S     K IY  +GI  FFKGF P+ +RS P        FE V+R
Sbjct: 272 LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMR 324

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 104/220 (47%), Gaps = 23/220 (10%)

Query: 2   SKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQN---ET 58
           SK+ N  ++ V+   SN T      +V G+  GV  + +  P + I++RLQT  +   + 
Sbjct: 122 SKNPNMSSQDVDLSRSN-TLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 59  RFKGPLDCVYKTFRNQGIRGFYLGFTPPLV--GWILMDSVMLGCLHNYRMLMHKYV---Y 113
            FKGP DC+ K  + QG  G   G  P ++  G  L    ++     Y  L+ + +    
Sbjct: 181 EFKGPWDCI-KKLKAQG--GLMRGLFPTMIRAGHGLGTYFLV-----YEALVAREIGTGL 232

Query: 114 PNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLD-VIKKIYS 172
             +E  P   C+  G  +G  +     P+++ K+ +Q   D    +YK  +  V K IY+
Sbjct: 233 TRNEIPPWKLCLF-GAFSGTMLWLTVYPLDVVKSIIQ-NDDLRKPKYKNSISYVAKTIYA 290

Query: 173 AQGIRGLYKGLISTLIFRTHFV--YWWGSYELLTRWFREN 210
            +GIR  +KG   T++ R+  V    + ++EL+ R+  E 
Sbjct: 291 KEGIRAFFKGFGPTMV-RSAPVNGATFLTFELVMRFLGEE 329

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 76/198 (38%), Gaps = 27/198 (13%)

Query: 109 HKYVYPNDEKLPLSGC-----IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP 163
            K   PN EK  LS       I +G + G +   +  P +  K +LQ    +TTT     
Sbjct: 18  QKVTTPN-EKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT----- 71

Query: 164 LDVIKKIYSAQGIRGLYKGLISTLIFRTHFV-YWWGSYELLTRWFR-----ENTKMSEAA 217
           L+V++ +   +G+   YKG ++ L+     V   +G  E + R+F+     +N  MS   
Sbjct: 72  LEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQD 131

Query: 218 INXXXXXXXXXXXXXXXAYPSDVVK----------QVVLCNDKYDGSFKSWRTAVKDIYQ 267
           ++                    VV           ++ L     +G  + ++     I +
Sbjct: 132 VDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKK 191

Query: 268 SKGINGFFKGFVPSFLRS 285
            K   G  +G  P+ +R+
Sbjct: 192 LKAQGGLMRGLFPTMIRA 209

>Kwal_33.12988
          Length = 303

 Score =  111 bits (277), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 131/306 (42%), Gaps = 16/306 (5%)

Query: 5   SNAITEP--VNSLISNETYSRIM-GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK 61
           S+ +T P  V+ L       R +    AG   G+A+  VG PFD  KVRLQTS   T   
Sbjct: 2   SDELTMPQVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTT-- 59

Query: 62  GPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPL 121
             L  V    +N+G+RGFY G T PL+G  L  S   G     +   HK        L L
Sbjct: 60  -ALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRL 118

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQY-DKTTTRYKGPLDVIKKIYSAQGIRGLY 180
                 G ++G + +F+A PIE  +  LQVQ   +    Y+G +D IKK+        L 
Sbjct: 119 PEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEG---KLM 175

Query: 181 KGLISTLIFRTH-FVYWWGSYE--LLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYP 237
           +G   T++  +H F  ++ SYE  + +   +   +    A                  YP
Sbjct: 176 RGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYP 235

Query: 238 SDVVKQVVLCNDKYDGSFKSWRT--AVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXX 295
            DV+K  V+ +DK              K+IY  +G   F KGF P+ LRS P        
Sbjct: 236 FDVIKS-VMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTA 294

Query: 296 FEFVLR 301
           FE  +R
Sbjct: 295 FEMAMR 300

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  108 bits (271), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 131/289 (45%), Gaps = 33/289 (11%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPPLV 88
           G  +G     + +PFDT+KVRLQT Q    F     C+  T++N+GI +GF+ G   PL 
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQT-QGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLA 78

Query: 89  GWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAK 148
           G  + ++ +    +     +  Y   +D    L+  +ISG  AG   SF+  P+EL K K
Sbjct: 79  GAAIENAALFLSYNQCSKFLQHYTNVSD----LTNILISGAFAGSCASFVLTPVELIKCK 134

Query: 149 LQVQY-----------DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF--VY 195
           LQV             +  T R+   +  I+ +   +G  GL++G   T I R  F  V 
Sbjct: 135 LQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFI-RESFGGVA 193

Query: 196 WWGSYELLTRWFRENTKMSEAAI-------NXXXXXXXXXXXXXXXAYPSDVVKQVVLCN 248
           W+ +YEL+ ++ +    + + ++                        +P+D VK ++   
Sbjct: 194 WFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMM--Q 251

Query: 249 DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
            ++ G     +TA+K I+  KG+ GF++G   + +R+ P        +E
Sbjct: 252 TEHLG----LKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYE 296

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 30/182 (16%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET-------------RFKGPLDCVYKTFRN 73
            ++G F+G   + V  P + IK +LQ S  ++             R    +  +    +N
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 74  QGIRGFYLGFTPPL-------VGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCII 126
           +G  G + G +          V W     +M   L + R  +     PND K      + 
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKS-RHNIEDPSLPNDNK--TWELLA 227

Query: 127 SGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           SG  AG + +    P +  K+ +Q       T + G    IKKI+  +G+RG Y+GL  T
Sbjct: 228 SGASAGLAFNASIFPADTVKSMMQ-------TEHLGLKTAIKKIFVEKGLRGFYRGLGIT 280

Query: 187 LI 188
           LI
Sbjct: 281 LI 282

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  108 bits (270), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 125/274 (45%), Gaps = 19/274 (6%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPPLV 88
           G  +G     + +PFDT+KVRLQT Q    F     C+  T+ N+G+ RGFY G   PL 
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQT-QPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLA 71

Query: 89  GWILMDSVMLGCLHNYRMLMHKYVYPNDEKL--PLSGCIISGVLAGWSVSFIAPPIELAK 146
           G  L ++V+    +  + L+      + E L  PLS  + +G  AG   SF+  P+EL K
Sbjct: 72  GAALENAVLFVSFNQAKRLL------DVESLLSPLSKTVWAGAFAGACASFVLTPVELIK 125

Query: 147 AKLQVQYDKTT-TRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT-HFVYWWGSYELLT 204
            KLQV    TT T +   L  IK + S +G  GL++G   T I  +     W+ +YE++ 
Sbjct: 126 CKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVK 185

Query: 205 RWFRENTKMSEAAI-NXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVK 263
            +     +  +                     +P+D +K   +  D  D S     +A +
Sbjct: 186 NYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKS-TMQTDHIDLS-----SATR 239

Query: 264 DIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
            IY  +GI GF++G   + +R+ P        +E
Sbjct: 240 KIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 65/170 (38%), Gaps = 26/170 (15%)

Query: 29  AGVFSGVAKNAVGHPFDTIKVRLQTSQ---NETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
           AG F+G   + V  P + IK +LQ S     +T     L  +      +G  G + G + 
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSG 165

Query: 86  PLV-------GWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
             +        W     V+   L + R       +           + SG  AG + +  
Sbjct: 166 TFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWE---------LLASGASAGLAFNAS 216

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
             P +  K+ +Q  +   ++         +KIY+ QGI G Y+GL  TLI
Sbjct: 217 IFPADTIKSTMQTDHIDLSS-------ATRKIYARQGIAGFYRGLGITLI 259

>Scas_632.9
          Length = 292

 Score =  108 bits (270), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 138/301 (45%), Gaps = 23/301 (7%)

Query: 5   SNAITEPVN-SLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP 63
           S +I  P+  S + N     + G +AG F  +    + +PFDT+KVRLQT Q    F   
Sbjct: 2   SESIDHPIEKSSVQNALSDIVNGSIAGAFGKI----IEYPFDTVKVRLQT-QGSHIFPTT 56

Query: 64  LDCVYKTFRNQGI-RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLS 122
             C+  T+ N+G+ RGF+ G   PL G  L ++ +    +    ++ K+   +    PLS
Sbjct: 57  WSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVS----PLS 112

Query: 123 GCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTT----RYKGPLDVIKKIYSAQGIRG 178
             ++SG  AG   SF+  P+EL K KLQV   +T      ++   +  +  +   +GI G
Sbjct: 113 NILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILG 172

Query: 179 LYKGLISTLIFRT-HFVYWWGSYELLTRWFRENTKMSEAAI-NXXXXXXXXXXXXXXXAY 236
           L++G  ST I  +   V W+ +YE++ +  ++  K +E                     +
Sbjct: 173 LWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIF 232

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXF 296
           P+D VK ++           +   AVK +  + GI GF++G   + +R+ P        +
Sbjct: 233 PADTVKSMM------QTEHITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMY 286

Query: 297 E 297
           E
Sbjct: 287 E 287

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  103 bits (256), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 123/276 (44%), Gaps = 19/276 (6%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPPLV 88
           G  +G     + +PFDT+KVRLQT Q    +     C+  T+ ++GI +GFY G   PL 
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQT-QPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLF 72

Query: 89  GWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAK 148
           G  L ++V+    +     + ++     +  PL+  I SG  AG   SFI  P+EL K K
Sbjct: 73  GAALENAVLFVSFNQCTNFLDEFT----QLKPLTKTIYSGAFAGACASFILTPVELVKCK 128

Query: 149 LQVQYDKT----TTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT-HFVYWWGSYELL 203
           LQV         TTR+      IK +   +G+ GL++G +ST +        W+ +YE++
Sbjct: 129 LQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIM 188

Query: 204 TRWFR--ENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTA 261
              F      +                       +P+D VK V  C  ++     S   A
Sbjct: 189 KMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSV--CQTEH----VSIVNA 242

Query: 262 VKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
           +K + ++ GI GF++G   + +R+ P        +E
Sbjct: 243 LKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

>Kwal_27.12599
          Length = 304

 Score =  102 bits (253), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 123/280 (43%), Gaps = 11/280 (3%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG   G+A+  VG PFDT KVRLQTS   T     ++ V K  +N+G+RGFY G   P
Sbjct: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT---AVEVVKKLVKNEGLRGFYKGTLTP 84

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146
           LVG     S   G     +           + L L    I G + G + SF+A PIE  +
Sbjct: 85  LVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVR 144

Query: 147 AKLQVQ-YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH-FVYWWGSYE-LL 203
            +LQ Q    T   +KGPLD I K+  A G   L +GL  T++        ++ +YE L+
Sbjct: 145 IRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCATYFLTYEALV 201

Query: 204 TRWFRENTKMSEA-AINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAV 262
                +    S+  A                  YP DV+K ++  ++  +         V
Sbjct: 202 ANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQV 261

Query: 263 KDIYQSK-GINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
             +  +K G   FFKGF P+ LR+ P        FE  +R
Sbjct: 262 ARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMR 301

>Kwal_26.8669
          Length = 296

 Score =  100 bits (248), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 124/271 (45%), Gaps = 19/271 (7%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE---TRFKGPLDCVYKTFRNQGIRGFYLGF 83
           F AG  +G+++  V +P D +K R+Q   +     ++KG +DC+ +    +G    Y G 
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
           + P++      +    C   ++ +  +      EKL  S  I+SG  AG   +F+  P E
Sbjct: 73  SSPVLMEAPKRATKFACNDEFQKIYKREF--GVEKLTQSLSILSGASAGCCEAFVVVPFE 130

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
           L K +LQ      ++ YKGP+DV++KI + +G+  +Y GL STL    H V+  G + ++
Sbjct: 131 LVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL--WRHGVWNAGYFGII 184

Query: 204 TR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK---- 256
            +      E    S+   N               + P DVVK  +       G  +    
Sbjct: 185 FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244

Query: 257 SWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           SW  ++  IY+ +G    +KGFVP  LR  P
Sbjct: 245 SW-PSIFTIYKEEGFRALYKGFVPKVLRLGP 274

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 78/172 (45%), Gaps = 7/172 (4%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           E  ++ +  ++G  +G  +  V  PF+ +K+RLQ   +   +KGP+D V K    +G+  
Sbjct: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS--YKGPIDVVRKIIAQEGVLA 161

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
            Y G    L    + ++   G +   R L+ +    + +       +I+G + G   S +
Sbjct: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLM 218

Query: 139 APPIELAKAKLQ--VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           + P ++ K+++Q          +Y      I  IY  +G R LYKG +  ++
Sbjct: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270

>Kwal_56.23011
          Length = 303

 Score =  100 bits (248), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 131/309 (42%), Gaps = 22/309 (7%)

Query: 5   SNAITEP--VNSLISNETYSRIMGFV-AGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK 61
           S  +T P  V+ L+    + + +  V  G   GVA+  VG PFD  KVRLQTS   T   
Sbjct: 2   SEELTSPQVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTT-- 59

Query: 62  GPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPL 121
                +    +N+G+  FY G   PL G     S   G     +    K     D+ L L
Sbjct: 60  -AAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLAL 118

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQ-YDKTTTRYKGPLDVIKKIYSAQGIRGLY 180
                 G ++G + +F+A PIE  + +LQ+Q    +   Y G LD  +K+   QG   L 
Sbjct: 119 RQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLK-QG--ALM 175

Query: 181 KGLISTLIFRTH-FVYWWGSYELLTR------WFRENTKMSEAAINXXXXXXXXXXXXXX 233
           +G  +T +  +H F  ++ +YE L          REN    +  +               
Sbjct: 176 RGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCV----YGAFSGAFFWA 231

Query: 234 XAYPSDVVKQVVLCNDKYDGSFKSWRTAV-KDIYQSKGINGFFKGFVPSFLRSFPXXXXX 292
             YP DVVK V+  +   +  +     AV K IY+ +G   F KGF P+ LRS P     
Sbjct: 232 MTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGAT 291

Query: 293 XXXFEFVLR 301
              FE  +R
Sbjct: 292 FAAFEITMR 300

>Kwal_55.21335
          Length = 317

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 117/272 (43%), Gaps = 15/272 (5%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQG-IRGFYLGFTPPLV 88
           G  +G A   + +P DTIKVRLQT Q    F     C+  T++ +G ++GFY G   PLV
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQT-QPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLV 110

Query: 89  GWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAK 148
           G  L ++V+    +  +  + +Y    +   PLS  ++SG  AG   S++  P+EL K  
Sbjct: 111 GAALENAVLFVTFNRAQNFLQQY----ESVSPLSQTVLSGAFAGACTSYVLTPVELIKCT 166

Query: 149 LQV-QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRW 206
           LQV   +  TTR+      +K I   +GI GL++G  ST I        W+ +YE L  +
Sbjct: 167 LQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSY 226

Query: 207 F-RENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDI 265
             R                           +P+D +K       ++ G       A K I
Sbjct: 227 LARRRNDTENHTWELLASGASAGVAFNASIFPADTIKST--AQTQHLGIVD----ATKRI 280

Query: 266 YQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
               G  G ++G   + +R+ P        +E
Sbjct: 281 LARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 12/164 (7%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNE---TRFKGPLDCVYKTFRNQGIRGFYLGFT 84
           ++G F+G   + V  P + IK  LQ S  E   TR       V    +++GI G + G +
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQS 203

Query: 85  PPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIEL 144
              +      +V      + +  + +    ND +      + SG  AG + +    P + 
Sbjct: 204 STFIRECAGGAVWFTTYESLKSYLARR--RNDTENHTWELLASGASAGVAFNASIFPADT 261

Query: 145 AKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
            K+  Q       T++ G +D  K+I +  G  GLY+GL  TLI
Sbjct: 262 IKSTAQ-------TQHLGIVDATKRILARSGPAGLYRGLGITLI 298

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 70/169 (41%), Gaps = 18/169 (10%)

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG-IRGLYKGL 183
           I+ G +AG +   I  P++  K +LQ Q       +      IK  Y  +G ++G Y+G+
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHV---FPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 184 ISTLIFRT-----HFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPS 238
            S L+         FV +  +   L + +   + +S+  ++                 P 
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQ-YESVSPLSQTVLSGAFAGACTSYVLT----PV 160

Query: 239 DVVK---QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           +++K   QV           K W T VK I Q KGI G ++G   +F+R
Sbjct: 161 ELIKCTLQVSNLEGATTRHSKIWPT-VKHIVQHKGIGGLWQGQSSTFIR 208

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score =  100 bits (248), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 124/294 (42%), Gaps = 30/294 (10%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETR------FKGPLDCVYKTFRNQGIR 77
           I G +AG+ SG+    V  P D  K RLQ    +TR      ++G +  +    R++G+R
Sbjct: 73  ISGALAGLLSGI----VVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVR 128

Query: 78  GFYLGFTPPLVG----WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGW 133
           G Y G  P ++G    W++  SV   C  N R         N           S + AG 
Sbjct: 129 GLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRT--------NSSNWSFVSHSFSAITAGA 180

Query: 134 SVSFIAPPIELAKAKLQVQYD--KTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT 191
             + +  PI + K +L +Q      TT Y+G  D  KKI + +G++ LY GL+ +L+   
Sbjct: 181 VSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLL 240

Query: 192 HFVYWWGSYELLT---RWFRENTKMSEAAINXX---XXXXXXXXXXXXXAYPSDVVKQVV 245
           H    +  YE L    + ++ +   +E+ IN                  +YP ++++  +
Sbjct: 241 HVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRL 300

Query: 246 LCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
                     +     +K  Y  +GI GF+ GF  +  R+ P        FE+V
Sbjct: 301 QLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 98.6 bits (244), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 117/273 (42%), Gaps = 16/273 (5%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPPLV 88
           G  +G     V +PFDT+KVRLQT Q+   F     CV  T++ +G+ RGFY G   P+ 
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQT-QSAALFPTTWSCVSHTYKQEGLWRGFYQGMASPVF 73

Query: 89  GWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAK 148
           G  L  +V+    +  + ++           PL   + +G +AG   S++  P+EL K K
Sbjct: 74  GAFLEHAVLFVSFNRAQAVLENCYSCG----PLEKVVFAGAIAGACTSYVLTPVELVKCK 129

Query: 149 LQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH-FVYWWGSYELLTR 205
           LQV      +  RY   L  ++ I    G+ GL++G   T I  +     W+ +YE+L  
Sbjct: 130 LQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKG 189

Query: 206 WFRENTKMSEAAI-NXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKD 264
           W       +E  +                  +P+D VK  +       G       AV+ 
Sbjct: 190 WLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLGP------AVRT 243

Query: 265 IYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
           + +  G  GF++G   + LR+ P        +E
Sbjct: 244 VLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 98.6 bits (244), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 137/308 (44%), Gaps = 20/308 (6%)

Query: 5   SNAITEP--VNSLISNETYSR-IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK 61
           S+ +T P  V+ L     + + I   ++G   G+A+  VG PFD  KVR+QTS       
Sbjct: 2   SDELTTPQVVDDLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPT-- 59

Query: 62  GPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG---CLHNYRMLMHKYVYPNDEK 118
             ++ +    +N+G+  FY G   PL+G     S   G    +  Y + ++ Y    D+ 
Sbjct: 60  -AIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGY---KDQH 115

Query: 119 LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIR 177
           L L      G ++G + +F+A PIE  + +LQ+Q        Y+G LD +KK+      +
Sbjct: 116 LSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ---K 172

Query: 178 GLYKGLISTLIFRTH-FVYWWGSYELLTRWFRENTKMSEAAI--NXXXXXXXXXXXXXXX 234
            L +G  +TL+  +H F  ++ +YE L     +N  + +                     
Sbjct: 173 ALMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAM 232

Query: 235 AYPSDVVKQVVLCNDKYDGSF-KSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXX 293
            YP DVVK ++  +        K+     K I+ ++G   F KGFVP+ LRS P      
Sbjct: 233 TYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATF 292

Query: 294 XXFEFVLR 301
             FE  +R
Sbjct: 293 ATFEVTMR 300

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 98.6 bits (244), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 132/286 (46%), Gaps = 24/286 (8%)

Query: 29  AGVFSGVAKNAVGHPFDTIKVRLQT-SQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
           +G   GVA+  VG PFD IKVRLQT   N T ++   D V    + +G  GFY G   PL
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLV----KYEGFMGFYKGTMAPL 85

Query: 88  VGWILMDSVMLG---CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIEL 144
           VG     S   G    +  Y   +++     D  L L      G ++G + + +A PIE 
Sbjct: 86  VGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPIEH 145

Query: 145 AKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH-FVYWWGSYEL 202
            + +LQ+Q +      YK  LD  +K+   QG   L +G  +TL+  +H F  ++ +YE 
Sbjct: 146 VRIRLQLQKEALANAEYKSTLDCTEKLLK-QG--SLMRGFTATLMRTSHGFGIYFLTYET 202

Query: 203 LTR------WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK 256
           L        + RE+    +A +                 YP DVVK V+  +   + ++ 
Sbjct: 203 LIASQLAHGFRREDISAWKACM----FGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYG 258

Query: 257 SWRTAV-KDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           +    V K+IY+ +G+  F KGF+P+ LRS P        FE  ++
Sbjct: 259 TNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQ 304

>Scas_714.18
          Length = 305

 Score = 95.5 bits (236), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 121/294 (41%), Gaps = 35/294 (11%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPP 86
           +AG  +G     + +PFDT+KVRLQT Q    F     C+  T+ N+GI  GFY G   P
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQT-QEAYMFPSTWSCIKYTYENEGILEGFYQGIESP 75

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146
           L+G  L ++++    +     ++ +     E       +IS   AG   SF+  P+EL K
Sbjct: 76  LIGAALENAILFLAYNQCSSFLNAFT----EFSAFLIILISAGFAGSCASFVLTPVELIK 131

Query: 147 AKLQVQ------YDKTTT----------------RYKGPLDVIKKIYSAQGIRGLYKGLI 184
            KLQ+       +D                    R+   +  IK I   +G+ GL++G  
Sbjct: 132 CKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQS 191

Query: 185 STLIFRT-HFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQ 243
           ST I  +   V W+ +YEL+ +  R+                          +P+D VK 
Sbjct: 192 STFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPADTVKS 251

Query: 244 VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
           ++           +    V+ I +  G+ GF++G   + LR+ P        +E
Sbjct: 252 IM------QTEHLALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYE 299

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGI-RGLYKGL 183
           I++G +AG    FI  P +  K +LQ Q       +      IK  Y  +GI  G Y+G+
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQTQ---EAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 184 ISTLI 188
            S LI
Sbjct: 73  ESPLI 77

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 93.2 bits (230), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 119/284 (41%), Gaps = 19/284 (6%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE---TRFKGPLDCVYKTFRNQGIRGFYLGF 83
           F AG  +GV++  V +P D +K R+Q          + G +DC+ K    +G+   Y G 
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
           + P++      +    C   ++ L  +         PLS  +++G  AG   +F+  P E
Sbjct: 75  SSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPFE 132

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
           L K +LQ      ++ YKGP+DV++KI + +G+  +Y GL STL        W G Y  +
Sbjct: 133 LVKIRLQ----DASSSYKGPVDVVRKIVAREGVLAMYNGLESTL---WRHALWNGGYFGI 185

Query: 204 TRWFR----ENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWR 259
               R         ++   N               + P DVVK  +       G  + + 
Sbjct: 186 IFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYN 245

Query: 260 ---TAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVL 300
               ++  IY+ +G    +KGFVP  LR  P        F  VL
Sbjct: 246 WSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 7/172 (4%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           E  S+ +  +AG  +G  +  V  PF+ +K+RLQ + +   +KGP+D V K    +G+  
Sbjct: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSS--YKGPVDVVRKIVAREGVLA 163

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
            Y G    L    L +    G +   R L+      +++   ++  +IS  +       +
Sbjct: 164 MYNGLESTLWRHALWNGGYFGIIFQARALLPA---AHNKTQCITNDLISDSIGCSIGCML 220

Query: 139 APPIELAKAKLQ--VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           + P ++ K+++Q          +Y   L  +  IY  +G R LYKG +  ++
Sbjct: 221 STPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYSA 173
           + + LP      +G +AG S   +  P+++ K ++Q+Q        Y G +D +KKI + 
Sbjct: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64

Query: 174 QGIRGLYKGLISTLIFRT 191
           +G+  LYKG+ S ++   
Sbjct: 65  EGVGRLYKGISSPILMEA 82

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 94.4 bits (233), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 127/295 (43%), Gaps = 20/295 (6%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP-----LDCVYKT 70
           +S+   + + G  AG  SGVA      P D  K RLQ    +TRF+ P     +  +   
Sbjct: 74  LSSTQITALSGAFAGFLSGVAVC----PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTI 129

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
            R++G RG Y G  P ++G+     +        +   H  ++P  + +  S   I+   
Sbjct: 130 VRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHG-IFPQFDFVAQSCAAIT--- 185

Query: 131 AGWSVSFIAPPIELAKAKLQVQYD--KTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           AG + + +  PI + K +L +Q +  +  T YKG  D  +K++  +G + LY GL+ +L+
Sbjct: 186 AGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL 245

Query: 189 FRTHFVYWWGSYELLTRWF----RENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK-Q 243
              H    +  YE L   F    REN   S                     YP ++++ +
Sbjct: 246 GLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTR 305

Query: 244 VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEF 298
           + L +D  D   +     +K  Y  +G+ GF+ GF  + +R+ P        FE+
Sbjct: 306 MQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY 360

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQN--ETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
           +A   S +  +AV +P + ++ R+Q   +  ++  +     +  T+  +G++GFY GFT 
Sbjct: 283 MASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTT 342

Query: 86  PLVGWILMDSVMLGCLHNYR 105
            LV  I   ++ L     +R
Sbjct: 343 NLVRTIPASAITLVSFEYFR 362

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 123/304 (40%), Gaps = 37/304 (12%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-------- 52
           MS  SNA   P            I  F++G  +G+++  V +P D +K R Q        
Sbjct: 1   MSSDSNAKPLPF-----------IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTA 49

Query: 53  --TSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHK 110
               +   R+ G +DC+ K  + +G    Y G + P++      +    C   Y+ +   
Sbjct: 50  AAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKN 109

Query: 111 YVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKI 170
               N+    +S  I +G  AG + + +  P EL K ++Q       + Y GP+D +KK 
Sbjct: 110 LFNTNETTQKIS--IAAGASAGMTEAAVIVPFELIKIRMQ----DVKSSYLGPMDCLKKT 163

Query: 171 YSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKMS----EAAINXXXXXXX 226
              +GI GLYKG+ ST+ +R     W G Y  +    R +  ++    +   N       
Sbjct: 164 IKNEGIMGLYKGIESTM-WRNAL--WNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAI 220

Query: 227 XXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKD---IYQSKGINGFFKGFVPSFL 283
                     P DVVK  +   D    + K +   +     IY+ +G    +KGFVP   
Sbjct: 221 GGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVC 280

Query: 284 RSFP 287
           R  P
Sbjct: 281 RLAP 284

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQT----SQNETRFKGPLDCVYKTFRNQGIRGFYLG 82
            +AG   G     +  PFD +K R+Q+    S    ++   L  +   +R +G R  Y G
Sbjct: 215 LIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKG 274

Query: 83  FTPPLV----GWILMDSVMLGCLHNYRMLMHKY 111
           F P +     G  LM  V  G ++ +R L + +
Sbjct: 275 FVPKVCRLAPGGSLMLVVFTGMMNFFRDLKYGH 307

>Kwal_47.17321
          Length = 881

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 130/284 (45%), Gaps = 25/284 (8%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQG 75
           I +  Y+ ++G VAG     A     +P D +K R+Q  +N +++K  +DC  K F  +G
Sbjct: 497 IFDSIYNFLLGSVAGCIGATA----VYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREG 552

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
           IRG Y G  P LVG     ++ L  +++Y   + K +   + +L L   IISG  AG   
Sbjct: 553 IRGIYSGLGPQLVGVAPEKAIKL-TVNDY---VRKLLMDENNRLTLPLEIISGAAAGACQ 608

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-V 194
                P+E+ K +LQV+ +   +  K  L  +  + S  G+RGLYKGL++ L+    F  
Sbjct: 609 VIFTNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSL-GLRGLYKGLVACLMRDVPFSA 667

Query: 195 YWWGSYELLTR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVVLCN 248
            ++ +Y  L R    +    K   A ++               AY   P DV+K  +  +
Sbjct: 668 IYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID 727

Query: 249 -----DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
                 +Y G   + RT +K+    +    FFKG     LRS P
Sbjct: 728 PRKGETRYTGILHAARTILKE----ERFKSFFKGGGARVLRSSP 767

>Scas_709.9
          Length = 365

 Score = 91.7 bits (226), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 133/302 (44%), Gaps = 31/302 (10%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT----SQNETRFKGPLDCVYKTF 71
           +S+   + + G +AG  SG+    +  P D  K RLQ     S     ++G L  +    
Sbjct: 61  LSDPKITALSGALAGFLSGI----IVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIV 116

Query: 72  RNQGIRGFYLGFTPPLVG----WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIIS 127
            ++G+RG Y G  P ++G    W++  SV     + +   ++  V PN + +  S C  S
Sbjct: 117 VDEGVRGLYKGLIPIILGYFPTWMIYFSV-----YEFAKDLYPRVLPNSDFISHS-C--S 168

Query: 128 GVLAGWSVSFIAPPIELAKAKLQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLIS 185
            + AG + + +  PI + K +L +Q    ++ T Y+G +D  KKI + +G+R LY GL+ 
Sbjct: 169 AITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVP 228

Query: 186 TLIFRTHFVYWWGSYELLTRWFRENT--------KMSEAAINXXXXXXXXXXXXXXXAYP 237
           ++    H    +  YE L      +T        + S                     YP
Sbjct: 229 SMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYP 288

Query: 238 SDVVK-QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXF 296
            ++++ ++ L +DK   S       +K  Y+ +G+ GF+ GF  + LR+ P        F
Sbjct: 289 HEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSF 348

Query: 297 EF 298
           E+
Sbjct: 349 EY 350

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP--LDCVYKTFRNQGIRGFYLGFT 84
            +A   S +  + + +P + ++ R+Q   ++        LD + +T+R +G+ GFY GF 
Sbjct: 272 IIASSASKMLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFA 331

Query: 85  PPLVGWILMDSVMLGCLHNYR 105
             L+  +   ++ L     +R
Sbjct: 332 TNLLRTVPASAITLVSFEYFR 352

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 122/292 (41%), Gaps = 27/292 (9%)

Query: 21  YSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           +  I  F  G  +G     V +P D +K R+Q  +N  ++K  +DCV K F+ +GIRG Y
Sbjct: 502 FDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G  P L+G     ++ L         M +Y       +     I+SG  AG        
Sbjct: 562 SGLGPQLIGVAPEKAIKLTV----NDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTN 617

Query: 141 PIELAKAKLQVQYDKTTTRYK---GPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VYW 196
           P+E+ K +LQ++ D      +   G + +I+++    G+RGLYKG  + L+    F   +
Sbjct: 618 PLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSAIY 673

Query: 197 WGSYELLTR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVVLCNDK 250
           + +Y  L +    F  N K     +                AY   P DV+K  +  + +
Sbjct: 674 FPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPR 733

Query: 251 -----YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
                Y G   + RT +K+    + I  FFKG     LRS P        FE
Sbjct: 734 KGETTYTGVIHAARTILKE----ESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 126/299 (42%), Gaps = 36/299 (12%)

Query: 7   AITEP---VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP 63
           AI EP   V +  SN  Y       AG   GV     GHPFD +KVR Q++Q      G 
Sbjct: 28  AIEEPSVHVGTPKSNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQAS----GT 83

Query: 64  LDCVYKTF---RNQG-------IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVY 113
           +D V K     R Q        +RGFY G  PPL+G   + +V       Y  +  K V 
Sbjct: 84  VDAVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAV---SFWGYD-VGKKLVT 139

Query: 114 PNDE--KLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIY 171
            ND   KL  +    +G ++    + +  P E  K  LQ Q + +           K I 
Sbjct: 140 WNDNSGKLTTAQLATAGFISAIPTTLVMAPTERVKVVLQTQSNHSLG------SAAKHIL 193

Query: 172 SAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRENTKMSEAAI-NXXXXXXXXXX 229
           +  G+R L++G ++TL         ++ SYE    +    +  +E +I N          
Sbjct: 194 ATGGVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGV 253

Query: 230 XXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSK-GINGFFKGFVPSFLRSFP 287
                 +P D +K  +  ++    + ++   A + IY ++ GI GFF G  P+ LRSFP
Sbjct: 254 SMWVGVFPIDTIKTELQSSN----TRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFP 308

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 90.5 bits (223), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 131/298 (43%), Gaps = 29/298 (9%)

Query: 2   SKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK 61
           S+SSN    P+        +  I  F  G  +G     V +P D +K R+Q  ++ +++K
Sbjct: 511 SRSSNLYFYPI--------FDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYK 562

Query: 62  GPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPL 121
             +DC+ K    +G+RG Y G  P L+G     ++ L    + R  +       D KL L
Sbjct: 563 NSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAG----RDGKLSL 618

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
              IISG  AG        P+E+ K +LQV+ D      +  ++ I  I +  G+ GLY+
Sbjct: 619 PCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVIKNL-GLIGLYR 677

Query: 182 GLISTLIFRTHF--VYWWGSYELLTRWFRENTKMSEA--AINXXXXXXXXXXXXXXXAY- 236
           G  + L+    F  +Y+     + +  F  + K S+    +N               A+ 
Sbjct: 678 GAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFL 737

Query: 237 --PSDVVKQVVLCNDK-----YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
             P DV+K  +  + K     Y+G + + RT +K+    +GI  FFKG     LRS P
Sbjct: 738 TTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKE----EGIKSFFKGGPARVLRSSP 791

>Scas_640.25
          Length = 306

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 130/290 (44%), Gaps = 26/290 (8%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-------TSQNETRFKGPLDCVYKTFRNQGIRGF 79
           F+AG  +G+++  V +P D +K R+Q          + T +KG +DC+ +  + +G    
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA 139
           Y G + P++      +V       + + + K V+   ++L     ++SG  AG + + + 
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEF-IKLWKSVF-GTKQLTQQISVLSGASAGITEALVI 134

Query: 140 PPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGS 199
            P EL K +LQ       +++KGP++V+K I    G++GLY G+ ST ++R     W   
Sbjct: 135 VPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST-VWRN--AVWNAG 187

Query: 200 YELLTRWFRENTKMS----EAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLC--NDKYDG 253
           Y  +    RE   ++    E   N                 P DVVK  +    N+  +G
Sbjct: 188 YFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIING 247

Query: 254 SFK---SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVL 300
             K   +W + +K IY  +G    +KGFVP  LR  P        F  V+
Sbjct: 248 VRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 81/178 (45%), Gaps = 8/178 (4%)

Query: 14  SLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRN 73
           S+   +  ++ +  ++G  +G+ +  V  PF+ +K+RLQ     ++FKGP++ +    + 
Sbjct: 107 SVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVN--SKFKGPVEVLKHIIKQ 164

Query: 74  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGW 133
            G++G Y G    +    + ++   G +   R L+        EK     C  +G + G 
Sbjct: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL-PVAKSKQEKTRNDLC--AGFVGGT 221

Query: 134 SVSFIAPPIELAKAKLQVQYDKTTT---RYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
                  P ++ K+++Q   ++      +Y      + KIY  +G R LYKG +  ++
Sbjct: 222 FGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVL 279

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 119 LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-----KTTTRYKGPLDVIKKIYSA 173
           LP     ++G +AG S   +  P+++ K ++Q+Q        + T YKG +D + +I   
Sbjct: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKK 70

Query: 174 QGIRGLYKGLISTLIFRT 191
           +G   +YKG+ S ++   
Sbjct: 71  EGPMHMYKGISSPMLMEA 88

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 87.4 bits (215), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 119/271 (43%), Gaps = 19/271 (7%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           F+AG  +GV++  V +P D +K  +Q   +  +  ++KG  DC+ +    +G    Y G 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
           + P++      +    C   ++ +            PLS  I+SG  AG   SF+  P E
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGASAGICESFVVVPFE 130

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
           L K +LQ      ++++  P+ V+K I   +GI  +Y GL ST+    H ++  G + ++
Sbjct: 131 LVKIRLQ----DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM--WRHGIWNAGYFGII 184

Query: 204 TR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK---- 256
            +      + +  SE   N               + P DVVK  V       G  +    
Sbjct: 185 FQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNW 244

Query: 257 SWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           SW  A+  IY+ +G    +KGFVP  LR  P
Sbjct: 245 SW-PALATIYKEEGFKALYKGFVPKVLRLGP 274

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 79/178 (44%), Gaps = 7/178 (3%)

Query: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72
             L   E  ++ +  ++G  +G+ ++ V  PF+ +K+RLQ     ++F  P+  V     
Sbjct: 98  KDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDV--SSKFTSPIAVVKNIVE 155

Query: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132
            +GI   Y G    +    + ++   G +   R L+ K    +++       +++G + G
Sbjct: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQT---RNDLLAGTVGG 212

Query: 133 WSVSFIAPPIELAKAKLQ--VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
              S ++ P ++ K+++Q          +Y      +  IY  +G + LYKG +  ++
Sbjct: 213 TLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVL 270

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 115 NDEK-LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYS 172
           +D+K LP     ++G +AG S   +  P+++ K  +Q+Q    +  +YKG  D +K+I +
Sbjct: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAA 61

Query: 173 AQGIRGLYKGLISTLIFRT 191
            +G   LYKG+ S ++   
Sbjct: 62  KEGPSRLYKGISSPILMEA 80

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 117/279 (41%), Gaps = 20/279 (7%)

Query: 21  YSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           +  +  F  G  +G     V +P D IK R+Q  ++  ++K  +DC+ K    +GI+G Y
Sbjct: 528 FDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLY 587

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G  P L+G     ++ L         M   +   + KL L   IISG  AG        
Sbjct: 588 SGLGPQLIGVAPEKAIKLTV----NDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTN 643

Query: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VYWWGS 199
           P+E+ K +LQVQ D      +   +   +I    G+RGLY G+ + L+    F   ++ +
Sbjct: 644 PLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 200 YELLTR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVVLCN----- 248
           Y  L +    F  N K     +                A+   P DV+K  +  +     
Sbjct: 704 YAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE 763

Query: 249 DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
            KY+G F + RT +K+    +    FFKG     LRS P
Sbjct: 764 TKYNGIFHAIRTILKE----ESFRSFFKGGGARVLRSSP 798

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 117/302 (38%), Gaps = 49/302 (16%)

Query: 43  PFDTIKVRLQT----------------------SQNETRFKGPLDCVYKTFRNQGIRGFY 80
           PFD +K RLQ+                      +Q    FK     +   +RN+G R  +
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G  P LVG I   S+        + +  K +    E + +   +++   AGW+ S    
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIH--LMAAATAGWATSTATN 189

Query: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSY 200
           PI L K +LQ+    TT +YK   D +K +   +GI GLYKGL ++ +     +  W  Y
Sbjct: 190 PIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEGILQWVLY 249

Query: 201 ELLTRWFRENT-----KMSEAA----------INXXXXXXXXXXXXXXXAYPSDVV---- 241
           E +    ++ +      +SE                              YP +VV    
Sbjct: 250 EQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRL 309

Query: 242 KQVVLCND--KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
           +Q  L N   KY G  +S R  +K+    +G+   + G  P  LR+ P        +E V
Sbjct: 310 RQAPLENGKLKYTGLVQSIRVIIKE----EGLASMYGGLTPHLLRTVPNSIIMFGTWELV 365

Query: 300 LR 301
           +R
Sbjct: 366 IR 367

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 89/199 (44%), Gaps = 25/199 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET--RFKGPLDCVYKTFRNQGIRGFYLGFT 84
            +A   +G A +   +P   +K RLQ  +  T  ++K   DC+    + +GI G Y G +
Sbjct: 174 LMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLS 233

Query: 85  PPLVG-------WILMDSVMLGCLHNYRML-MHKYVYPNDEKLPLSG-----CIISGV-- 129
              +G       W+L + +     H  +   M K+   ++ +   S      C  SG   
Sbjct: 234 ASYLGSVEGILQWVLYEQMK----HIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAG 289

Query: 130 LAGWSVSFIAPPIELAKAKL-QVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           LA +  S I  P E+ + +L Q   +    +Y G +  I+ I   +G+  +Y GL   L+
Sbjct: 290 LAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLL 349

Query: 189 FRT--HFVYWWGSYELLTR 205
            RT  + +  +G++EL+ R
Sbjct: 350 -RTVPNSIIMFGTWELVIR 367

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 122/302 (40%), Gaps = 33/302 (10%)

Query: 15  LISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS---QNETRFKGPLDCVYKTF 71
           L+ +   + + G +AG  SG+       P D  K RLQ       E  ++G +  +    
Sbjct: 80  LLDDTQVTAVSGALAGFVSGIMVC----PLDVAKTRLQAQGAGSGERYYRGIVGTLSAIL 135

Query: 72  RNQGIRGFYLGFTPPLVG----WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIIS 127
           R++G+ G Y G  P ++G    W+L  SV   C         K  YP+           S
Sbjct: 136 RDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKC---------KQRYPSYLPGGFVSHAAS 186

Query: 128 GVLAGWSVSFIAPPIELAKAKLQVQYD--KTTTRYKGPLDVIKKIYSAQGIRGLYKGLIS 185
            + AG   + +  PI + K +L +Q D  + +T Y+  LD  +K+Y ++G++  Y GL+ 
Sbjct: 187 ALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVP 246

Query: 186 TLIFRTHFVYWWGSYELLTRWFRENTKMSEAA---------INXXXXXXXXXXXXXXXAY 236
           +L    H    +  YE L  W   NT  ++                             Y
Sbjct: 247 SLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITY 306

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXF 296
           P ++++  +    ++ G   S    +  I  S+G  GF+ GF  + +R+ P        F
Sbjct: 307 PHEILRTRM--QVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSF 364

Query: 297 EF 298
           E+
Sbjct: 365 EY 366

>Kwal_55.20868
          Length = 380

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 125/311 (40%), Gaps = 36/311 (11%)

Query: 12  VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT----SQNETRFKGPLDCV 67
           VN    +   + + G +AG  +GV       P D  K RLQ     S     +KG L  +
Sbjct: 68  VNRSFDDTEITALSGAMAGFLAGVTVC----PLDVAKTRLQAQGLHSNPSNYYKGILGTL 123

Query: 68  YKTFRNQGIRGFYLGFTPPLVG----WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG 123
               R++G RG Y G  P ++G    W++  SV     +     ++  ++P+ + +  S 
Sbjct: 124 TTIIRDEGARGLYKGLVPIIMGYFPTWMIYFSV-----YERSKKLYPRIFPSFDFISHSA 178

Query: 124 CIISGVLAGWSVSFIAPPIELAKAKL--QVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
              S + AG   + +  P+ + K +L  Q   +K +T Y    D   K+Y+ +G+R  Y 
Sbjct: 179 ---SALTAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYA 235

Query: 182 GLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXX------XXXXXXXXXXXXA 235
           GL+ +L+   H    +  YE L  W      MS    +                      
Sbjct: 236 GLLPSLLGLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLT 295

Query: 236 YPSDVVKQVVLC----NDKYDGSFKSWRTA----VKDIYQSKGINGFFKGFVPSFLRSFP 287
           YP ++++  +       D      K+ R      +K  Y+S+G+ GF+ GF  +  R+ P
Sbjct: 296 YPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLP 355

Query: 288 XXXXXXXXFEF 298
                   FE+
Sbjct: 356 ASAITLVSFEY 366

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 9/92 (9%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQ---------TSQNETRFKGPLDCVYKTFRNQGIRG 78
           +A   S +  + + +P + ++ R+Q          +  +T   G +  +  T++++G+RG
Sbjct: 282 IASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRG 341

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHK 110
           FY GFT  L   +   ++ L     +R  + K
Sbjct: 342 FYSGFTANLARTLPASAITLVSFEYFRKYLTK 373

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 122/279 (43%), Gaps = 20/279 (7%)

Query: 21  YSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           +  +  F  G  +G     + +P D +K R+Q  ++ +++K  +DC  K    +GIRG Y
Sbjct: 541 FDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVY 600

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G  P L+G     ++ L  +++Y   M   +   + KL L   IISG  AG        
Sbjct: 601 SGLGPQLIGVAPEKAIKL-TVNDY---MRNKLKDKNGKLGLLSEIISGASAGACQVIFTN 656

Query: 141 PIELAKAKLQVQYDKTTTRYKG----PLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VY 195
           P+E+ K +LQV+ +      +      L +IK++    G+ GLYKG  + L+    F   
Sbjct: 657 PLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GLPGLYKGAAACLLRDVPFSAI 712

Query: 196 WWGSYELLTR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVVLCND 249
           ++ +Y  L R    F  N K   + +N               AY   P DV+K  +  + 
Sbjct: 713 YFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDP 772

Query: 250 KYDGS-FKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           K   + +K    A + I + +    FFKG     LRS P
Sbjct: 773 KKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

>Kwal_27.12081
          Length = 369

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 120/299 (40%), Gaps = 46/299 (15%)

Query: 43  PFDTIKVRLQT----------SQNET---------RFKGPLDCVYKTFRNQGIRGFYLGF 83
           PFD +K RLQ+          S N++          F+     +   ++ +G R  + G 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
            P LVG I   S+        + +  +  + N E+ P    +IS   AGW+ S    PI 
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSR-AFNNGEEAPWIH-LISAATAGWATSTATNPIW 189

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
           L K +LQ+     T +YK   D +K I   +G  GLYKGL ++ +     +  W  YE +
Sbjct: 190 LIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGILQWLLYEQM 249

Query: 204 TRWFRENT-----KMSEAAINXXXXXXX----------XXXXXXXXAYPSDVV----KQV 244
            +  +  +      +SE   N                          YP +VV    +Q 
Sbjct: 250 KQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQA 309

Query: 245 VLCND--KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
            L ND  KY G  +S+R  +K+    +G+   + G  P  LR+ P        +E V++
Sbjct: 310 PLENDKLKYTGLIQSFRVIIKE----EGLASMYGGLTPHLLRTVPNSIIMFGTWELVIK 364

>Scas_721.27
          Length = 374

 Score = 83.6 bits (205), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 121/306 (39%), Gaps = 53/306 (17%)

Query: 43  PFDTIKVRLQTS--------------------------QNETRFKGPLDCVYKTFRNQGI 76
           PFD +K RLQ+                           Q  T FK     +   ++ +G 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 77  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVS 136
           R  + G  P LVG I   S+        + +  K  + N ++ PL   ++S   AGW+ S
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK-AFNNGQETPLI-HLMSAATAGWATS 189

Query: 137 FIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW 196
               PI + K ++Q+    TT +YK   D +K +  ++GI GLY+GL ++ +     +  
Sbjct: 190 TATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEGILQ 249

Query: 197 WGSYELLTRWFREN-----------TKMSEAAINXXXXXXXXXXXXXXXA----YPSDVV 241
           W  YE +    ++            TK     I                A    YP +VV
Sbjct: 250 WLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVV 309

Query: 242 ----KQVVLCND--KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXX 295
               +Q+ + N   KY G  +S+R  +K+    +G+   + G  P  +R+ P        
Sbjct: 310 RTRLRQMPMENGKPKYTGLVQSFRVIIKE----EGLASMYSGLTPHLMRTVPNSIIMFGT 365

Query: 296 FEFVLR 301
           +E V+R
Sbjct: 366 WELVIR 371

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 93/209 (44%), Gaps = 25/209 (11%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET--RFKGPLDCVYKTFRNQ 74
           +N   + ++  ++   +G A +   +P   IK R+Q  +  T  ++K   DC+    +++
Sbjct: 168 NNGQETPLIHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSE 227

Query: 75  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG----------- 123
           GI G Y G +   +G I  + ++   L  Y  + H     + EK    G           
Sbjct: 228 GIYGLYRGLSASYLGSI--EGILQWLL--YEQMKHLIKQRSIEKFGHEGQLTKSRTEKIK 283

Query: 124 --CIISGV--LAGWSVSFIAPPIELAKAKL-QVQYDKTTTRYKGPLDVIKKIYSAQGIRG 178
             C  SG   +A +  S +  P E+ + +L Q+  +    +Y G +   + I   +G+  
Sbjct: 284 EWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLAS 343

Query: 179 LYKGLISTLIFRT--HFVYWWGSYELLTR 205
           +Y GL   L+ RT  + +  +G++EL+ R
Sbjct: 344 MYSGLTPHLM-RTVPNSIIMFGTWELVIR 371

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 82.8 bits (203), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 117/289 (40%), Gaps = 29/289 (10%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYK------- 69
           SN     I  FVAG   GV     GHPFD IKVR Q  Q  +      + + +       
Sbjct: 29  SNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKG 88

Query: 70  TFRNQGIRGFYLGFTPPLVGWILMDSVML-GCLHNYRMLMHKYVYPNDEKLPLSGCIISG 128
           T     ++GFY G  PPL+G   + +V   G     +++          +L +     +G
Sbjct: 89  TLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAG 148

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP-LDVIKKIYSAQGIRGLYKGLISTL 187
            ++    + +  P E  K  LQ       T  KG  +   K I    GI  L+KG ++TL
Sbjct: 149 FISAIPTTLVTAPTERVKVVLQ-------TSSKGSFIQAAKTIVKEGGIASLFKGSLATL 201

Query: 188 IFR-THFVYWWGSYE-----LLTRWFRENTKMSEAA--INXXXXXXXXXXXXXXXAYPSD 239
                    ++ SYE     L +R  R++    E    +N                +P D
Sbjct: 202 ARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPID 261

Query: 240 VVKQVVLCNDKYDGSFKSWRTAVKDIY-QSKGINGFFKGFVPSFLRSFP 287
            +K  +  +     + ++  +A K+IY Q  GI GFF G  P+ LRSFP
Sbjct: 262 TIKTKLQASS----TRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFP 306

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/343 (24%), Positives = 135/343 (39%), Gaps = 51/343 (14%)

Query: 3   KSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT--------- 53
           KS++ I+ P     S       + FVAG   G+A   V  PFD +K RLQ+         
Sbjct: 30  KSADRISLPTIKDDSQPAVKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKS 89

Query: 54  --------------SQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG 99
                         S++   FK     +   +R +G R  + G  P LVG I   S+   
Sbjct: 90  AAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINF- 148

Query: 100 CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTR 159
             +     ++     N ++ P    +++   AGW+ S +  PI L K +LQ+    T T 
Sbjct: 149 LTYGTTKDIYSRTLNNGQEAPWIH-LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKT- 206

Query: 160 YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAIN 219
           YK  LD IK +   +G+ GLYKGL ++ +     +  W  YE + R  +E +      I+
Sbjct: 207 YKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIH 266

Query: 220 XXXXXXXXXXX---------------XXXXAYPSDVV----KQVVLCND--KYDGSFKSW 258
                                          YP +VV    +Q    N   KY G  +S+
Sbjct: 267 EDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSF 326

Query: 259 RTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           R  +K+    +G+   + G  P  LR+ P        +E V++
Sbjct: 327 RVIIKE----EGLVSMYSGLTPHLLRTVPNSIIMFGTWELVIK 365

>Scas_697.47
          Length = 328

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 124/301 (41%), Gaps = 30/301 (9%)

Query: 3   KSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKG 62
           K+   +T P N++  N     +   VAG   GV     GHPFD IKVR Q+ Q  +    
Sbjct: 21  KARPPVTPPANAIRDN-----LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHA 75

Query: 63  PLDCVYKTFRN--------QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYP 114
            +  + K  R           ++GFY G  PPL+G   + +V        + ++ +    
Sbjct: 76  -IKIILKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS-DS 133

Query: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ 174
           +  +L +     +G ++    + +  P E  K  LQ     + T + G     K I    
Sbjct: 134 SSAQLTMGQMAAAGFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIG---AAKNIVKDG 190

Query: 175 GIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRENTKMSEAAI------NXXXXXXXX 227
           G++ L+KG ++TL         ++ SYE+  ++  +    +E+        N        
Sbjct: 191 GVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIA 250

Query: 228 XXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSK-GINGFFKGFVPSFLRSF 286
                   +P D +K  +       GS +S   A ++IY  + GI GFF G  P+ LRSF
Sbjct: 251 GMSMWLVVFPIDTIKTKL---QSSSGS-QSMVAATREIYVKRGGIKGFFPGLGPALLRSF 306

Query: 287 P 287
           P
Sbjct: 307 P 307

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 124/308 (40%), Gaps = 45/308 (14%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF 60
           +S++ + +TE + SL             AG   GV     GHPFD +KVR Q++Q  +  
Sbjct: 18  VSQTKSQLTENLKSL------------AAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAM 65

Query: 61  KGPLDCVYKTFRNQG------IRGFYLGFTPPLVGWILMDSV----------MLGCLHNY 104
                 +    +  G      +RGFY G  PPL+G   + +V          ++  + + 
Sbjct: 66  DAVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSS 125

Query: 105 RMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPL 164
                  V P   +L LS    +G ++    + +  P E  K  LQ    K +      L
Sbjct: 126 AASGAAAVEP---ELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGKASF-----L 177

Query: 165 DVIKKIYSAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRENTKMSEAAI---NX 220
           D  K+I   QG + L+KG ++TL         ++ SYE+   +  + +  +   +   N 
Sbjct: 178 DAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNV 237

Query: 221 XXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKG-INGFFKGFV 279
                          +P D VK  +  + K     +  R     IY ++G I GFF G  
Sbjct: 238 CISGGMAGVSMWVVVFPIDTVKTQLQSSSKRQSMLEVTRM----IYNTRGGIKGFFPGVG 293

Query: 280 PSFLRSFP 287
           P+ LRSFP
Sbjct: 294 PAILRSFP 301

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 121/283 (42%), Gaps = 29/283 (10%)

Query: 21  YSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           +  I  F  G  +G     V +P D +K R+Q  ++ +++K  +DC  K F  +GIRG Y
Sbjct: 516 FDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIY 575

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYR-MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA 139
            G  P L+G     ++ L      R  LM K+       L     I+SG  AG       
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHA-----NLKWYFEILSGACAGACQVVFT 630

Query: 140 PPIELAKAKLQVQYDKTTTRYKG---PLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VY 195
            P+E+ K +LQV+ +      K     L VIK++    GI+GLYKG+ + L+    F   
Sbjct: 631 NPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL----GIKGLYKGIAACLMRDVPFSAI 686

Query: 196 WWGSYELLTR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVVLCN- 248
           ++ +Y  L +    +    K     +                AY   P DV+K  +  + 
Sbjct: 687 YFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDP 746

Query: 249 ----DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
                +Y+G F + RT +K+    +    FFKG     LRS P
Sbjct: 747 RKGETRYEGIFHAARTILKE----ESFKSFFKGGSARVLRSSP 785

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 120/290 (41%), Gaps = 26/290 (8%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTS--QNETR----FKGPLDCVYKTFRNQGIRGFYL 81
           ++G  SG     +  PFD  K RLQ    QN T     +KG        F+++G  G Y 
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 82  GFTPPLVGWILMDSVMLGCLHNYRMLMHKY---VYPNDEKLPLSGCIISGVLAGWSVSFI 138
           G  P ++G+I    +        R    KY   ++P+    P      S + AG   +  
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCR----KYSVDIFPHS---PFLSNASSAITAGAISTVA 155

Query: 139 APPIELAKAKLQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW 196
             PI + K +L +Q    K +T YKG +D  +KI   +G + LY GL+  L+   +    
Sbjct: 156 TNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQ 215

Query: 197 WGSYELLTRWF--RENTKMSEAAINXX-----XXXXXXXXXXXXXAYPSDVVK-QVVLCN 248
           +  YE L   F   E+T +S    +                     YP ++++ ++ L +
Sbjct: 216 FPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKS 275

Query: 249 DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEF 298
           D  +   +     +K  Y+ +G  GF+ GF  + +R+ P        FE+
Sbjct: 276 DLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 122/282 (43%), Gaps = 28/282 (9%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQT-----SQNETRFKGPLDCVYKTFRNQGIRG 78
           I  FV+G  +GV++  V +P D +K R+Q      + +   + G +DC+ +  + +G   
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
            Y G + P++      +    C  +Y+  M K +Y  D KL     I+SG LAG + + +
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQK-MFKDLYGVD-KLTQQISILSGSLAGVTEACV 126

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWG 198
             P EL K +LQ       +++ GP++V+ K     GI  LY GL ST+ +R  F  W G
Sbjct: 127 IVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRETGILSLYNGLESTM-WRNAF--WNG 179

Query: 199 SYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSD-----VVK---QVVLCNDK 250
            Y  +    R     ++                    Y ++     VVK   Q       
Sbjct: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239

Query: 251 YDGSFK-----SWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
            DG+       +W +  K IY  +G    +KGF+P  LR  P
Sbjct: 240 ADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGP 280

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTT---TRYKGPLDVIKKIY 171
           +++ LP     +SG  AG S   +  P+++ K ++Q+Q    T     Y G +D + +I 
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61

Query: 172 SAQGIRGLYKGLISTLIFR 190
             +G   LYKG+ S ++  
Sbjct: 62  KREGFSRLYKGISSPMLME 80

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 116/284 (40%), Gaps = 33/284 (11%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ------------NETRFKGPLDCVYKT--F 71
             VAG   GV     GHPFD IKVR Q++Q             E R    ++    T  F
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLF 83

Query: 72  RNQGIRGFYLGFTPPLVGWILMDSVML-GCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
               ++GFY G  PPL+G   + +V   G     R++  K    +D  L  +    +G +
Sbjct: 84  FKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQA--SDAPLTTAQMATAGFI 141

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP-LDVIKKIYSAQGIRGLYKGLISTLIF 189
           +    + +  P E  K  LQ     T + +KG  +   K I S  G++ L+ G ++TL  
Sbjct: 142 SAIPTTLVTAPTERIKVVLQ-----TNSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLAR 196

Query: 190 R-THFVYWWGSYEL----LTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQV 244
                  ++ SYEL    L +   +  K      N                +P D +K  
Sbjct: 197 DGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTR 256

Query: 245 VLCNDKYDGSFKSWRTAVKDIY-QSKGINGFFKGFVPSFLRSFP 287
           +    +   +  S   A KDIY Q  GI GFF G  P+ LRSFP
Sbjct: 257 L----QVATTPISMVQATKDIYIQRGGIKGFFPGLGPALLRSFP 296

>Kwal_23.4731
          Length = 314

 Score = 79.3 bits (194), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 118/285 (41%), Gaps = 29/285 (10%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQG-----IRGFYLG 82
           +AG+ +G       HP D +K+RLQ   N T   G  + +    R+        R  Y G
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRG 77

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKY-----------VYPNDEKLPLSGCIISGVLA 131
               L+G  +   +  G     + ++++Y            +  D+ +  S  + S  L+
Sbjct: 78  LGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALS 137

Query: 132 GWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT 191
           G   + +  PI + K ++     + + RYK   D I+K+Y+ +G  G ++GL+ +L    
Sbjct: 138 GLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSLFGVA 197

Query: 192 HFVYWWGSYELL------TRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK--- 242
               ++  Y+ L       R   E+ KM    +                 YP  ++K   
Sbjct: 198 QGAIYFTIYDSLRHQYFARRGITEDEKMGN--LENIAITSVSKMLSVTAVYPFQLLKSNL 255

Query: 243 QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           Q     +K D S++ W   VK I+Q +G+ G +KG   + LR+ P
Sbjct: 256 QSFAAVEKRD-SYRFW-NLVKSIHQKEGLQGLYKGLSANLLRAIP 298

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 77/186 (41%), Gaps = 27/186 (14%)

Query: 120 PLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIY-----SAQ 174
           PL   II+G+ AG   +    P++L K +LQ+  +  TT   G  +VIK I       + 
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVN--TTHSHGYKEVIKTIIRDSKADSN 69

Query: 175 GIRGLYKGLISTLI--------------FRTHFVYWWGSYELLT---RWFRENTKMSEAA 217
             R  Y+GL   LI              F    VY +G  ++ T     F+++  M  + 
Sbjct: 70  VFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSL 129

Query: 218 INXXXXXXXXXXXXXXXAYPSDVVK-QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFK 276
                              P  V+K +++  + +    +K+    ++ +Y  +G +GF++
Sbjct: 130 --YLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWR 187

Query: 277 GFVPSF 282
           G VPS 
Sbjct: 188 GLVPSL 193

>Scas_589.10
          Length = 316

 Score = 79.3 bits (194), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 121/285 (42%), Gaps = 30/285 (10%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF--------KGP-----LDCVYKT 70
           I  F++G  +G+++  + +P D +K R Q   N+           K P     L C+ K 
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKI 73

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
            + +G +  Y G +PPL+  +   +V       ++ +M K      +++  +  +++G  
Sbjct: 74  LKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF--KLKEVTSTVTLLAGTF 131

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR 190
           AG + S I  P EL K +LQ       + Y+ P+   + I   QG+ G+Y G  ST+   
Sbjct: 132 AGITESLIVVPFELVKIRLQ----DAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRN 187

Query: 191 THFVYWWGSYELLTRWFR------ENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQV 244
           T    W  SY  L    +      ++T   +   N               + P DVVK  
Sbjct: 188 T---IWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTR 244

Query: 245 VLCNDKY-DGSFKSWR-TAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           +  + K   G    W   +V  IY+++GI G +KG +P   R  P
Sbjct: 245 MQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 86/185 (46%), Gaps = 23/185 (12%)

Query: 17  SNETYSRIM-------------GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP 63
           SNE + +IM               +AG F+G+ ++ +  PF+ +K+RLQ +Q++  ++ P
Sbjct: 103 SNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSD--YRSP 160

Query: 64  LDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG 123
           + C      NQG+ G Y GF   +    + ++   G +   +    K++          G
Sbjct: 161 IRCTRTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVK----KFIPRAKSTTKFQG 216

Query: 124 C---IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKG-PLDVIKKIYSAQGIRGL 179
                + G +AG    F++ P ++ K ++Q     ++    G     +  IY  +GI+G+
Sbjct: 217 IRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGI 276

Query: 180 YKGLI 184
           YKG++
Sbjct: 277 YKGIL 281

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 73/181 (40%), Gaps = 16/181 (8%)

Query: 118 KLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTT-----------RYKGPLDV 166
           KLP     ISG +AG S + +  P+++ K + Q+Q +K               +   L  
Sbjct: 10  KLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSC 69

Query: 167 IKKIYSAQGIRGLYKGLISTLIFRT-HFVYWWGSYELLTRWFRENTKMSEAAINXXXXX- 224
           + KI   +G + LYKG+   L+         + S E   +   +  K+ E          
Sbjct: 70  LSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAG 129

Query: 225 XXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
                       P ++VK + L + + D  ++S     + I +++G+ G + GF  +  R
Sbjct: 130 TFAGITESLIVVPFELVK-IRLQDAQSD--YRSPIRCTRTIIENQGLFGIYAGFESTIWR 186

Query: 285 S 285
           +
Sbjct: 187 N 187

>Scas_602.8
          Length = 885

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 117/280 (41%), Gaps = 22/280 (7%)

Query: 21  YSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           +  I  F  G  +G     + +P D IK R+Q  ++ T++K  +DC+ K F  +GIRG Y
Sbjct: 496 FDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLY 555

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G  P L+G     ++ L         M K +      L L   ++SG  AG        
Sbjct: 556 SGLGPQLIGVAPEKAIKLTV----NDFMRKSLVDKKGNLQLGAEVLSGATAGACQVVFTN 611

Query: 141 PIELAKAKLQVQYDKTTTRY-KGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VYWWG 198
           P+E+ K +LQV+ + T     K  L   + I   + I GLYKG+ + L+    F   ++ 
Sbjct: 612 PLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLI-GLYKGVGACLLRDVPFSAIYFP 670

Query: 199 SYELLTR---WFRENTKMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVV-----LC 247
           +Y  L +    F  N K     +                A+   P DV+K  +     + 
Sbjct: 671 TYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVG 730

Query: 248 NDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
             +Y G   + RT +K+    +    FFKG     +RS P
Sbjct: 731 ETRYTGILHAVRTILKE----ESFRSFFKGGAARVMRSSP 766

>Kwal_23.2913
          Length = 320

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 117/294 (39%), Gaps = 37/294 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR-----------NQG 75
             AG   GV     GHPFD +KVR Q++Q      G LD + +              NQ 
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLLKVRCQSNQAS----GTLDAISRVLHEAKSKSGPLPLNQ- 86

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYP------NDEKL-PL--SGCII 126
           I+GFY G  PPL+G   + +V        + L+     P      +  KL PL  S   +
Sbjct: 87  IKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLAL 146

Query: 127 SGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           +G  +    + I  P E  K  LQ      T+     L   + +    G+R L++G ++T
Sbjct: 147 AGFFSAIPTTLITAPTERVKVVLQ------TSESGSFLGAARTLIREGGVRSLFQGTLAT 200

Query: 187 LIFR-THFVYWWGSYELLTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQV 244
           L         ++ SYE+  R+   N      + ++                +P D +K  
Sbjct: 201 LARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTK 260

Query: 245 VLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEF 298
           +  + +     +S   A ++IY   G+ GFF G  P+ +RSFP         EF
Sbjct: 261 LQSSSRS----QSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEF 310

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 82/187 (43%), Gaps = 18/187 (9%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
           +AG FS +    +  P + +KV LQTS++ +     L       R  G+R  + G     
Sbjct: 146 LAGFFSAIPTTLITAPTERVKVVLQTSESGSF----LGAARTLIREGGVRSLFQG----T 197

Query: 88  VGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLS--GCIISGVLAGWSVSFIAPPIELA 145
           +  +  D            +  +++  N +   LS     ++G +AG S+     PI+  
Sbjct: 198 LATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTI 257

Query: 146 KAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI--FRTHFVYWWGSYELL 203
           K KLQ     +++R +  +   ++IY+  G+RG + GL   L+  F  +   + G  E  
Sbjct: 258 KTKLQ-----SSSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLG-VEFT 311

Query: 204 TRWFREN 210
            + F++N
Sbjct: 312 HQLFKQN 318

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 123/293 (41%), Gaps = 32/293 (10%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNE----------TRFKG 62
           I N     I  F AG  +GV++  V +P D +K R+Q   T++              + G
Sbjct: 4   IDNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTG 63

Query: 63  PLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHK-YVYPNDEKLPL 121
            +DC+ K  + +G    Y G T P++      ++       ++    K +  PN E +  
Sbjct: 64  VMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGE-MTQ 122

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
              I SG  AG   +F+  P EL K +LQ       +++K P++V+K      G+  L+ 
Sbjct: 123 KIAIYSGASAGAVEAFVVAPFELVKIRLQ----DVNSQFKTPIEVVKNSVVKGGVLSLFN 178

Query: 182 GLISTLIFRTHFVYWWGSYELL--TRWFRENTKMS-EAAINXXXXXXXXXXXXXXXAYPS 238
           GL +T I+R H ++  G + ++   R      K S E   N                 P 
Sbjct: 179 GLEAT-IWR-HVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPF 236

Query: 239 DVVKQVVLCND----KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           DVVK  +  +     KY+ S  S    V  +Y+ +G    +KGF P  +R  P
Sbjct: 237 DVVKSRIQRSSGPLRKYNWSLPS----VLLVYREEGFKALYKGFAPKVMRLAP 285

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 116/317 (36%), Gaps = 57/317 (17%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTS--QNETRFKGPLDCVYKTF-------------- 71
           ++G  +G     +  P D  K RLQ    Q       P+  V  TF              
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 72  --RNQGIRGFYLGFTPPLVG----WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCI 125
             R++ IRG Y G  P ++G    W++  SV   C      L +   + N E L  S   
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERC-----KLSYPRYFNNSEFLSHS--- 219

Query: 126 ISGVLAGWSVSFIAPPIELAKAKLQVQYDKT---TTRYKGPLDVIKKIYSAQGIRGLYKG 182
           +S + AG   + +  PI + K +L +Q  K     T YK  LD   KIY  +GI+  Y G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 183 LISTLIFRTHFVYWWGSYELLTRWF------RENTKMSEAAINXXXXXXXXX-------- 228
           LI +L    H    +  YE L +        R N +      N                 
Sbjct: 280 LIPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLI 339

Query: 229 -------XXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPS 281
                         YP ++++  +        S KS    ++  Y  +GI GF+ GF+ +
Sbjct: 340 VASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKS---IIRTTYAKEGIRGFYSGFLTN 396

Query: 282 FLRSFPXXXXXXXXFEF 298
             R+ P        FE+
Sbjct: 397 MFRTVPASAITLVSFEY 413

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 92/214 (42%), Gaps = 45/214 (21%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRL--QTSQN---ETRFKGPLDCVYKTFRNQGIRGFYLG 82
           ++ + +G     + +P   +K RL  Q+ +N    T +K  LD   K ++ +GI+ FY G
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKYVY--PNDEKLPLSG----------------C 124
             P L G +L  ++        + ++H Y    PN E + ++G                 
Sbjct: 280 LIPSLFG-LLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
           I++   +    S +  P E+ + +LQ++ D K + +      +I+  Y+ +GIRG Y G 
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIK-----SIIRTTYAKEGIRGFYSGF 393

Query: 184 ISTLI---------------FRTHFVYWWGSYEL 202
           ++ +                FR HF  W  S E+
Sbjct: 394 LTNMFRTVPASAITLVSFEYFRKHFKLWNDSIEV 427

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 91/203 (44%), Gaps = 18/203 (8%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQ 55
           M+K  + I +      + +  S+   F AG  +      V +P + +K+R+Q      + 
Sbjct: 1   MAKGEDKIQKS-----AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAA 55

Query: 56  NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN 115
           N+  +  P   +   FRN+GIRG   G     +  I ++   LG     R +M+K  YP+
Sbjct: 56  NQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPD 115

Query: 116 DEKLPLSGC---IISGVLAGWSVSFIAPPIELAKAKLQVQYDK----TTTRYKGPLDVIK 168
            E   +      + +G  +G   + +  P+ L K +LQ   +       T Y G  + +K
Sbjct: 116 QESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLK 175

Query: 169 KIYSAQGIRGLYKGLISTLIFRT 191
            IY  +G++GL++G I   I RT
Sbjct: 176 TIYMTEGVKGLFRG-IDAAILRT 197

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 83/190 (43%), Gaps = 21/190 (11%)

Query: 29  AGVFSGVAKNAVGHPFDTIKVRLQTSQN------ETRFKGPLDCVYKTFRNQGIRGFYLG 82
           AG  SG+    +G P   +K RLQ+  N      +T + G  + +   +  +G++G + G
Sbjct: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189

Query: 83  FTPPLVGWILMDSVMLGCLHNYR-MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPP 141
               ++      SV L   +  +  L+   +  +   L L+   ISG+     V+ +  P
Sbjct: 190 IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL----GVAVVMNP 245

Query: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYE 201
            ++   ++   Y++    YKGP+D + K    +GI  LYKG  +        V+  G + 
Sbjct: 246 WDVILTRI---YNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQ-------VFRIGPHT 295

Query: 202 LLTRWFRENT 211
           +L   F E T
Sbjct: 296 ILCLTFLEQT 305

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 113/300 (37%), Gaps = 47/300 (15%)

Query: 43  PFDTIKVRLQTS------------------QNETRFKGPLDCVYKTFRNQGIRGFYLGFT 84
           PFD +K RLQ+                   Q    F+  +  +   +  +G R  + G  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 85  PPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIEL 144
           P LVG I   S+        +    + +  ND +       ++G  AGW+ S    PI L
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLL--NDGQEAPWIHFLAGATAGWATSTATNPIWL 186

Query: 145 AKAKLQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYEL 202
            K +LQ+    D  + RYK   D +K +   +GI GLYKGL ++ +     +  W  YE 
Sbjct: 187 VKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVLYEQ 246

Query: 203 LTRWFR-----------ENTKMSEAAINXXXXXXXXXXXXXXXA----YPSDVV----KQ 243
           +    R           E  K +   +                A    YP +VV    +Q
Sbjct: 247 MKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQ 306

Query: 244 VVLCND--KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
               N   KY G F+S+   +K+    +G    + G  P  +R+ P        +E V++
Sbjct: 307 APKENGKLKYTGLFQSFSLIIKE----EGFASMYSGLTPHLMRTVPNSIIMFGTWELVIK 362

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/306 (19%), Positives = 127/306 (41%), Gaps = 34/306 (11%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF 60
           M  +SN++  P+   I           ++G+ +G     V HP D IK+RLQ +  + + 
Sbjct: 1   MDATSNSVLSPLQKEI-----------ISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKP 49

Query: 61  KGPLDCVYKTFRN---------QGIRGFYLGFTPPLVGWIL------MDSVMLGCLHNYR 105
               + V +  ++         +  RG  +      V W L          ++  L +  
Sbjct: 50  SSYYNQVQRIIKDGSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEP 109

Query: 106 MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLD 165
            L +K++  ND K+  S  ++S   +G + + +  P+ + K +  +   K++  Y   L+
Sbjct: 110 ALQNKFM--NDRKMTSSMYLVSAGASGLATALLTNPMWVIKTR--IMSTKSSQGYTSILN 165

Query: 166 VIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLT-RWFRENTKMSEAAINXXXX- 223
            I +IY+ +G++  ++GL+ +L   T    ++  Y+ L  ++  +   + E  +N     
Sbjct: 166 AITRIYTEEGLKTFWRGLVPSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETI 225

Query: 224 --XXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPS 281
                         YP  ++K  +              + ++ I+ + GI GF+KG   +
Sbjct: 226 GIISLSKMISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFAN 285

Query: 282 FLRSFP 287
            +R+ P
Sbjct: 286 LVRAIP 291

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 1/65 (1%)

Query: 42  HPFDTIKVRLQTSQNETRFKGPLDCVYKTF-RNQGIRGFYLGFTPPLVGWILMDSVMLGC 100
           +P   +K  LQT + E      ++ + ++     GI GFY G    LV  I    +  G 
Sbjct: 240 YPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGV 299

Query: 101 LHNYR 105
             +++
Sbjct: 300 YEHFK 304

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 119/310 (38%), Gaps = 25/310 (8%)

Query: 10  EPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETR------FKGP 63
           E  N   +    S+   FVAG  +      V +PFD +K R+Q  Q E        +  P
Sbjct: 7   EKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQL-QGELHANAAKVYTNP 65

Query: 64  LDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG 123
           +      F+N+GI G   G     +  I ++   LG     R +++   YPN E   +  
Sbjct: 66  IQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQH 125

Query: 124 C---IISGVLAGWSVSFIAPPIELAKAKLQVQYDK----TTTRYKGPLDVIKKIYSAQGI 176
               + +G  +G   +FI  P+ L K ++Q   +       T Y    + +  I+ ++GI
Sbjct: 126 IGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGI 185

Query: 177 RGLYKGLISTLIFRTHF--VYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXX 234
           +GL++G +   + RT          Y +   +  ++  M++                   
Sbjct: 186 KGLFRG-VDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVA 244

Query: 235 AYPSDVVKQVVLCNDK---YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXX 291
             P DVV   V  N K   Y G    +   V++    +G++  +KGF    LR  P    
Sbjct: 245 MNPWDVVLTRVY-NQKGNLYSGPIDCFIKTVRN----EGLSALYKGFGAQILRIGPHTVL 299

Query: 292 XXXXFEFVLR 301
                E  L+
Sbjct: 300 CLTFMEQTLK 309

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 121/307 (39%), Gaps = 24/307 (7%)

Query: 11  PVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT---SQNETRFKGPLDCV 67
           P N + S ++ +  +  VAG  +G+ +    HP DTIKVR+Q    +   T+  G L   
Sbjct: 45  PDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTG 104

Query: 68  YKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIIS 127
              +  +G+  FY G    ++G I   ++       YR L+          +      ++
Sbjct: 105 ANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLA 161

Query: 128 GVLAGWSVS-FIAPPIELAKAKLQVQY---DKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
           GV AG + +  +  P+E+ K +LQ Q+        +Y+  +     I   +GI  LY+G+
Sbjct: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221

Query: 184 ISTLIFR-----THFVYWWGSYELLTRWF-RENTKMSEAAINXXXXXXXXXXXXXXXAYP 237
             T   +      +F  +    E L  +   +N    E ++                  P
Sbjct: 222 SLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSL----IGLVSGAIGPFSNAP 277

Query: 238 SDVVKQVVLCNDKYDGSFKSW---RTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXX 294
            D +K   L  DK   +  +W    T  + + Q +G    +KG  P  +R  P       
Sbjct: 278 LDTIK-TRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFT 336

Query: 295 XFEFVLR 301
            +EFV R
Sbjct: 337 VYEFVRR 343

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/308 (20%), Positives = 122/308 (39%), Gaps = 31/308 (10%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQ 55
           MS  +  +    +   + +  S++  F+AG  +      V +PF+ +K R+Q     ++ 
Sbjct: 1   MSSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSAT 60

Query: 56  NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN 115
           N+  ++ P   +   F+N+G++G   G     V  I ++   LG     R +++K  +P 
Sbjct: 61  NQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPE 120

Query: 116 DEKLPLSGC---IISGVLAGWSVSFIAPPIELAKAKLQVQYDK----TTTRYKGPLDVIK 168
            +   L      + +G  +G   + +  P+ L K ++Q   +       T Y    + + 
Sbjct: 121 SDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLA 180

Query: 169 KIYSAQGIRGLYKGLISTLIFRTHFVYWWGS------YELLTRWFRENTKMSEAAINXXX 222
            I+  +G+ GL++G +   I RT      GS      Y     +  +N  M E       
Sbjct: 181 TIFKKEGVLGLFRG-VDAAILRT----GAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLL 235

Query: 223 XXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQS---KGINGFFKGFV 279
                         P DVV   V     Y+    +++  +  ++++   +GI   +KGF 
Sbjct: 236 SSTVTGLGVGIVMNPWDVVLTRV-----YNQKGNTYKGPIDCMFKTIKIEGIGALYKGFG 290

Query: 280 PSFLRSFP 287
               R  P
Sbjct: 291 AQLFRIAP 298

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 135/326 (41%), Gaps = 37/326 (11%)

Query: 1   MSKSSNAITEP--VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET 58
           MS+ +  + +P  V S++ N++    + F+AG  +G     V  PF+ +K+ LQ   + T
Sbjct: 1   MSELAQVLPQPSYVKSILKNDSN---VAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTT 57

Query: 59  RF-KGPLDCVYKTFRNQGIRGFYLG--------FTPPLVGWILMDSVMLGCLHNYRMLMH 109
            + +G +  V + +R +G  G + G        F    V +++ ++    C  ++    H
Sbjct: 58  AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEA----CKKHF---FH 110

Query: 110 KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK-------- 161
                  E+L     + SG L G        P++L + +L +Q    T   K        
Sbjct: 111 VDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISK 170

Query: 162 --GPLDVIKKIYSAQ-GIRGLYKGLISTLIFRTHFVYW-WGSYELLTRWFRENTKMSEAA 217
             G  D++ + Y  + GI+GLY+G+  T +    +V   +  YE    +  E T  + A 
Sbjct: 171 PPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLAN 230

Query: 218 INXXXXXXXXXXXXXXXAYPSDVVKQ----VVLCNDKYDGSFKSWRTAVKDIYQSKGING 273
                             YP D++++    + +  ++    +KS   A+  I +++G  G
Sbjct: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290

Query: 274 FFKGFVPSFLRSFPXXXXXXXXFEFV 299
           ++KG   +  +  P        +E V
Sbjct: 291 YYKGLTANLFKVIPSTAVSWLVYEVV 316

>Kwal_26.7653
          Length = 325

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 88/188 (46%), Gaps = 15/188 (7%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQNETRFKGPLDCVYKTF 71
           + +  S+   F+AG  +      V +P + +K R+Q     ++  +  +K P+  +   F
Sbjct: 18  AAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIF 77

Query: 72  RNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGC---IISG 128
           +N+GIRG   G +   +  I ++   LG     R +++K  YP  +   +      ++SG
Sbjct: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSG 137

Query: 129 VLAGWSVSFIAPPIELAKAKLQ-----VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
             +G   + +  P+ L K ++Q     +Q  +  T Y    + +  IY A+G +GLY+G 
Sbjct: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRG- 195

Query: 184 ISTLIFRT 191
           +   I RT
Sbjct: 196 VDAAILRT 203

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 114 PNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTR---YKGPLDVIKKI 170
           P  +K+  +G  I+G +A      +  PIEL K ++Q+Q + +      YK P+  +K I
Sbjct: 17  PAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI 76

Query: 171 YSAQGIRGLYKGLISTLIFR 190
           +  +GIRGL KGL    I++
Sbjct: 77  FKNEGIRGLQKGLSCAYIYQ 96

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 92/218 (42%), Gaps = 30/218 (13%)

Query: 10  EPVNSLISNETYSRI---------MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQN---- 56
           EP+ S+++   Y  +         +  V+G  SG+    +G P   IK R+Q+  N    
Sbjct: 108 EPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQI 167

Query: 57  --ETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYP 114
             +T +    + +   +R +G +G Y G    ++      SV L   +  +  + K+   
Sbjct: 168 GQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH--- 224

Query: 115 NDEKLPLSGC-IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSA 173
            D     +G  +++  ++G+ V  +  P ++   ++   Y++    YKGPLD   K    
Sbjct: 225 -DLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRV---YNQKGNLYKGPLDCFVKTVRI 280

Query: 174 QGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENT 211
           +GI  LYKG     IFR         + +L   F E T
Sbjct: 281 EGIGALYKGF-EAQIFRI------APHTILCLTFMEQT 311

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 86/185 (46%), Gaps = 13/185 (7%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQNETRFKGPLDCVYKTFRN 73
           +  S+   FVAG  +      V +P + IK+R+Q     ++     +K P+  +   F+N
Sbjct: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77

Query: 74  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDE--KLPLSGC-IISGVL 130
           +GI+G   G     +  I ++   LG     R  +++  +P+ E  K+   G  + SG  
Sbjct: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAA 137

Query: 131 AGWSVSFIAPPIELAKAKLQVQYD----KTTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           +G   + I  P+ L K +LQ   +       T Y G  + +  I+  +G++GL++G I  
Sbjct: 138 SGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG-IDA 196

Query: 187 LIFRT 191
            I RT
Sbjct: 197 AILRT 201

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 78/169 (46%), Gaps = 15/169 (8%)

Query: 29  AGVFSGVAKNAVGHPFDTIKVRLQTSQN------ETRFKGPLDCVYKTFRNQGIRGFYLG 82
           +G  SG+    +G P   +K RLQ+         +T + G  + +   F+ +G++G + G
Sbjct: 134 SGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG 193

Query: 83  FTPPLVGWILMDSVMLGCLHNYR-MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPP 141
               ++      SV L   +  + +L+   +  +   L L+   ISG+     V+ +  P
Sbjct: 194 IDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGL----GVAVVMNP 249

Query: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR 190
            ++   ++   Y++    YKGP+D + K    +G+  LYKG  +  +FR
Sbjct: 250 WDVILTRI---YNQKGDLYKGPIDCLVKTVRIEGVTALYKGF-AAQVFR 294

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFT 84
             A   SG+    V +P+D I  R+   + +  +KGP+DC+ KT R +G+   Y GF 
Sbjct: 233 LTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFA 289

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 87/177 (49%), Gaps = 12/177 (6%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT----FRNQGIR 77
           S+   ++AG  +G+A     +P DT+K R+Q +  +T+ KG  + +++T    FR  G+R
Sbjct: 346 SKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGN-NLLFQTAKDMFREGGLR 404

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHN----YRMLMHKYVYPNDEKLPLSGCII--SGVLA 131
            FY G T  +VG     ++ LG        Y     K +    +++ LS  ++   G  +
Sbjct: 405 LFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFS 464

Query: 132 GWSVSFIAPPIELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLISTL 187
           G   + +  PI L + +LQ Q        Y G  DV+ K    +G +GL+KGL+ TL
Sbjct: 465 GTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTL 521

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 110/298 (36%), Gaps = 39/298 (13%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRL--------------------QTSQNETRFKGPLDC 66
           F+AG  SGV       PFD +KV L                      + +  +   PL  
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 67  VYKT-FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK-LPLSGC 124
             K+ +R  GI+ FY+G    ++      S+  G     + +M K     D K L     
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP---LDVIKKIYSAQGIRGLYK 181
            I+G LAG +  F   PI+    K +VQ     T+ KG        K ++   G+R  Y+
Sbjct: 351 YIAGGLAGMAAQFSVYPID--TLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYR 408

Query: 182 GLISTLI-FRTHFVYWWGSYELLTRWFRE------NTKMSEAAINXXXXXXXXXXXXXXX 234
           G+   ++    +     G++  L +W+        N    +  ++               
Sbjct: 409 GVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVG 468

Query: 235 A---YPSDVVKQVVLCNDKYDGS--FKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           A   YP ++++  +     Y     +  ++  +    + +G  G FKG VP+  +  P
Sbjct: 469 ASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCP 526

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 3/93 (3%)

Query: 20  TYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFRNQGI 76
           T S ++    G FSG    +V +P + ++ RLQ   T  +   + G  D + KT   +G 
Sbjct: 451 TLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGY 510

Query: 77  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMH 109
           +G + G  P L       S+   C  N +  M+
Sbjct: 511 QGLFKGLVPTLAKVCPAVSISYLCYENLKKFMN 543

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 118/307 (38%), Gaps = 54/307 (17%)

Query: 43  PFDTIKVRLQ---------------------------TSQNETRFKGPLDCVYKTFRNQG 75
           PFD +K RLQ                           T Q  T FK  +  +   +R +G
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
            R  + G  P LVG I   S+        + +  K  + N ++ P    +++   AGW+ 
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSK-AFNNGQEAPWIH-LMAAATAGWAT 193

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVY 195
           +    PI + K ++Q+     T  YK   D +K I   +GI GLY+GL ++ +     + 
Sbjct: 194 ATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGIL 253

Query: 196 WWGSYELLTRWFR-----------ENTKMSEAAINXXXXXXXXXXXXXXXA----YPSDV 240
            W  YE L    +           E+T  +   I                A    YP +V
Sbjct: 254 QWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEV 313

Query: 241 V----KQVVLCND--KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXX 294
           V    +Q  L N   KY G  +S+R  +K+    +G+   + G  P  +R+ P       
Sbjct: 314 VRTRLRQSPLENGKVKYTGLVQSFRVIIKE----EGLASMYSGLTPHLMRTVPNSIIMFG 369

Query: 295 XFEFVLR 301
            +E V++
Sbjct: 370 TWEVVIK 376

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 84/183 (45%), Gaps = 23/183 (12%)

Query: 42  HPFDTIKVRLQTSQ-NETR-FKGPLDCVYKTFRNQGIRGFYLGFTPPLVG-------WIL 92
           +P   +K R+Q  +  +TR +K   DC+    RN+GI G Y G +   +G       W+L
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLL 257

Query: 93  MDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG-----CIISGV--LAGWSVSFIAPPIELA 145
            +   L  L   R +  K+   ++  +  +      C  SG   LA +  S +  P E+ 
Sbjct: 258 YEQ--LKHLIKKRSI-EKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVV 314

Query: 146 KAKL-QVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT--HFVYWWGSYEL 202
           + +L Q   +    +Y G +   + I   +G+  +Y GL   L+ RT  + +  +G++E+
Sbjct: 315 RTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLM-RTVPNSIIMFGTWEV 373

Query: 203 LTR 205
           + +
Sbjct: 374 VIK 376

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 33  SGVAK---NAVGHPFDTIKVRLQTSQNET---RFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
           +G+AK   + V +P + ++ RL+ S  E    ++ G +       + +G+   Y G TP 
Sbjct: 297 AGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPH 356

Query: 87  LVGWILMDSVMLGC 100
           L+  +    +M G 
Sbjct: 357 LMRTVPNSIIMFGT 370

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 76/173 (43%), Gaps = 24/173 (13%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
              G  +G+  + V +P D ++ RL  ++   R     +C  + + N+G+RGF+ G +  
Sbjct: 118 LTVGALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEEC-RQMWLNEGVRGFFTGISTA 176

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK----LPLSGCIISGVLAGWSVSFIAPPI 142
           +    L  ++M        +     V  N EK     P+S    SG++AG+    +  PI
Sbjct: 177 MTTVTLSTAIMFLTYETVNI-----VCENHEKEFWSRPVSAS--SGIIAGFVSKTMVFPI 229

Query: 143 ELAKAKLQVQYDKTTT------------RYKGPLDVIKKIYSAQGIRGLYKGL 183
           +  + ++QV   K T             RYK    +I KI   +G+  LY+GL
Sbjct: 230 DTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGL 282

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 81/183 (44%), Gaps = 21/183 (11%)

Query: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ-NETRFKGPLDCVYKTF 71
           + L   ET S     +AG  SGV       P DT+K+R Q     E ++KG    V    
Sbjct: 8   DHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIM 67

Query: 72  RNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPND---EKLP----LSGC 124
           + +G+R  + G  P    +++  +V  G           Y + N+    K P        
Sbjct: 68  KEEGLRALWKGNIPATAMYVVYGAVQFGS----------YSWFNNVWSAKFPRFSQQGQT 117

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
           +  G LAG + S ++ P++L + +L    ++T+ R     +  ++++  +G+RG + G+ 
Sbjct: 118 LTVGALAGMTSSVVSYPLDLLRTRLIA--NRTSHR-TSVAEECRQMWLNEGVRGFFTGIS 174

Query: 185 STL 187
           + +
Sbjct: 175 TAM 177

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 17/95 (17%)

Query: 10  EPVNSLISN---ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ----------- 55
           E VN +  N   E +SR +   +G+ +G     +  P DT++ R+Q              
Sbjct: 192 ETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFP 251

Query: 56  ---NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
              +E R+K     +YK  R +G+   Y G T  L
Sbjct: 252 AVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGL 286

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 12/177 (6%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT----FRNQGIR 77
           SR+  +VAG   G+      +P DT+K R+Q +  +TR +G L  + KT    +R  G+R
Sbjct: 294 SRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRG-LPLLIKTAKDMYREGGLR 352

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHN----YRMLMHKYVYPNDEKLPLSGCII--SGVLA 131
            FY G    ++G     ++ LG        Y       +  ++ ++ +S  ++   G  +
Sbjct: 353 LFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFS 412

Query: 132 GWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
           G   + +  PI L + +LQ Q       RY G  DV +K    +G+ GLYKGL+ TL
Sbjct: 413 GTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 108/301 (35%), Gaps = 47/301 (15%)

Query: 43  PFDTIKVRLQT--------------------SQNETRFKGPL-DCVYKTFRNQGIRGFYL 81
           PFD IKV L                        +  + + PL       +R  G+R FYL
Sbjct: 195 PFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYL 254

Query: 82  GFTPPLVGWILMDSVMLGCLH-NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
           G    ++      ++  G      R+L          +L      ++G L G    F   
Sbjct: 255 GNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGIMAQFSVY 314

Query: 141 PIELAKAKLQVQYDKTTTRYKG-PL--DVIKKIYSAQGIRGLYKGL-ISTLIFRTHFVYW 196
           PI+    K ++Q     TR +G PL     K +Y   G+R  Y+GL +  L    +    
Sbjct: 315 PID--TLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALD 372

Query: 197 WGSYELLTRWF---RENT---KMSEAAINXXXXXXXXXXXXXXXA---YPSDVVKQVVLC 247
            G++  L RW+   R N      +E  ++               A   YP ++++  +  
Sbjct: 373 LGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQA 432

Query: 248 N------DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
                   +YDG    +R  V    Q +G+ G +KG VP+  +  P        +E + R
Sbjct: 433 QGTYAHPHRYDGFQDVFRKTV----QREGLPGLYKGLVPTLAKVCPAVAISYLCYENLKR 488

Query: 302 T 302
            
Sbjct: 489 A 489

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 127/321 (39%), Gaps = 48/321 (14%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTS---------------------------QNETR 59
           FVAG   G+A   V  PFD +K RLQ+                            Q  T 
Sbjct: 56  FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTH 115

Query: 60  FKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL 119
           FK  L  +   ++ +G R  + G  P LVG I   S+        +  M+   + N ++ 
Sbjct: 116 FKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKD-MYAKAFNNGQET 174

Query: 120 PLSGCIISGVLAGWSVSFIAPPIELAKAKLQV-QYDKTTTR-YKGPLDVIKKIYSAQGIR 177
           P+   +++   AGW+ +    PI L K ++Q+ +  KT+ R YK   D +K +   +G  
Sbjct: 175 PMIH-LMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFT 233

Query: 178 GLYKGLISTLIFRTHFVYWWGSYELLTRWFREN-----------TKMSEAAINXXXXXXX 226
           GLYKGL ++ +     +  W  YE + R  +E            TK +   +        
Sbjct: 234 GLYKGLSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSG 293

Query: 227 XXXXXXXXA----YPSDVVKQVVLCNDKYDGSFK--SWRTAVKDIYQSKGINGFFKGFVP 280
                   A    YP +VV+  +    K +G  K      + K I + +G+   + G  P
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTP 353

Query: 281 SFLRSFPXXXXXXXXFEFVLR 301
             +R+ P        +E V+R
Sbjct: 354 HLMRTVPNSIIMFGTWEIVIR 374

>Kwal_23.3965
          Length = 307

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 9/163 (5%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTS-QNETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
            VAG  SG++   V  P DT+K+RLQ    NE ++ G L    +  R +G+R  + G  P
Sbjct: 18  LVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVP 77

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELA 145
            +  +IL  S           L+ K   P       +G +  G L+G   +  + P ++ 
Sbjct: 78  AMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH---TGMV--GALSGTCSAIASYPCDVL 132

Query: 146 KAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           + +    + +  +     L   ++I+  +G RG +KG+ S+++
Sbjct: 133 RTRFIANHSRELSTM---LSTAQEIWRHEGFRGFFKGVSSSIV 172

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 80/168 (47%), Gaps = 6/168 (3%)

Query: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGI 176
           +++P+   +++G L+G S   +  P++  K +LQ+Q      +Y G L   K++   +G+
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQEGV 68

Query: 177 RGLYKGLISTL-IFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXA 235
           R L+KG +  + ++  +    + SY +L +   ++     A I+               +
Sbjct: 69  RALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS--QLPAQIHTGMVGALSGTCSAIAS 126

Query: 236 YPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFL 283
           YP DV++   + N   +    +  +  ++I++ +G  GFFKG   S +
Sbjct: 127 YPCDVLRTRFIANHSRE--LSTMLSTAQEIWRHEGFRGFFKGVSSSIV 172

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 64/144 (44%), Gaps = 9/144 (6%)

Query: 12  VNSLIS-NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT 70
           +N L+S ++  ++I   + G  SG       +P D ++ R   + +       L    + 
Sbjct: 96  LNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRF-IANHSRELSTMLSTAQEI 154

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPL---SGCIIS 127
           +R++G RGF+ G +  +V   +  S +L    + ++   +    +   + L   S  +I+
Sbjct: 155 WRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSASVIA 214

Query: 128 GVLAGWSVSFIAPPIELAKAKLQV 151
           G+++      I  PI+  + + QV
Sbjct: 215 GIVS----KTIVFPIDTVRKRYQV 234

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 63.2 bits (152), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 83/180 (46%), Gaps = 18/180 (10%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP---LDCVYKTFRNQGIRG 78
           SR+  ++AG   GVA     +P DT+K R+Q +   T  K     L    + ++  GIR 
Sbjct: 318 SRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRL 377

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK--LPLSGCIIS-------GV 129
           FY G    ++G     ++ LG    +  L   Y+    +K  LP    IIS       G 
Sbjct: 378 FYRGVHIGVMGIFPYAALDLGT---FSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGA 434

Query: 130 LAGWSVSFIAPPIELAKAKLQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
            +G   + +  PI L + +LQ Q  Y    T Y G  DV+KK    +G +GL+KGL+  L
Sbjct: 435 FSGTVGATLVYPINLLRTRLQAQGTYAHPHT-YNGFSDVLKKTIQREGYQGLFKGLVPNL 493

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 117/310 (37%), Gaps = 35/310 (11%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRL--------------------QTSQNETRFKGPLDC 66
           F+AG  SGV       PFD IKV L                      + + ++ K PL  
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 67  VYKT-FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPND-EKLPLSGC 124
              T +R  G+R FY+G    +V      ++  G     + +M +     D  +L     
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPL-DVIKKIYSAQGIRGLYKGL 183
            I+G L G +  F   PI+  K ++Q     T  +    L    K++Y   GIR  Y+G+
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 184 -ISTLIFRTHFVYWWGSYELLTRWF--RENTKM----SEAAINXXXXXXXXXXXXXXXA- 235
            I  +    +     G++  L +W+  +E  K      E  I+               A 
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 236 --YPSDVVKQVVLCNDKYDG--SFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXX 291
             YP ++++  +     Y    ++  +   +K   Q +G  G FKG VP+  +  P    
Sbjct: 443 LVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSI 502

Query: 292 XXXXFEFVLR 301
               +E + R
Sbjct: 503 SYLCYENLKR 512

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/298 (20%), Positives = 116/298 (38%), Gaps = 32/298 (10%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYK--------TFRNQGIRG 78
            ++G+ +G       HP D +KVRLQ      + +G  D V +        +F  +  RG
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRG 71

Query: 79  FYLGFTPPLVGWILM--------DSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
             +      V W L         D V   C  N  +        ND+++     +++  +
Sbjct: 72  LGVNLLGNSVAWGLYFGLYRASKDWVFQWC--NTDVKRFNNTMNNDKEMTSLMYLLAAAM 129

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR 190
           +G + S +  PI + K ++       +  Y+  +D IKK+Y  +G+ G ++GL+ +L   
Sbjct: 130 SGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFGV 189

Query: 191 THFVYWWGSYELLTRWF----RENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQ--- 243
           +    ++  Y+ L   +      + K   + +                 YP  ++K    
Sbjct: 190 SQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQ 249

Query: 244 ----VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
                 + N K   S + W+  +  IY   G+ G +KG + + +R+ P        +E
Sbjct: 250 SFEVSTVINPK--TSHRVWK-LITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYE 304

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 76/182 (41%), Gaps = 21/182 (11%)

Query: 120 PLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG---- 175
           P+   +ISG+ AG   +    P++L K +LQ+    T  + +G  DV+K+I         
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLL--ATNKKPQGYYDVVKRIVKDSKQHSF 64

Query: 176 IRGLYKGLISTLIFRT-----HFVYWWGSYELLTRWFRENTKMSEAAINX---------X 221
            R  Y+GL   L+  +     +F  +  S + + +W   + K     +N           
Sbjct: 65  FRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYL 124

Query: 222 XXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDG-SFKSWRTAVKDIYQSKGINGFFKGFVP 280
                          P  V+K  ++     D  S++S    +K +Y+ +G+ GF++G VP
Sbjct: 125 LAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVP 184

Query: 281 SF 282
           S 
Sbjct: 185 SL 186

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 112/297 (37%), Gaps = 22/297 (7%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRN--- 73
           SN   + I G  AG+F  +      HP DTIKVR+Q  +             KT RN   
Sbjct: 8   SNPAVNLIAGGTAGLFEALC----CHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYT 63

Query: 74  -QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132
            +G+   Y G    ++G I   ++       YR  +          +      ++GV AG
Sbjct: 64  EEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALAD---KQTGSVSTGNTFLAGVGAG 120

Query: 133 WSVS-FIAPPIELAKAKLQVQY----DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
            + +  +  P+E+ K +LQ Q+       + RY+  L     I   +GI  LY+G+  T 
Sbjct: 121 TTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTA 180

Query: 188 IFR-THFVYWWGSYELLTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQVV 245
             + T+    +  Y  L  + +E+ K     +                   P D +K   
Sbjct: 181 ARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIK-TR 239

Query: 246 LCNDKYDGSFKSWRTAV---KDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
           L  DK   +   W   V   K + + +G    +KG  P  +R  P        +EFV
Sbjct: 240 LQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 296

>Scas_721.129
          Length = 323

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 113/290 (38%), Gaps = 31/290 (10%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQNETRFKGPLDCVYKTFRN 73
           +  S+   F+AG  +        +P + +K+R+Q      +  +  ++ P+  +   FRN
Sbjct: 17  QKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRN 76

Query: 74  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCII---SGVL 130
           +GIRG   G     +  I ++   LG     R  ++   YPN+E   +    I   +G  
Sbjct: 77  EGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGAS 136

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDK----TTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           +G   + I  P+ L K ++Q   D       T Y+   + +  I   +G +GL++G I  
Sbjct: 137 SGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRG-IDA 195

Query: 187 LIFRTHFVYWWGS------YELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDV 240
            I RT      GS      Y     +  +N  M +                     P DV
Sbjct: 196 AILRT----GAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDV 251

Query: 241 VKQVVLCNDK---YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           +   +  N K   Y G    +   V+    ++GI+  +KGF    LR  P
Sbjct: 252 ILTRIY-NQKGNLYKGPVDCFVKTVR----TEGISALYKGFQAQILRIAP 296

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 115/288 (39%), Gaps = 36/288 (12%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR-GFYLGFTPP 86
           V+G   G   ++  H  DT+K R Q + N  +++  +      +  +G+R G Y G+   
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAA 117

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146
           ++G     ++  G     +  M +    ND    LS    +G L  +  SF+  P E+ K
Sbjct: 118 MLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS----AGFLGDFISSFVYVPSEVLK 173

Query: 147 AKLQVQ------YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL-----IFRTHFVY 195
            +LQ+Q      + ++   Y    + IK +   +G R L+ G  +TL          F +
Sbjct: 174 TRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAF 233

Query: 196 WWGSYELLTRWFRENTKMSEAAI-NXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGS 254
           +    +L  +  +++ +  E +I N                 P DVVK  V        S
Sbjct: 234 YEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQS 293

Query: 255 FKSWRT-------------------AVKDIYQSKGINGFFKGFVPSFL 283
            KS+                     +++ +YQS+G+ GFF G  P F+
Sbjct: 294 NKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFV 341

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 30/202 (14%)

Query: 7   AITEPVNSLIS----NETYSRIMGFVAGVFSGVAKNAVG----HPFDTIKVRLQT----- 53
           A  + + SL+S     + Y++   F   +FSG A   +     +  D  + RL       
Sbjct: 96  AFKDKIKSLLSYDRERDGYAKW--FAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGS 153

Query: 54  -SQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV 112
            S ++ +F G LD   KT +  G+ G Y GF P ++G I+   +  G   +++       
Sbjct: 154 KSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFK------- 206

Query: 113 YPNDEKLPLSGCIISGVLAGWSVSFIAP----PIELAKAKLQVQYDKTTTRYKGPLDVIK 168
            P      L G  ++  L GW ++  A     P++  + ++ +   + T +Y G LD ++
Sbjct: 207 -PVLLTGALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMMTSGQ-TIKYDGALDCLR 264

Query: 169 KIYSAQGIRGLYKGLISTLIFR 190
           KI   +G   L+KG  +  IFR
Sbjct: 265 KIVQKEGAYSLFKGCGAN-IFR 285

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 117/279 (41%), Gaps = 32/279 (11%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKTFRNQGIRGF 79
            + GV + +AK     P + +K+ +Q  +        +TR+KG LDC  +T  ++GI  F
Sbjct: 18  LMGGVSAAIAKTGAA-PIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA 139
           + G T  ++ +    ++        + L+      +      +G + SG  AG       
Sbjct: 77  WRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFV 136

Query: 140 PPIELAKAKL--QVQYDKTTTR--YKGPLDVIKKIYSAQGIRGLYKGLIST----LIFRT 191
             ++ A+ +L    +  K+T++  + G LDV KK     G+ GLY+G + +    +++R 
Sbjct: 137 YSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRG 196

Query: 192 HFVYWWGSYE--LLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCND 249
            +   + S++  LLT        +  + +                +YP D V++ ++   
Sbjct: 197 LYFGLYDSFKPVLLT------GALEGSFVASFLLGWVITMGASTASYPLDTVRRRMMMTS 250

Query: 250 ----KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
               KYDG+    R     I Q +G    FKG   +  R
Sbjct: 251 GQTIKYDGALDCLR----KIVQKEGAYSLFKGCGANIFR 285

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 116/289 (40%), Gaps = 37/289 (12%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-------RGFY 80
           ++G+ +G     + HP D  KVRLQ     T  KG     Y+   ++ +       R  Y
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKG-----YRNLWSEIVGSDLSLTRELY 67

Query: 81  LGFTPPLVGWILMDSVMLGC-LHNYR-----MLMHKYVYPNDEKLP----LSGCIISGVL 130
            G T  LVG    +++  G    +YR     ++ + +   ND+ L     LS    SG+L
Sbjct: 68  RGLTVNLVG----NTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGML 123

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR 190
                + +  P+ + K ++  + +   T  K   D+IK      G++GL+KGL+  L+  
Sbjct: 124 T----TVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKN----DGVQGLWKGLVPALVGV 175

Query: 191 THFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXA--YPSDVVKQVVLCN 248
           +     +  Y+ L        + S+   N               +  YP  ++K  +   
Sbjct: 176 SQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSF 235

Query: 249 DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
              +  FK    + K IY   G+ GF+KG   + LRS P        +E
Sbjct: 236 QASENDFKLLPLS-KMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 17/179 (9%)

Query: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ 174
           +D   PL   +ISG+ AG   + I  P++L K +LQ+    T+T  KG  ++  +I  + 
Sbjct: 2   SDRYTPLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLI--TSTTKKGYRNLWSEIVGSD 59

Query: 175 --GIRGLYKGLISTLIFRTHFVYW---WGSYELLTRWF-----RENTKMSEAAINXXXXX 224
               R LY+GL   L+  T  + W   + SY +   +      R       ++       
Sbjct: 60  LSLTRELYRGLTVNLVGNT--IAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSAS 117

Query: 225 XXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFL 283
                       P  V+K  ++   K +    S +  ++D+ ++ G+ G +KG VP+ +
Sbjct: 118 ASSGMLTTVLTNPLWVIKTRMM--SKANSDLTSMK-VLRDLIKNDGVQGLWKGLVPALV 173

>Scas_718.24
          Length = 337

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 71/157 (45%), Gaps = 19/157 (12%)

Query: 42  HPFDTIKVRLQTSQNETR------FKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDS 95
           +  D  + RL      ++      F G +D   KT ++ G+ G Y GF P +VG I+   
Sbjct: 165 YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRG 224

Query: 96  VMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP----PIELAKAKLQV 151
           +  G        ++  + P      L G  ++  L GW V+  A     P++  + K+ +
Sbjct: 225 LYFG--------LYDSIKPVLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRKMMM 276

Query: 152 QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
              +   +YKG  D  KKI +A+G+  L+KG  + ++
Sbjct: 277 TSGQ-AVKYKGAFDCFKKIVAAEGVASLFKGCGANIL 312

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 121/280 (43%), Gaps = 35/280 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE--------TRFKGPLDCVYKTFRNQGIRG 78
            + GV + VAK A   P + +K+ +Q +QNE        T++KG +DC  +T + +GI  
Sbjct: 47  LMGGVSAAVAKTAA-SPIERVKLLIQ-NQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIIS 104

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
           F+ G T  ++ +    ++      +   LM  +   +      +G + SG  AG      
Sbjct: 105 FWRGNTANVIRYFPTQALNF-AFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGLSLLF 163

Query: 139 APPIELAKAKLQVQYDKT----TTRYKGPLDVIKKIYSAQGIRGLYKG----LISTLIFR 190
              ++ A+ +L      +    + ++ G +DV KK   + G+ GLY+G    ++  +++R
Sbjct: 164 VYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYR 223

Query: 191 THFVYWWGSYE--LLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCN 248
             +   + S +  LLT        +  + +                +YP D V++ ++  
Sbjct: 224 GLYFGLYDSIKPVLLT------GSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRKMMMT 277

Query: 249 D----KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
                KY G+F  +    K I  ++G+   FKG   + LR
Sbjct: 278 SGQAVKYKGAFDCF----KKIVAAEGVASLFKGCGANILR 313

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 115/287 (40%), Gaps = 20/287 (6%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLGFTP 85
           F+AG  +G  + +V +PF+  K RLQ     ++  + PL  +Y T + QGI   Y+G   
Sbjct: 13  FIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGCPA 72

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA-PPIEL 144
            +VG      V        + L+     P   +L     +I+G+ AG   S +A  P E 
Sbjct: 73  FIVGNTAKAGVRFLGFDTIKNLLRD---PKTGELSGPRGVIAGLGAGLLESVVAVTPFEA 129

Query: 145 AKAKLQVQYDKTTTRY----KGPLDVIKKIYSAQGIRGLYKGLISTLIFR-THFVYWWGS 199
            K  L       T +Y    KG L     +   QG+ GLY+G++   + +  +     G 
Sbjct: 130 IKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGC 189

Query: 200 YELLTRWFRENTKM-SEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVV--LCNDKYDG 253
           Y  +    ++ T    +  ++                Y   P D VK  +  L + +Y  
Sbjct: 190 YNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRYSS 249

Query: 254 SFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVL 300
           +   + T    I++ +G+  F+KG  P   R F         +E VL
Sbjct: 250 TINCFTT----IFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVL 292

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 11/165 (6%)

Query: 26  GFVAGVFSGVAKNAVG-HPFDTIKVRL------QTSQNETRFKGPLDCVYKTFRNQGIRG 78
           G +AG+ +G+ ++ V   PF+ IK  L       T +     KG L       R QG+ G
Sbjct: 108 GVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSG 167

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV-YPNDEKLPLSGCIISGVLAGWSVSF 137
            Y G  P  +      +V LGC +  ++++  Y   P D+ L      + G  +G    +
Sbjct: 168 LYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVY 227

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKG 182
              PI+  K ++Q    K   RY   ++    I+  +G++  +KG
Sbjct: 228 TTMPIDTVKTRMQSLDSK---RYSSTINCFTTIFKEEGLKAFWKG 269

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 68/171 (39%), Gaps = 10/171 (5%)

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
           S   I+G LAG   + +  P E AK +LQ+  DK +   + PL +I      QGI  +Y 
Sbjct: 10  SKSFIAGCLAGAVEASVTYPFEFAKTRLQL-LDKASKASRNPLVLIYNTAKTQGIGSVYV 68

Query: 182 GLISTLIFRT--HFVYWWGSYELLTRWFRE-NTKMSEAAINXXXXXXXXXXXXXXXAYPS 238
           G  + ++  T    V + G ++ +    R+  T                         P 
Sbjct: 69  GCPAFIVGNTAKAGVRFLG-FDTIKNLLRDPKTGELSGPRGVIAGLGAGLLESVVAVTPF 127

Query: 239 DVVKQVVL-----CNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           + +K  ++        KY  + K        + + +G++G ++G +P  +R
Sbjct: 128 EAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMR 178

>Scas_667.4
          Length = 308

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/278 (21%), Positives = 122/278 (43%), Gaps = 31/278 (11%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKTFRNQGIRGF 79
            + GV + VAK A   P + +K+ +Q           ++++KG ++C  +T + +GI  F
Sbjct: 18  LMGGVSAAVAKTAA-SPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAF 76

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP--LSGCIISGVLAGWSVSF 137
           + G T  ++ +    ++        + +   + +  +E      +G + SG  AG     
Sbjct: 77  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYGKWFAGNLASGGAAGGLSLL 133

Query: 138 IAPPIELAKAKLQVQYDKT----TTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF 193
               ++ A+ +L      +    + +YKG +DV K+  +  G+ GLY+G + +++     
Sbjct: 134 FVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVV--GII 191

Query: 194 VY---WWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCND- 249
           VY   ++G Y+ L       + +  + +                +YP D V++ ++    
Sbjct: 192 VYRGLYFGLYDSLKPAVLTGS-LEGSFLASFLLGWIVTTGASTASYPLDTVRRRMMMTSG 250

Query: 250 ---KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
              KYDG+F  +R  V     ++G++  FKG   + LR
Sbjct: 251 QAVKYDGAFDCFRKVV----AAEGVSSLFKGCGANILR 284

>Kwal_27.12481
          Length = 304

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 71/157 (45%), Gaps = 19/157 (12%)

Query: 42  HPFDTIKVRLQTSQ------NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDS 95
           +  D  + RL           E +F G +D   KT  + GI G Y GF P +VG ++   
Sbjct: 133 YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRG 192

Query: 96  VMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP----PIELAKAKLQV 151
           +  G   + + L+            L G  ++  L GW+V+  A     P++  + ++ +
Sbjct: 193 LYFGGYDSLKPLLLTG--------SLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 152 QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
              +   +Y G  D  +KI +A+GI+ L+KG  + ++
Sbjct: 245 TSGQ-AVKYNGAFDAFRKIVAAEGIKSLFKGCGANIL 280

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 119/277 (42%), Gaps = 29/277 (10%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLD--------CVYKTFRNQGIRG 78
            + GV + V+K A   P + +K+ +Q +Q+E   +G LD        C  +T  N+GI  
Sbjct: 15  LMGGVSAAVSKTAA-APIERVKLLIQ-NQDEMIKQGSLDRRYTGIGECFKRTAANEGIAS 72

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP--LSGCIISGVLAGWSVS 136
           F+ G T  ++ +    ++        + +   + +  +E      +G + SG  AG    
Sbjct: 73  FWRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGAAGGLSL 129

Query: 137 FIAPPIELAKAKLQVQYDKTTT----RYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRT 191
                ++ A+ +L             ++ G +DV KK  ++ GI GLY+G + +++    
Sbjct: 130 MFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVV 189

Query: 192 HFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCND-- 249
           +   ++G Y+ L       + +  + +                +YP D V++ ++     
Sbjct: 190 YRGLYFGGYDSLKPLLLTGS-LEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQ 248

Query: 250 --KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
             KY+G+F ++R     I  ++GI   FKG   + LR
Sbjct: 249 AVKYNGAFDAFR----KIVAAEGIKSLFKGCGANILR 281

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 16/189 (8%)

Query: 12  VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP---LDCVY 68
           V +    +  S++  F+AG  +GV      +P DT+K R+Q +      KG    +    
Sbjct: 309 VENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAK 368

Query: 69  KTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYP-------NDEKLPL 121
           + +   G++ FY G T  ++G     ++ LG    + ML   Y+          +E + L
Sbjct: 369 EMYTEGGLKLFYRGVTVGVLGIFPYAALDLG---TFSMLKKWYISSKAKKLNKKEEDVEL 425

Query: 122 SGCII--SGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYSAQGIRG 178
           S  ++   G  +G   + +  PI L + +LQ Q       RY G  DV+ K    +G  G
Sbjct: 426 SNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPG 485

Query: 179 LYKGLISTL 187
           L+KGL+ TL
Sbjct: 486 LFKGLVPTL 494

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 115/300 (38%), Gaps = 43/300 (14%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRL-------QTSQNET-------------RFKGPL-D 65
           F+AG  SGV       PFD +KV L        T  N T             + + PL  
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 66  CVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK-LPLSGC 124
            +   +R  GI+ FY+G     +      S+  G     + LM K     D K L     
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQ-YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
            I+G LAG    F   PI+  K ++Q    +      K  +   K++Y+  G++  Y+G+
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 184 -ISTLIFRTHFVYWWGSYELLTRWF------RENTKMSEAAINXXXXXXXXXXXXXXXA- 235
            +  L    +     G++ +L +W+      + N K  +  ++               A 
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 236 --YPSDVVKQVVLCND------KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
             YP ++++  +          +YDG    +R  +    Q +G  G FKG VP+  +  P
Sbjct: 444 VVYPINLLRTRLQAQGTFAHPYRYDG----FRDVLLKTIQREGYPGLFKGLVPTLAKVCP 499

>Scas_489.4
          Length = 297

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 79/185 (42%), Gaps = 16/185 (8%)

Query: 6   NAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVG-HPFDTIKVRLQTSQNETRFK--- 61
           N + +PV   +S        G VAG+ +G+ ++ V   PF+ IK  L   +   + K   
Sbjct: 94  NMLRDPVTGELSGP-----RGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQN 148

Query: 62  ---GPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV-YPNDE 117
              G L       R+QGI G Y G  P  +      +V LGC +  + ++  Y   P D 
Sbjct: 149 NGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDR 208

Query: 118 KLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIR 177
            L      I G  +G    +   PI+  K ++Q       T+Y   ++   KI+  +G++
Sbjct: 209 PLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQ---SLDATKYTSTVNCFAKIFKEEGLK 265

Query: 178 GLYKG 182
             +KG
Sbjct: 266 TFWKG 270

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 71/164 (43%), Gaps = 9/164 (5%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-TSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
           F+AG  +G  + ++ +PF+  K RLQ   +  T  + PL  +Y T + QG    Y+G   
Sbjct: 14  FIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPA 73

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA-PPIEL 144
            +VG      +        + ++     P   +L     +++G+ AG   S +A  P E 
Sbjct: 74  FIVGNTAKAGIRFLGFDTIKNMLRD---PVTGELSGPRGVVAGLGAGLLESVVAVTPFEA 130

Query: 145 AKAKL----QVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
            K  L    Q    K     +G L     +   QGI GLY+G++
Sbjct: 131 IKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVL 174

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
           F+ G FSGV       P DT+K R+Q S + T++   ++C  K F+ +G++ F+ G TP 
Sbjct: 216 FIVGAFSGVVTVYTTMPIDTVKTRMQ-SLDATKYTSTVNCFAKIFKEEGLKTFWKGATPR 274

Query: 87  LVGWILMDSVMLGCLHN 103
           L   IL   ++     N
Sbjct: 275 LGRLILSGGIVFTIYEN 291

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 115 NDEKLPLS--GCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYS 172
           + EK P+      I+G LAG   + I  P E AK +LQ+  DKT+T  + PL +I     
Sbjct: 2   SQEKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQL-IDKTSTASRNPLVLIYNTAK 60

Query: 173 AQGIRGLYKG 182
            QG   +Y G
Sbjct: 61  TQGTGAIYVG 70

>Scas_662.12
          Length = 308

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 118/290 (40%), Gaps = 37/290 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQ--------------NETRFKGPLDCV 67
            ++G+ +G     + HP D IKVRLQ     T+Q              N ++  G    +
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPI 70

Query: 68  YKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIIS 127
           Y   + +  RG  +      V W L  ++      +Y M  + Y++ N+  + L+    S
Sbjct: 71  YNLIK-ESYRGLPINLLGNAVAWSLYFTIY-NSTKDY-MFQNNYLHNNNTTIFLT----S 123

Query: 128 GVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
           G+++G S + +  P+ + K ++          YK      K + + +G + ++ GL+ +L
Sbjct: 124 GLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSL 183

Query: 188 IFRTHFVYWWGSYELLTRWFRENTKMSE-----AAINXXXXXXXXXXXXXXXAYPSDVVK 242
           +  +    ++  Y+ L   F  N   S+     A +                 YP  ++K
Sbjct: 184 LGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLK 243

Query: 243 QVV-----LCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
             +     + N+     +  + T ++ IY+  GI G +KG   + LR+ P
Sbjct: 244 SNLQTFRSVTNNIPQNDYH-FITLIRKIYRDNGIKGLYKGLSANLLRAIP 292

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 77/185 (41%), Gaps = 21/185 (11%)

Query: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRY-KGPLDVIKKIYS--- 172
           E  P+   IISG+ AG   + I  P++L K +LQ+    TT ++ KG   +I ++ +   
Sbjct: 3   ELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSK 62

Query: 173 ---AQG-----IRGLYKGLISTLI-----FRTHFVYWWGSYELLTRWFRENTKMSEAAIN 219
              +QG     I+  Y+GL   L+     +  +F  +  + + +   F+ N   +     
Sbjct: 63  KMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYM---FQNNYLHNNNTTI 119

Query: 220 XXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD-GSFKSWRTAVKDIYQSKGINGFFKGF 278
                            P  V+K  ++   ++   S+KS R   K +   +G    + G 
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

Query: 279 VPSFL 283
           +PS L
Sbjct: 180 LPSLL 184

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 107/269 (39%), Gaps = 25/269 (9%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVG 89
           G F G+      HP D  KVRLQT+         +    +  RN+G+ G Y G T  ++ 
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPK--PTLVRMASQILRNEGVPGLYSGLTAAILR 72

Query: 90  WILMDSVMLGCLHNYRMLMHKYV---YPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAK 146
                +   G    Y  +  +Y+   Y N     L   + SG + G     I  P ++  
Sbjct: 73  QCTYTTARFGV---YDFVKERYIPKEYLNSMLYLLPCSMFSGAVGG----LIGNPADVVN 125

Query: 147 AKLQVQYD---KTTTRYKGPLDVIKKIYSAQGIRGLYKG----LISTLIFRTHFVYWWGS 199
            ++Q       +    YK   D + KI S +G+  L+ G    L+  ++  +  V    +
Sbjct: 126 IRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVV---T 182

Query: 200 YELLTRWFRENTKMS-EAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSW 258
           Y++   +  +N  +  +                     P+DV+K  V+   K+  S  S 
Sbjct: 183 YDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKH--SHDSA 240

Query: 259 RTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
              + D  + +G +  F+G++PSF+R  P
Sbjct: 241 VRILLDAVKQEGPSFMFRGWLPSFVRLGP 269

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 115/272 (42%), Gaps = 19/272 (6%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKTFRNQGIRGF 79
            + GV + VAK A   P + +K+ +Q           + R+KG +DC  +T R +GI  F
Sbjct: 16  LMGGVSAAVAKTAA-SPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISF 74

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP--LSGCIISGVLAGWSVSF 137
           + G T  ++ +    ++        + +   + +  +E      +G + SG +AG     
Sbjct: 75  WRGNTANVIRYFPTQALNFAFKDQIKAM---FGFKKEEGYAKWFAGNLASGGIAGGLSLM 131

Query: 138 IAPPIELAKAKLQVQYDKTTT----RYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRTH 192
               ++ A+ +L      +      ++ G +DV KK  ++ G+ GLY+G + ++I    +
Sbjct: 132 FVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVY 191

Query: 193 FVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
              ++G Y+         + +  + I                +YP D V++ ++      
Sbjct: 192 RGLYFGLYDSCKPLLLTGS-LEGSFIASFLLGWVVTTGASTASYPLDTVRRRMMMTSGQA 250

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
             +K     ++ I  ++G++  FKG   + LR
Sbjct: 251 VKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

 Score = 34.7 bits (78), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-TSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           S I  F+ G       +   +P DT++ R+  TS    ++KG +DC+ K    +G+   +
Sbjct: 214 SFIASFLLGWVVTTGASTASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLF 273

Query: 81  LG 82
            G
Sbjct: 274 KG 275

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 78/176 (44%), Gaps = 23/176 (13%)

Query: 27  FVAGVFSGVAKNAVG----HPFDTIKVRLQTSQNETR------FKGPLDCVYKTFRNQGI 76
           F   + SG A  A+     +  D  + RL      ++      F G +D   KT ++ G+
Sbjct: 127 FAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGV 186

Query: 77  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVS 136
            G Y GF P +VG ++   +  G        M+  + P      L G  ++  L GW V+
Sbjct: 187 AGLYRGFLPSVVGIVVYRGLYFG--------MYDSLKPLLLTGSLEGSFLASFLLGWVVT 238

Query: 137 FIAP----PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
             A     P++  + ++ +   +   +Y G  D ++KI +A+G+  L+KG  + ++
Sbjct: 239 TGASTCSYPLDTVRRRMMMTSGQ-AVKYDGAFDCLRKIVAAEGVGSLFKGCGANIL 293

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/276 (20%), Positives = 114/276 (41%), Gaps = 27/276 (9%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKTFRNQGIRGF 79
            + GV + VAK A   P + +K+ +Q           + ++ G LDC  +T   +G+  F
Sbjct: 28  LMGGVSAAVAKTAA-SPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISF 86

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP--LSGCIISGVLAGWSVSF 137
           + G T  ++ +    ++        + +   + +  +E      +G + SG  AG     
Sbjct: 87  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGAAGALSLL 143

Query: 138 IAPPIELAKAKLQVQYDKT----TTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRTH 192
               ++ A+ +L      +      ++ G +DV KK   + G+ GLY+G + +++    +
Sbjct: 144 FVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVY 203

Query: 193 FVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCND--- 249
              ++G Y+ L       + +  + +                +YP D V++ ++      
Sbjct: 204 RGLYFGMYDSLKPLLLTGS-LEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQA 262

Query: 250 -KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
            KYDG+F   R     I  ++G+   FKG   + LR
Sbjct: 263 VKYDGAFDCLR----KIVAAEGVGSLFKGCGANILR 294

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 131/348 (37%), Gaps = 65/348 (18%)

Query: 1   MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ-NETR 59
           M+K++N      NSL     Y    G   GV    AK  +  P D IK+  QTS  + ++
Sbjct: 1   MTKTNNRQAVDKNSL----DYVVRSGLAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSK 55

Query: 60  FKGPLDCVYKTFR----NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN 115
           + G L  +Y+  +    N GIRGF+ G +  L+      +V        R ++     P+
Sbjct: 56  YAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSIL----IPS 111

Query: 116 DEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG 175
            E       + SG LAG    FI  P++L + +L    +    + +   D++K IY    
Sbjct: 112 REYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLR---DIVKTIYHEPA 168

Query: 176 IRGL----------------YKGLISTLI---------FRTH---------------FVY 195
             GL                Y+G + T++         F  H                V 
Sbjct: 169 SEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVK 228

Query: 196 WWGSYELLTRW-FRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK---QVVLCNDK- 250
              S E L R   R+ T +   A                 AYP ++++   QV   + + 
Sbjct: 229 QLSSQEELERKKLRQKTPLRTWA--ELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRK 286

Query: 251 -YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
            YD  F+S  +  + IYQ KG  GFF G    +++  P        +E
Sbjct: 287 MYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYE 334

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 113/300 (37%), Gaps = 41/300 (13%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE--TRFKGP--LDCVYKTFRNQGIRGFYLG 82
            +AG  +G+ +    HP DTIKVR+Q  +N   +  K P  +    + +RN+G   FY G
Sbjct: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKG 73

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWS-VSFIAPP 141
               ++G     ++       YR L+         K+      I+GV AG +    +  P
Sbjct: 74  LGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVSTGNTFIAGVGAGITEAVVVVNP 130

Query: 142 IELAKAKLQVQY---DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT------- 191
           +E+ K +LQ Q+    +   +YK  +     I   +G   LY+G+  T   +        
Sbjct: 131 MEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190

Query: 192 -------HFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQV 244
                   F+  + + E+L  W      +   AI                  P D +K  
Sbjct: 191 TVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA------------PLDTIK-T 237

Query: 245 VLCNDKYDGSFKSWRTAV---KDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
            L  DK   +    +      K + Q +G    +KG  P  +R  P        +EF+ +
Sbjct: 238 RLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRK 297

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 70/157 (44%), Gaps = 19/157 (12%)

Query: 42  HPFDTIKVRLQTSQ------NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDS 95
           +  D  + RL           E +F G +D   KT  + GI G Y GF P +VG ++   
Sbjct: 133 YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRG 192

Query: 96  VMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP----PIELAKAKLQV 151
           +  G        M+  + P      L    I+  L GW+V+  A     P++  + ++ +
Sbjct: 193 LYFG--------MYDSLKPLLLTGNLESSFIASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 152 QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
              +   +Y G  D  +KI +A+G++ L+KG  + ++
Sbjct: 245 TSGQ-AVKYDGAFDAFRKIVAAEGVKSLFKGCGANIL 280

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/283 (19%), Positives = 114/283 (40%), Gaps = 21/283 (7%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKT 70
           N+  + ++ F+ G  S         P + +K+ +Q           + R+ G +DC  +T
Sbjct: 4   NKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRT 63

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
             ++G+  F+ G T  ++ +    ++        + +       +      +G + SG  
Sbjct: 64  AASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLASGGA 123

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTT----RYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           AG         ++ A+ +L             ++ G +DV KK  ++ GI GLY+G + +
Sbjct: 124 AGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPS 183

Query: 187 LI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVV 245
           ++    +   ++G Y+ L         +  + I                +YP D V++ +
Sbjct: 184 VVGIVVYRGLYFGMYDSLKPLLLTGN-LESSFIASFLLGWAVTTGASTASYPLDTVRRRM 242

Query: 246 LCND----KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           +       KYDG+F ++R     I  ++G+   FKG   + LR
Sbjct: 243 MMTSGQAVKYDGAFDAFRK----IVAAEGVKSLFKGCGANILR 281

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 74/168 (44%), Gaps = 11/168 (6%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTP 85
           F+AG   G+  ++  H  DT+K R Q + N  ++K  L      F  +G  RG Y G+  
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYGGYCA 116

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELA 145
            ++G     ++        +  M    + ND    L+    +G L  +  SF+  P E+ 
Sbjct: 117 AMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLT----AGFLGDFFSSFVYVPSEVL 172

Query: 146 KAKLQVQ------YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
           K +LQ+Q      +  +   YK   + I  IY  +G+  L+ G  +TL
Sbjct: 173 KTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATL 220

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/196 (18%), Positives = 79/196 (40%), Gaps = 14/196 (7%)

Query: 112 VYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIY 171
           ++ + E  P+  C ++G + G         ++  K + Q        +YK  L   + ++
Sbjct: 44  LFDDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGA--PNVHKYKHMLQAYRTMF 101

Query: 172 SAQGIR-GLYKGLISTLI--FRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXX 228
             +G R GLY G  + ++  F +  +++  +YE   R    +  +++   +         
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFF-STYEFTKRTMINDYHLNDT-FSHLTAGFLGD 159

Query: 229 XXXXXXAYPSDVVKQVVLCNDKYDG-------SFKSWRTAVKDIYQSKGINGFFKGFVPS 281
                   PS+V+K  +     Y+        ++KS R A+  IY+++G+   F G+  +
Sbjct: 160 FFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKAT 219

Query: 282 FLRSFPXXXXXXXXFE 297
             R  P        +E
Sbjct: 220 LARDLPFSALQFAFYE 235

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 92/197 (46%), Gaps = 18/197 (9%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-TSQNETRFKGP--LDCVYKTFRNQGIRGFYLGF 83
            +AG  SG+   ++  P DTIK+RLQ T  N  +  G   ++      +N+GIR F+ G 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
            P  + ++   S           L ++Y+ P   +  L   ++ G  AG + S ++ P +
Sbjct: 80  IPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSYPFD 134

Query: 144 LAKAKLQVQ---YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV-YWWGS 199
           + + +L      +  + TR       ++ I+  +G+ G +KG I+++   T      +G+
Sbjct: 135 VLRTRLVANNQMHSMSITRE------VRDIWKLEGLPGFFKGSIASMTTITLTASIMFGT 188

Query: 200 YELLTRWFRENTKMSEA 216
           YE +  +  EN K + A
Sbjct: 189 YETIRIYCDENEKTTAA 205

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 86/212 (40%), Gaps = 35/212 (16%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYL 81
           +R+   V G F+G+  + V +PFD ++ RL  + N+         V   ++ +G+ GF+ 
Sbjct: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRL-VANNQMHSMSITREVRDIWKLEGLPGFFK 169

Query: 82  GFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDE-----------KLPLSGCIISGVL 130
           G    +    L  S+M G     R+    Y   N++            L  S   I GV+
Sbjct: 170 GSIASMTTITLTASIMFGTYETIRI----YCDENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYK------------GPLDVIKKIYSAQGIRG 178
           A      I  P+E  + ++Q    K   ++             G   +  +I   +G+  
Sbjct: 226 A----KIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSS 281

Query: 179 LYKGLISTL--IFRTHFVYWWGSYELLTRWFR 208
           LY+G++  L     T FV +WG YE    + R
Sbjct: 282 LYRGILVALSKTIPTTFVSFWG-YETAIHYLR 312

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 75/161 (46%), Gaps = 6/161 (3%)

Query: 124 CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP-LDVIKKIYSAQGIRGLYKG 182
            +++G ++G     I  P++  K +LQ+        +    ++V + +   +GIR  +KG
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

Query: 183 LI-STLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVV 241
            I  +L++ T+    + SY L  R+        EA ++               +YP DV+
Sbjct: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGL--EARLHSLVVGAFAGITSSIVSYPFDVL 136

Query: 242 KQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSF 282
           +  ++ N++      S    V+DI++ +G+ GFFKG + S 
Sbjct: 137 RTRLVANNQMHS--MSITREVRDIWKLEGLPGFFKGSIASM 175

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 78/176 (44%), Gaps = 23/176 (13%)

Query: 27  FVAGVFSGVAKNAVG----HPFDTIKVRLQTSQNETR------FKGPLDCVYKTFRNQGI 76
           F   + SG A  A+     +  D  + RL      ++      F G  D   KT ++ GI
Sbjct: 116 FAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 77  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVS 136
            G Y GF P +VG ++   +  G   + + L+            L G  ++  L GW V+
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTG--------SLDGSFLASFLLGWVVT 227

Query: 137 FIAP----PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
             A     P++  + ++ +   +   +Y G +D +KKI +++G+  L+KG  + ++
Sbjct: 228 TGASTCSYPLDTVRRRMMMTSGQ-AVKYNGAIDCLKKIVASEGVGSLFKGCGANIL 282

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 57/286 (19%), Positives = 119/286 (41%), Gaps = 27/286 (9%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKT 70
            ET   I   + GV + +AK A   P + +K+ +Q           + ++ G +DC  +T
Sbjct: 8   QETNFAINFLMGGVSAAIAKTAA-SPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRT 66

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP--LSGCIISG 128
            + +G+  F+ G T  ++ +    ++        +++   + +  +E      +G + SG
Sbjct: 67  AKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLM---FGFKKEEGYGKWFAGNLASG 123

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQYDKT----TTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
             AG         ++ A+ +L      +      ++ G  DV KK   + GI GLY+G +
Sbjct: 124 GAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFM 183

Query: 185 STLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQ 243
            +++    +   ++G ++ L       + +  + +                +YP D V++
Sbjct: 184 PSVVGIVVYRGLYFGMFDSLKPLVLTGS-LDGSFLASFLLGWVVTTGASTCSYPLDTVRR 242

Query: 244 VVLCND----KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRS 285
            ++       KY+G+       +K I  S+G+   FKG   + LRS
Sbjct: 243 RMMMTSGQAVKYNGAID----CLKKIVASEGVGSLFKGCGANILRS 284

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 91/188 (48%), Gaps = 27/188 (14%)

Query: 16  ISNETYSRIMG--------FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCV 67
           + NE+ + IM          +A   SG+A   + +P   IK R+  +     +K   D V
Sbjct: 98  LGNESATGIMDRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGV 157

Query: 68  YKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH--NYRMLMHKYVYPNDEK----LPL 121
           YK ++ +G+  F+ G  P L+G      V  G ++   Y  L   Y++ + +K    L +
Sbjct: 158 YKLYQTEGVLAFWRGVVPSLLG------VSQGAIYFALYDTLKFHYLHSSTDKAERRLSV 211

Query: 122 SGCI-ISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLY 180
           S  I I+ +    SV+ +  P +L K+KLQ  +   +    G   +++ +YS +GIRG Y
Sbjct: 212 SEIIGITCISKMISVTSVY-PFQLLKSKLQ-DFGAPS----GITQLVQTVYSREGIRGFY 265

Query: 181 KGLISTLI 188
           +GL + L+
Sbjct: 266 RGLSANLL 273

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/286 (19%), Positives = 122/286 (42%), Gaps = 27/286 (9%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTS---QNETRFKGPLDCVYKTFRNQGIRGFYLGFT 84
           ++G+ +G       HP D +K+RLQ S   +  T + G +  +++  R Q  R  Y G  
Sbjct: 13  ISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFE--RQQWGRELYRGLG 70

Query: 85  PPLVGWILMDSVMLGCLHNYRMLMHKYVYPN------DEKLPLSGCIISGVLAGWSVSFI 138
             L+G  +  ++  GC    + +  +++         D +LP    +++   +G + + +
Sbjct: 71  VNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAVL 130

Query: 139 APPIELAKAKLQVQYDKTTTR---YKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVY 195
             PI + K ++       T+R   YK   D + K+Y  +G+   ++G++ +L+  +    
Sbjct: 131 TNPIWVIKTRIMA-----TSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQGAI 185

Query: 196 WWGSYELLT-RWFRENTKMSEAAINXXX---XXXXXXXXXXXXAYPSDVVKQVVLCNDKY 251
           ++  Y+ L   +   +T  +E  ++                   YP  ++K  +    + 
Sbjct: 186 YFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKL----QD 241

Query: 252 DGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
            G+       V+ +Y  +GI GF++G   + LR+ P        +E
Sbjct: 242 FGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/309 (20%), Positives = 118/309 (38%), Gaps = 31/309 (10%)

Query: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72
           + L  +E  S     VAG  SG+       P DT+K++LQ + +        + +    +
Sbjct: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKN----ANVLINILK 60

Query: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAG 132
            +GIRGF+ G  P  + +I+      G        +   +  N     L  C++ G LAG
Sbjct: 61  REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISP-QLYSCLV-GSLAG 118

Query: 133 WSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRT 191
            + S  + P ++ + +          + +   D I  I+S +G+ G + G  S++I    
Sbjct: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGL 175

Query: 192 HFVYWWGSYELLTRWFRENTKMSEA----AINXXXXXXXXXXXXXXXAYPSDVVKQVVLC 247
           +    +G YE +  +  E +K+S+      +                 +P D V++ +  
Sbjct: 176 NTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQI 235

Query: 248 NDKYDGSFKSWRTAVKDIY----------------QSKGINGFFKGFVPSFLRSFPXXXX 291
            +  +   +  R   KDIY                Q +G    ++G   S ++S P    
Sbjct: 236 RNSPNEE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAI 294

Query: 292 XXXXFEFVL 300
               +E  +
Sbjct: 295 SLWSYELFM 303

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 70/157 (44%), Gaps = 19/157 (12%)

Query: 42  HPFDTIKVRLQTSQ------NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDS 95
           +  D  + RL           E +F G +D   KT  + G+ G Y GF P +VG ++   
Sbjct: 133 YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRG 192

Query: 96  VMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP----PIELAKAKLQV 151
           +  G   + + L+      N          ++  L GW+V+  A     P++  + ++ +
Sbjct: 193 LYFGLYDSLKPLLLTGSLEN--------SFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 152 QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
              +   +Y G  D  +KI +A+GI+ L+KG  + ++
Sbjct: 245 TSGQ-AVKYDGAFDAFRKIVAAEGIKSLFKGCGANIL 280

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 121/280 (43%), Gaps = 35/280 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQN-------ETRFKGPLDCVYKTFRNQGIRGF 79
            + GV + V+K A   P + +K+ +Q           + R+ G ++C  +T  ++G+  F
Sbjct: 15  LMGGVSAAVSKTAAA-PIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASF 73

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP--LSGCIISGVLAGWSVSF 137
           + G T  ++ +    ++        + +   + +  +E      +G + SG LAG     
Sbjct: 74  WRGNTANVIRYFPTQALNFAFKDKIKAM---FGFKKEEGYAKWFAGNLASGGLAGGLSLL 130

Query: 138 IAPPIELAKAKLQVQYDKTTT----RYKGPLDVIKKIYSAQGIRGLYKG----LISTLIF 189
               ++ A+ +L             ++ G +DV KK  ++ G+ GLY+G    ++  +++
Sbjct: 131 FVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVY 190

Query: 190 RTHFVYWWGSYE-LLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCN 248
           R  +   + S + LL     EN+ ++   +                +YP D V++ ++  
Sbjct: 191 RGLYFGLYDSLKPLLLTGSLENSFLASFLLG-----WAVTTGASTASYPLDTVRRRMMMT 245

Query: 249 D----KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
                KYDG+F ++R     I  ++GI   FKG   + LR
Sbjct: 246 SGQAVKYDGAFDAFRK----IVAAEGIKSLFKGCGANILR 281

>Scas_379.2
          Length = 301

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 83/175 (47%), Gaps = 24/175 (13%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           +T+  +   ++G  + +A +A+ +PFDT+K R+Q + N T +    +   + ++N+G   
Sbjct: 114 QTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTTVW----NVTKQIYKNEGFSA 169

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
           FY  +   L   I   +       +      K+  P ++  PL  C +SG L+G + + I
Sbjct: 170 FYYSYPTTLAMNIPFAAFNFMIYESAT----KFFNPTNDYNPLVHC-LSGGLSGATCAAI 224

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKK----------IYSAQGIRGLYKGL 183
             P++  K  LQV+  ++ +     L V+K+          IY   G +G ++GL
Sbjct: 225 TTPLDCIKTVLQVRGSESVS-----LQVMKEANTFQKATKAIYQVHGAKGFWRGL 274

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 110/287 (38%), Gaps = 36/287 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG F+G+ +++V  P D +K R+Q++  ++     L  + K    +G           
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKST-SNMLSQMAKISTAEG----------S 75

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPN----DEK-----LPLSGCIISGVLAGWSVSF 137
           L  W  + SV+LG    + +    Y Y      DEK      PL    +SG +A  +   
Sbjct: 76  LALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTA-LSGTVATIAADA 134

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW- 196
           +  P +  K ++Q+  + T        +V K+IY  +G    Y    +TL     F  + 
Sbjct: 135 LMNPFDTLKQRMQLNTNTTV------WNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFN 188

Query: 197 WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK 256
           +  YE  T++F      +   +                  P D +K V+        S +
Sbjct: 189 FMIYESATKFFNPTNDYNP--LVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQ 246

Query: 257 ------SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
                 +++ A K IYQ  G  GF++G  P    + P        +E
Sbjct: 247 VMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 12/174 (6%)

Query: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGI 176
           +  PLS  +++G  AG     +  PI+  K ++Q    K+T+     L  + KI +A+G 
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNM---LSQMAKISTAEGS 75

Query: 177 RGLYKGLISTLIFR--THFVYWWGSYELLTRWFRENTKM-SEAAINXXXXXXXXXXXXXX 233
             L+KG+ S ++     H VY + +YE   ++  +   M +   +               
Sbjct: 76  LALWKGVQSVILGAGPAHAVY-FATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADA 134

Query: 234 XAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
              P D +KQ +  N     +   W    K IY+++G + F+  +  +   + P
Sbjct: 135 LMNPFDTLKQRMQLNT----NTTVWNV-TKQIYKNEGFSAFYYSYPTTLAMNIP 183

>Scas_578.3*
          Length = 524

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 81/181 (44%), Gaps = 18/181 (9%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP---LDCVYKTFRNQGIRG 78
           S++  +VAG  +GV      +P DT+K R+Q +  E   KG    +    + ++  GIR 
Sbjct: 325 SKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRV 384

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL--PLSGCIIS-------GV 129
           FY G     +G     ++ LG    +  L   Y+    +KL  P    ++S       G 
Sbjct: 385 FYRGVLLGALGIFPYAALDLGT---FSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGA 441

Query: 130 LAGWSVSFIAPPIELAKAKLQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
            +G   +    PI L + +LQ Q  Y    T Y G  DV  +    +G+ G YKGL+ TL
Sbjct: 442 FSGTVGATAVYPINLLRTRLQAQGTYAHPYT-YTGFRDVFMQTLKREGVPGFYKGLVPTL 500

Query: 188 I 188
           +
Sbjct: 501 V 501

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 111/297 (37%), Gaps = 39/297 (13%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKV-------------------RLQTSQNETRFKGPL-DC 66
           F+AG  SGV       P D IKV                   R+Q   N  + + P+   
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQ-GLNLAKIRSPIIKA 270

Query: 67  VYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV---YPNDEKLPLSG 123
           +   +R  G+R FY+G    +       S+  G     + LM         ND  L    
Sbjct: 271 IRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVND--LSKLQ 328

Query: 124 CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPL-DVIKKIYSAQGIRGLYKG 182
             ++G +AG        PI+  K ++Q    +   +    L    K++Y   GIR  Y+G
Sbjct: 329 TYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYRG 388

Query: 183 -LISTLIFRTHFVYWWGSYELLTRWF--RENTKMSEAAINXXXXXXXXX-------XXXX 232
            L+  L    +     G++  L +W+  R++ K++    +                    
Sbjct: 389 VLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGA 448

Query: 233 XXAYPSDVVKQVVLCNDKYDG--SFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
              YP ++++  +     Y    ++  +R       + +G+ GF+KG VP+ ++  P
Sbjct: 449 TAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVCP 505

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 30  GVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
           G FSG       +P + ++ RLQ   T  +   + G  D   +T + +G+ GFY G  P 
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 87  LVGWILMDSVMLGCLHNYRMLM 108
           LV      S+   C   ++  M
Sbjct: 500 LVKVCPAVSIGYLCYEKFKAAM 521

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 117/284 (41%), Gaps = 47/284 (16%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP--LDCVYKTFRNQGIRGFYLGF 83
           G  AG+F+ +      HP D  KVRLQ +        P  +  +    +N+GI G Y G 
Sbjct: 13  GGAAGIFAVMNT----HPLDLTKVRLQAAP----IPKPTIVQMLRSILKNEGIVGLYAGL 64

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP----LSGCIISGVLAGWSVSFIA 139
           +  L+      +   G     +    ++V P D+       L   ++SG L G + +F  
Sbjct: 65  SASLLRQCTYTTARFGMYDALK----EHVIPRDKLTNMWYLLGASMVSGALGGLAGNFA- 119

Query: 140 PPIELAKAKLQ----VQYDKTTTRYKGPLDVIKKIYSAQGIRGLY-----KGLISTLIFR 190
              +L   ++Q    +  DK    YK  +D + KIY A+G + L+       ++  ++  
Sbjct: 120 ---DLINIRMQNDSALPLDKRRN-YKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMT 175

Query: 191 THFVYWWGSYE--LLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCN 248
              V  +  ++  L+T++  +  K S                      P+DV+K +V+  
Sbjct: 176 ASQVVTYDMFKNFLVTKYNMDPKKNS----THLTSSLLAGFVATTVCSPADVIKTIVMNA 231

Query: 249 DK-----YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
            K     +D SFK    A+      +G +  F+G+VPSF R  P
Sbjct: 232 HKKPGHNHDSSFKILMEAI----NKEGPSFMFRGWVPSFTRLAP 271

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 81/187 (43%), Gaps = 30/187 (16%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ--TSQNETRFKGPLDCVYKTFRNQGIR------- 77
            ++G  +G+    V +P D ++VRL   T +++ + +  + C+Y    ++ +R       
Sbjct: 122 LLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQW 181

Query: 78  -----GFYLGFTPPLVGWI------------LMDSVMLGCLHNYRMLMHKYVYPNDEKLP 120
                 FY G+TP ++G I              D      L  Y +L        D  +P
Sbjct: 182 FAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVP 241

Query: 121 LS--GCIISGVLAGWSVSFIAPPIELAKAKLQVQY--DKTTTRYKGPLDVIKKIYSAQGI 176
           L     +++G LAG +    A P E+ + +LQV    D T   + G  ++ K IY+  G 
Sbjct: 242 LKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGW 301

Query: 177 RGLYKGL 183
           RG + GL
Sbjct: 302 RGFFVGL 308

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 65/160 (40%), Gaps = 10/160 (6%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE-TRFKGPLDCVYKTFR----NQGIRGFY 80
           G   G+    AK  V  P D IK+  QTS  +  +F G +  + +  +    + G RGF+
Sbjct: 23  GLAGGIAGSCAKTLVA-PLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G +  L+      ++        R +    V P          ++SG LAG    F+  
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSV----VIPTWRHESHWRRLLSGSLAGLCSVFVTY 137

Query: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLY 180
           P++L + +L    ++   + +  +  I     ++ +R  Y
Sbjct: 138 PLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWY 177

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQ--NETR--FKGPLDCVYKTFRNQGIRGFYLG 82
            VAG  +G+A     +PF+ I+ RLQ S   + TR  F G  +     +   G RGF++G
Sbjct: 248 LVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVG 307

Query: 83  FTPPLVGWILMDSVMLGC 100
            +   +G+I + + M+ C
Sbjct: 308 LS---IGYIKV-TPMVAC 321

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 76/165 (46%), Gaps = 11/165 (6%)

Query: 26  GFVAGVFSGVAKNAVG-HPFDTIKVRLQTSQNETR--FKGPLDCVYKTF----RNQGIRG 78
           G +AG+ +G+ ++ V   PF+ IK  L   +   R  ++     + + +    +++G RG
Sbjct: 109 GVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRG 168

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV-YPNDEKLPLSGCIISGVLAGWSVSF 137
            Y G  P  +      +V LGC +  ++L+  Y   P D+ L      I G  +G    +
Sbjct: 169 LYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVY 228

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKG 182
              PI+  K ++Q     T ++Y   L+    IY  +G++  +KG
Sbjct: 229 ATMPIDTVKTRMQ---SLTASKYSSTLNCFTTIYKEEGLKTFWKG 270

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 110/274 (40%), Gaps = 26/274 (9%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLGFTP 85
           FVAG  +G  + ++ +PF+  K RLQ     ++  + PL  +Y T + QG+   Y+G   
Sbjct: 14  FVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYVGCPA 73

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL-PLSG--CIISGVLAGWSVSFIA-PP 141
            +VG     +         R L+       D+K   LSG   +++G+ AG   S +A  P
Sbjct: 74  FIVGNTAKAATRFLGYDTIRNLLK------DKKTGELSGPRGVLAGLGAGLLESVVAVTP 127

Query: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSA----QGIRGLYKGLISTLIFR-THFVYW 196
            E  K  L         +Y+     + + Y +    +G RGLY G++   + +  +    
Sbjct: 128 FEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVR 187

Query: 197 WGSYELLTRWFRENTKM-SEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVV--LCNDK 250
            G Y  +    ++ T    +  +                 Y   P D VK  +  L   K
Sbjct: 188 LGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTASK 247

Query: 251 YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           Y  +   + T    IY+ +G+  F+KG  P   R
Sbjct: 248 YSSTLNCFTT----IYKEEGLKTFWKGATPRLGR 277

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 115 NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ 174
           + +K+  +   ++G LAG   + I  P E AK +LQ+  DK++   + PL +I      Q
Sbjct: 4   DSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQL-IDKSSKASRNPLVLIYNTAKTQ 62

Query: 175 GIRGLYKG 182
           G+  +Y G
Sbjct: 63  GVGAIYVG 70

>Scas_328.1
          Length = 227

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 19/167 (11%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
           +  +F  + KN +G    +IK     S    +F G LD   KT    G+ G Y GF P +
Sbjct: 52  IVCLFLRLCKNEIGSDAKSIK-----SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSV 106

Query: 88  VGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP----PIE 143
           VG ++   +  G   + + ++    + N          +   L GW+V+  A     P++
Sbjct: 107 VGIMVYRGLYFGLYDSLKPVLLTGSFEN--------AFLPSFLLGWAVTISASTTSYPLD 158

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR 190
             + ++ +   +   +YKG +D  ++I S +G+  L+KG  +  IFR
Sbjct: 159 TVRRRMMMTSGQ-AVKYKGAIDCFQQIVSQEGVYSLFKGCGAN-IFR 203

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 50/127 (39%), Gaps = 2/127 (1%)

Query: 159 RYKGPLDVIKKIYSAQGIRGLYKGLISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAA 217
           ++ G LDV KK     G+ GLY+G + +++    +   ++G Y+ L       +    A 
Sbjct: 78  KFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGS-FENAF 136

Query: 218 INXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKG 277
           +                +YP D V++ ++        +K      + I   +G+   FKG
Sbjct: 137 LPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKG 196

Query: 278 FVPSFLR 284
              +  R
Sbjct: 197 CGANIFR 203

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 82/181 (45%), Gaps = 20/181 (11%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP---LDCVYKTFRNQGIRG 78
           S+   ++AG   GV      +P DT+K R+Q +  +T  KG    +    + +R+ G++ 
Sbjct: 314 SKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKL 373

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL---PLSGCIIS-------G 128
           FY G T  ++G     ++ LG        + K+      K+   P+    IS       G
Sbjct: 374 FYRGVTVGVMGIFPYAALDLGTFS----ALKKWYIARQAKMTGVPVDQVTISNFIVLPMG 429

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQ--YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
             +G   + +  PI L + +LQ Q  Y    T Y G  DV+ K    +G +GL+KGL+  
Sbjct: 430 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHT-YTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 187 L 187
           L
Sbjct: 489 L 489

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 112/308 (36%), Gaps = 39/308 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKV----------RLQTSQNETRFKGP-----------LD 65
           F+AG  SGV       PFD IKV           L  S+++   K P           + 
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 66  CVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLM-HKYVYPNDEKLPLSGC 124
                +R  GIR FY+G    ++      ++  G     + LM H     +  +L     
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP---LDVIKKIYSAQGIRGLYK 181
            I+G + G    F   PI+    K +VQ     T  KG    +   +++Y   G++  Y+
Sbjct: 319 YIAGGMGGVVAQFSVYPID--TLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYR 376

Query: 182 GL-ISTLIFRTHFVYWWGSYELLTRWF-RENTKMSEAAINXXXXX--------XXXXXXX 231
           G+ +  +    +     G++  L +W+     KM+   ++                    
Sbjct: 377 GVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVG 436

Query: 232 XXXAYPSDVVKQVVLCNDKYD--GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXX 289
               YP ++++  +     Y    ++  +R  +    Q +G  G FKG VP+  +  P  
Sbjct: 437 ATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAV 496

Query: 290 XXXXXXFE 297
                 +E
Sbjct: 497 SISYLCYE 504

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 3/96 (3%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFR 72
           +   T S  +    G FSG     V +P + ++ RLQ   T  +   + G  D ++KT +
Sbjct: 415 VDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQ 474

Query: 73  NQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLM 108
            +G +G + G  P L       S+   C  N++ LM
Sbjct: 475 REGYQGLFKGLVPNLAKVCPAVSISYLCYENFKRLM 510

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 79/184 (42%), Gaps = 14/184 (7%)

Query: 10  EPVNSLISNETYSRIMGF---VAGVFSGVAKNAVG-HPFDTIKVRLQTSQN------ETR 59
           + + +L+ ++    + GF   VAG+ +G+ ++ V   PF+ IK  L   +       +  
Sbjct: 170 DTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNN 229

Query: 60  FKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV-YPNDEK 118
            KG +    K   +QG  G Y G  P  +      +V LGC +  + L+  Y   P D+ 
Sbjct: 230 GKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKP 289

Query: 119 LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRG 178
           L      I G  +G    +   PI+  K ++Q        +Y   ++    I+  +G++ 
Sbjct: 290 LSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQ---SLNAGQYSSTINCFATIFKEEGLKT 346

Query: 179 LYKG 182
            +KG
Sbjct: 347 FWKG 350

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 76/167 (45%), Gaps = 15/167 (8%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLGFTP 85
           F+AG  +G  + ++ +PF+  K RLQ     ++  + PL  +Y T +N GI   Y+G   
Sbjct: 94  FLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPA 153

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL-PLSG--CIISGVLAGWSVSFIA-PP 141
            +VG      +        + L+       D+K   LSG   +++G+ AG   S +A  P
Sbjct: 154 FIVGNTAKAGIRFLGFDTIKNLLR------DKKTGELSGFRGVVAGLGAGLLESVVAVTP 207

Query: 142 IELAKAKL----QVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
            E  K  L    Q    K     KG +    K+ S QG  GLY+G++
Sbjct: 208 FEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVL 254

>Kwal_23.3042
          Length = 542

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 79/177 (44%), Gaps = 12/177 (6%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGP---LDCVYKTFRNQGIRG 78
           SR   ++AG   GV      +P DT+K R+Q +   T  KG    +      ++  G+R 
Sbjct: 343 SRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRI 402

Query: 79  FYLGFTPPLVG---WILMDSVMLGCLHNYRMLMHKYV--YPNDEKLPLSG--CIISGVLA 131
           FY G T  ++G   +  MD      L  + +     +   P D+ + +S    ++ G  +
Sbjct: 403 FYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQ-VTMSNMFVLLMGAFS 461

Query: 132 GWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
           G   +    P+ L + +LQ Q       RY G  DV+ K    +G +GL+KGL+  L
Sbjct: 462 GTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNL 518

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/310 (20%), Positives = 112/310 (36%), Gaps = 35/310 (11%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRL--------------------QTSQNETRFKGPLDC 66
           F+AG  SGV       PFD IKV L                      + + ++ K PL  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 67  VYKT-FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK-LPLSGC 124
              T +R  GIR FY+G     +      ++  G     + LM +     D   L     
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPL-DVIKKIYSAQGIRGLYKGL 183
            ++G L G        PI+  K ++Q     T ++ +  L    K +Y   G+R  Y+G+
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGI 407

Query: 184 -ISTLIFRTHFVYWWGSYELLTRWF--REN--TKMSEAAINXXXXXXXXX-----XXXXX 233
            +  +    +     G++  L +W+  R+   T + E  +                    
Sbjct: 408 TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGAT 467

Query: 234 XAYPSDVVKQVVLCNDKYD--GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXX 291
             YP ++++  +     +     +  +R  +    Q +G  G FKG VP+  +  P    
Sbjct: 468 AVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSI 527

Query: 292 XXXXFEFVLR 301
               +E + R
Sbjct: 528 SYLCYENLKR 537

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 20  TYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFRNQGI 76
           T S +   + G FSG       +P + ++ RLQ   T  +  R+ G  D + KT + +G 
Sbjct: 448 TMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGY 507

Query: 77  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLM 108
           +G + G  P L       S+   C  N +  M
Sbjct: 508 QGLFKGLVPNLAKVCPAVSISYLCYENLKRGM 539

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/304 (20%), Positives = 126/304 (41%), Gaps = 37/304 (12%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLG- 82
           + F+AG  +G     V  PF+ +K+ LQ   + T + +G    + + +  +G +G + G 
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83

Query: 83  -------FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
                  F    V +++ ++         + L H       E+L  +  + SG L G   
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACK-------KKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136

Query: 136 SFIAPPIELAKAKLQVQY----------DKTTTRYKGPLDVIKKIYSAQ-GIRGLYKGLI 184
                P++L K +L +Q            K+ ++  G   ++ + Y  + G+RGLY+G+ 
Sbjct: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVW 196

Query: 185 STLIFRTHFVYW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXA----YPSD 239
            T +    +V   +  YE L R F  N+  ++ +                 A    YP D
Sbjct: 197 PTSLGVVPYVALNFAVYEQL-REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFD 255

Query: 240 VVKQ----VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXX 295
           ++++    + +  ++    + S   A+  I +++G++G++KG   +  +  P        
Sbjct: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLV 315

Query: 296 FEFV 299
           +E V
Sbjct: 316 YEVV 319

>Scas_716.29
          Length = 316

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/296 (21%), Positives = 114/296 (38%), Gaps = 28/296 (9%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF--KGPLDCVYKTFRNQ-GIRGFYLGF 83
            VAG  SG+    V  P DT+K+RLQ   + T     G L  +     N+ G+R F+ G 
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGN 85

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
            P  + ++L           Y  L  +    N +   L    + G LAG + SF++ P +
Sbjct: 86  VPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSL----VVGALAGMTSSFVSYPTD 141

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT-HFVYWWGSYEL 202
           + + +     D   +         K+I++ +GI G ++G  +++   T      +G+YE 
Sbjct: 142 VLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYES 198

Query: 203 LTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTA 261
           +  +  E +K S+                     YP D +++ +   +            
Sbjct: 199 IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKI 258

Query: 262 VKDIYQS----------------KGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           V +IYQS                +G+   ++G   S  ++ P        +E V+R
Sbjct: 259 VTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMR 314

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 5/168 (2%)

Query: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIK-KIYSAQG 175
           E + +S  +++G ++G     +  P++  K +LQ++   T     G L ++K  I +  G
Sbjct: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGG 77

Query: 176 IRGLYKGLI-STLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXX 234
           +R  +KG +  T+++  +    + SY      F E + M+   +                
Sbjct: 78  LRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMN-GQLQSLVVGALAGMTSSFV 136

Query: 235 AYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSF 282
           +YP+DV++   + N   D +  S     K+I+  +GI GFF+G   S 
Sbjct: 137 SYPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182

>Kwal_23.3529
          Length = 395

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 107/269 (39%), Gaps = 29/269 (10%)

Query: 38  NAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPPLVGWILMDSV 96
           ++V H  DT+K R Q + N  +++  +    K F  +GI RG Y G+T  ++G     ++
Sbjct: 100 DSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 97  MLGCLHNYRMLMHKYV--YPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQ-- 152
             G    Y +   K +  +  +E L      +SG L     S +  P E+ K +LQ+Q  
Sbjct: 160 FFGT---YELTKRKLIDDWGVNETLSHLTAGLSGDLVS---SVVYVPSEVLKTRLQLQGC 213

Query: 153 ----YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VYWWGSYELLTRW- 206
               +  +   Y+   D I  I   +G + L+ G  +TL     F  + +  YE   +W 
Sbjct: 214 YNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWA 273

Query: 207 FRENTKMSE---AAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWR---- 259
           F    K      + +N                 P DV+K  +        +  S R    
Sbjct: 274 FTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRI 333

Query: 260 -----TAVKDIYQSKGINGFFKGFVPSFL 283
                  +  +Y+S+G  GFF G  P F+
Sbjct: 334 ENSLIKGLTAVYRSEGTLGFFSGVGPRFI 362

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 10/83 (12%)

Query: 43  PFDTIKVRLQT------SQNETRFKGPLDCVYK----TFRNQGIRGFYLGFTPPLVGWIL 92
           P D IK R+QT      + + TR     + + K     +R++G  GF+ G  P  +   +
Sbjct: 307 PMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSI 366

Query: 93  MDSVMLGCLHNYRMLMHKYVYPN 115
             S+ML         + ++  PN
Sbjct: 367 QSSIMLLLYQVTLKSLDRFASPN 389

>Kwal_55.21338
          Length = 323

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 71/167 (42%), Gaps = 9/167 (5%)

Query: 42  HPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCL 101
           +P   +  +LQT   +       D +   +R  G  GF+ G    L G  L + V   C 
Sbjct: 41  YPLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCY 100

Query: 102 H-NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRY 160
             + R ++      + ++L  +  ++ G +AG   +  A P+ +A  ++ VQ        
Sbjct: 101 EASSRCVLRAR---HTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD----- 152

Query: 161 KGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWF 207
           +G L  I  I   +GI GL+KGL   LI   + +  +  YE L  W 
Sbjct: 153 RGTLSTIFDIVKDEGISGLFKGLNPALILVINPIIQYTVYEQLKNWI 199

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 122/298 (40%), Gaps = 36/298 (12%)

Query: 2   SKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF- 60
           SK++ +  +P++S            F+AG  +G A+  + +PF+  K RLQ     ++  
Sbjct: 3   SKATKSDVDPLHS------------FLAGSLAGAAEACITYPFEFAKTRLQLIDKASKAS 50

Query: 61  KGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLP 120
           + PL  +YKT + QGI   Y+G    ++G      +        + ++      + E   
Sbjct: 51  RNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLR-----DSETGE 105

Query: 121 LSGC--IISGVLAGWSVSFIA-PPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSA---- 173
           LSG   +I+G+ AG   S  A  P E  K  L       T +Y      + + YS+    
Sbjct: 106 LSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRD 165

Query: 174 QGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRENTKM-SEAAINXXXXXXXXXXXX 231
           +G  GLY+G++   + +  +     G Y  +    ++ T    +  ++            
Sbjct: 166 KGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSG 225

Query: 232 XXXAY---PSDVVKQVV--LCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
               Y   P D VK  +  L + KY  +   + T    I++ +G+  F+KG  P   R
Sbjct: 226 IVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFAT----IFKEEGLKTFWKGATPRLGR 279

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 108/283 (38%), Gaps = 24/283 (8%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETR--FKGPLDCVYKTFRNQGIRG------F 79
           ++G+ +G     V HP D +KVRLQ S    +    GP   + +  R+    G       
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYP----------NDEKLPLSGCIISGV 129
           Y G +  L G  +   V  G     + L++K V            ND K+     + +G 
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 130 LAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIF 189
            +G   + +  PI + K ++          Y    + ++++    G +GL+KGL+  L  
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFG 193

Query: 190 RTHFVYWWGSYELLT----RWFREN-TKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQV 244
            +    ++  Y+ L     R  REN   +    +                 YP  ++K  
Sbjct: 194 VSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSN 253

Query: 245 VLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           +      +  F+ +   +K I  + G  G +KG   + +R+ P
Sbjct: 254 LQSFRANEQKFRLF-PLIKLIIANDGFVGLYKGLSANLVRAIP 295

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 73/190 (38%), Gaps = 33/190 (17%)

Query: 120 PLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRG- 178
           PL   +ISG+ AG   + +  P++L K +LQ+        + GP  VIK+I  +    G 
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGR 67

Query: 179 -----LYKGLISTLIFRTHFVYWWGSY--------ELLTRWFRENTKMSEAAINXXXXXX 225
                LY+GL S  +F       WG Y        EL+   ++   K  E  +       
Sbjct: 68  SVTNELYRGL-SINLFGNAIA--WGVYFGLYGVTKELI---YKSVAKPGETQLKGVGNDH 121

Query: 226 XXXXXXXXXAYPSDVVKQVVLCNDKY-------------DGSFKSWRTAVKDIYQSKGIN 272
                    A  S  +   +L N  +              G++ S    V+ + ++ G  
Sbjct: 122 KMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQ 181

Query: 273 GFFKGFVPSF 282
           G +KG VP+ 
Sbjct: 182 GLWKGLVPAL 191

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 22/172 (12%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           I GFV G+ S +    V  PFD +K RLQ +++ T     L    K  R+   +  + G 
Sbjct: 12  IGGFVGGLTSAI----VLQPFDLLKTRLQQNKDTT-----LWGTLKEIRSP--KQLWRGA 60

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHK----YVYPNDEKLP---LSGCIISGVLAGWSVS 136
            P  +   +  ++ L  L+ +R  M K     + P    LP   +   + SG      V 
Sbjct: 61  LPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVG 120

Query: 137 FIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           FI  PI + K    V+Y+ T   YK   +  + IYS +GIRG + G  +T++
Sbjct: 121 FITMPITIIK----VRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVM 168

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 254 SFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           S+KS   A + IY ++GI GFF G   + +R  P
Sbjct: 139 SYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAP 172

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 62/303 (20%), Positives = 122/303 (40%), Gaps = 37/303 (12%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLG- 82
           + F+AG  +G     V  PF+ +K+ LQ   + T + KG  D + + ++ + I+G + G 
Sbjct: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGN 84

Query: 83  -------FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
                  F    V +++ +    GC    + + H       E+L     + SG L G   
Sbjct: 85  GLNCIRVFPYSAVQFVVFE----GC---KKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS 137

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYK----------GPLDVIKKIYSAQ-GIRGLYKGLI 184
                P++L + +L VQ    +   K          G   ++ K Y+ + GI GLY+G+ 
Sbjct: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197

Query: 185 STLIFRTHFVYW-WGSYELLTRWF----RENTKMSEAAINXXXXXXXXXXXXXXXAYPSD 239
            T +    +V   +  YE L  +       N+ M + ++                 YP D
Sbjct: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRD-SLYKLSMGAISGGVAQTITYPFD 256

Query: 240 VVKQ----VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXX 295
           ++++    + +  ++    + S   A+  I +++G  G++KG   +  +  P        
Sbjct: 257 LLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLV 316

Query: 296 FEF 298
           +E 
Sbjct: 317 YEL 319

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/280 (20%), Positives = 107/280 (38%), Gaps = 21/280 (7%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG F+G+ +++V  P D IK R+Q+S +    +G +  + K    +G    + G    
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPND--EKLPLSGCIISGVLAGWSVSFIAPPIEL 144
           ++G     +V       Y     K + P D     P+    ISG+ A      +  P ++
Sbjct: 80  ILGAGPAHAVYFA---TYEFSKSKLIDPQDMHTHQPIKTA-ISGMAATTVADALMNPFDV 135

Query: 145 AKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW-WGSYELL 203
            K ++Q+   ++         V K IY  +G    Y    +TL+    F  + +  YE  
Sbjct: 136 IKQRMQLNTRESV------WHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESA 189

Query: 204 TRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVV------LCNDKYDGSFKS 257
           T++   + + +                      P D +K V+        +++      +
Sbjct: 190 TKFMNPSNEYNP--FIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANT 247

Query: 258 WRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
           ++ A   IY+  G  GF +G  P  + + P        +E
Sbjct: 248 FQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 83/194 (42%), Gaps = 25/194 (12%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
            T+  I   ++G+ +    +A+ +PFD IK R+Q +  E+ +          +  +G   
Sbjct: 108 HTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRESVWH----VTKNIYHKEGFAA 163

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
           FY  +   LV  I   +       +      K++ P++E  P   C ISG L+G + + I
Sbjct: 164 FYYSYPTTLVMNIPFAAFNFAIYESAT----KFMNPSNEYNPFIHC-ISGGLSGATCAAI 218

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKK----------IYSAQGIRGLYKGLISTLI 188
             P++  K  LQV+  +T +      +++K+          IY   G +G  +GL   +I
Sbjct: 219 TTPLDCIKTVLQVRGSETVSN-----EIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVI 273

Query: 189 FRT-HFVYWWGSYE 201
                    W SYE
Sbjct: 274 ANMPATAISWTSYE 287

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 107/279 (38%), Gaps = 28/279 (10%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQT---------SQNETRFKGPLDCVYKTFRNQGI 76
            F   V S +A   V +P D  K  +QT         S+ E ++K  +DC+ K F+ +G 
Sbjct: 7   AFTGAVASSLAATTV-YPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 77  RGFYLGFTPPLVGWILMDSVML----GCLHNYRMLMHKYVYPNDE----KLPLSGCIISG 128
            G Y G    +    + + +          NY +     +   D+    +L     +  G
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALG 125

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIY--SAQGIRGLYKGLIST 186
           + AG     +  PI +   + Q+  D      K    VIK+IY  S   +   +KG    
Sbjct: 126 MSAGAMTQVVTNPISVISTRQQLTKDGEDASLKA---VIKQIYEESNGDLTAFWKGFKVA 182

Query: 187 LIFRTHFVYWWGSYELLTRWFRENTKMS-EAAINXXXXXXXXXXXXXXXAYPSDVVKQ-V 244
           L+  T+    +GSY+ L         +S    I+                  S  V Q +
Sbjct: 183 LVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQPL 242

Query: 245 VLCNDKYDG---SFKSWRTAVKDIYQSKGINGFFKGFVP 280
           ++      G    FK+++  ++ IYQ++G    +KG +P
Sbjct: 243 IVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIP 281

>Kwal_26.7967
          Length = 297

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 112/271 (41%), Gaps = 20/271 (7%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-TSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
           F+AG  +G  + ++ +PF+  K RLQ   ++ T  + PL  +Y+T + QG+   Y+G   
Sbjct: 13  FLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCPA 72

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA-PPIEL 144
            +VG      V        + ++     P   +L     I++G+ AG   S +A  P E 
Sbjct: 73  FIVGNTAKAGVRFLGFDAIKNILRD---PTTGELSGPRGIVAGLGAGLLESVVAVTPFEA 129

Query: 145 AKAKLQVQYDKTTTRY----KGPLDVIKKIYSAQGIRGLYKGLISTLIFR-THFVYWWGS 199
            K  L       + +Y    +G L     +   +G  GLY+G++   + +  +     G 
Sbjct: 130 IKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGC 189

Query: 200 YELLTRWFRENTKMS-EAAINXXXXXXXXXXXXXXXAY---PSDVVKQVV--LCNDKYDG 253
           Y  +    ++ T  + +  ++                Y   P D VK  +  L + KY  
Sbjct: 190 YNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSSKYSS 249

Query: 254 SFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           +   + T    +++ +G+  F+KG  P   R
Sbjct: 250 TINCFAT----VFREEGLKTFWKGATPRLGR 276

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFT 84
           M FV G FSG+       P DT+K R+Q S + +++   ++C    FR +G++ F+ G T
Sbjct: 213 MTFVVGAFSGIVTVYTTMPIDTVKTRMQ-SLDSSKYSSTINCFATVFREEGLKTFWKGAT 271

Query: 85  PPLVGWILMDSVM 97
           P L   IL   ++
Sbjct: 272 PRLGRLILSGGIV 284

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 13/166 (7%)

Query: 26  GFVAGVFSGVAKNAVG-HPFDTIKVRLQTSQNETRFK------GPLDCVYKTFRNQGIRG 78
           G VAG+ +G+ ++ V   PF+ IK  L   +     K      G L        ++G  G
Sbjct: 108 GIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSG 167

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCI--ISGVLAGWSVS 136
            Y G  P  +      +V LGC +  + ++  Y     +K PLS  +  + G  +G    
Sbjct: 168 LYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDK-PLSSGMTFVVGAFSGIVTV 226

Query: 137 FIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKG 182
           +   PI+  K ++Q      +++Y   ++    ++  +G++  +KG
Sbjct: 227 YTTMPIDTVKTRMQ---SLDSSKYSSTINCFATVFREEGLKTFWKG 269

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 101/252 (40%), Gaps = 24/252 (9%)

Query: 39  AVGHPFDTIKVRLQTSQNE----TRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMD 94
           A+  P  T+  R+Q S+ +    TR K  L+ V + +R +G+ GFY G    + G   M 
Sbjct: 32  ALTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYG---MA 88

Query: 95  SVMLGCLHNYRMLMHKYV-YPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQY 153
           +  L   + Y +     +      +L  S  I+S  +AG   +  + PI +   ++ V  
Sbjct: 89  ANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAK 148

Query: 154 DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLT----RWFRE 209
            + +T     L V+  I    G+  L+ GL   L+  ++ +  +  +E L     +W   
Sbjct: 149 SEQST-----LAVLLDIVRKDGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLKWSGS 203

Query: 210 NTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK-QVVLCNDKYDGSFKS--WRTAVKDIY 266
           +  +   A                  YP   +K ++ L   K D   +   W   V DI 
Sbjct: 204 DVLLPSWAF---LLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMV-DIV 259

Query: 267 QSKGINGFFKGF 278
           + +GI G + G 
Sbjct: 260 KKEGIQGLYHGI 271

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 88/200 (44%), Gaps = 15/200 (7%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           +T+  +   ++G  + VA +A+ +PFDTIK RLQ   +++  K    C  + ++ +GI  
Sbjct: 115 QTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTK----CAVRMYQREGIAA 170

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
           F+  + P  +   +  + +   ++       K   P++   P   C+  G+ +G + + I
Sbjct: 171 FFYSY-PTTIAMNIPFAALNFVIYESST---KIFNPSNNYNPWIHCLCGGI-SGATCAAI 225

Query: 139 APPIELAKAKLQVQ-YDKTTTRYKGPLDVIKK----IYSAQGIRGLYKGLISTLIFRT-H 192
             P++  K  LQ++  D   ++     D  +K    I+   G  G ++GL   +I     
Sbjct: 226 TTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPA 285

Query: 193 FVYWWGSYELLTRWFRENTK 212
               W SYE        N+ 
Sbjct: 286 TAISWTSYEFAKHLLFTNSN 305

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 113/300 (37%), Gaps = 35/300 (11%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ---TSQNETRFKGPLDCVYKTFRNQG 75
           E    +    AG F+G+ ++++  P D IK R+Q   T+ +    + P + + +  +   
Sbjct: 13  ENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKIST 72

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGC-------LHNYRMLMHKYVYPNDEKL--PLSGCII 126
             G        L  W  + SV+LG           Y M   + + P D +   PL    +
Sbjct: 73  TEG-------SLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTA-L 124

Query: 127 SGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           SG LA  +   +  P +  K +LQ+    + T+         ++Y  +GI   +    +T
Sbjct: 125 SGTLATVAADALMNPFDTIKQRLQLHPSDSMTK------CAVRMYQREGIAAFFYSYPTT 178

Query: 187 LIFRTHFVYW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVV 245
           +     F    +  YE  T+ F  +   +                      P D VK V+
Sbjct: 179 IAMNIPFAALNFVIYESSTKIFNPSNNYNPWI--HCLCGGISGATCAAITTPLDCVKTVL 236

Query: 246 L---CNDKYDGSFK---SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
                +      FK   ++R A   I+++ G +GFF+G  P  + + P        +EF 
Sbjct: 237 QIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFA 296

>Kwal_55.21106
          Length = 328

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 112/297 (37%), Gaps = 55/297 (18%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQ--------------------NETRFKGPLDCV 67
           + G  +    N V +P D +K  +QT                       E R+K  LD +
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 68  YKTFRNQGIRGFYLGFTPPLVGWILMD-------SVMLGCLHNYRML---MHKYVYPNDE 117
            K F+ +G+ G Y G    ++   L         S++      Y++L   + K+  P + 
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEE- 126

Query: 118 KLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ-GI 176
                  ++ G++A         PI +   +   Q   T+    G  +V+ +IYS Q  I
Sbjct: 127 -------LLLGIVAAAVSQIFTSPIGVISTR---QQTSTSGSKGGFREVLHQIYSEQNNI 176

Query: 177 RGLYKGLISTLIFRTHFVYWWGSYELLT-------RWFRENTKMSEAAINXXXXXXXXXX 229
            G ++G   +LI   +    + SYE L        R   EN ++ E +            
Sbjct: 177 TGFWRGFKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETS--GQLSPRQNFL 234

Query: 230 XXXXXAYPSDVVKQVVLCNDKY----DGSFKSWRTAVKDIYQSKGINGFFKGFVPSF 282
                   S ++ Q ++ +  Y      +F+S++  +  +Y+ +G+   +KG  P  
Sbjct: 235 LGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGLAPQL 291

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 81/197 (41%), Gaps = 34/197 (17%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETR--FKGPLDCVYKTFRNQGIRGFYL 81
           ++G VA   S +  + +G     I  R QTS + ++  F+  L  +Y    N  I GF+ 
Sbjct: 128 LLGIVAAAVSQIFTSPIG----VISTRQQTSTSGSKGGFREVLHQIYSEQNN--ITGFWR 181

Query: 82  GFTPPLVGWILMDSVMLGC---LHNYRMLMHKYVYPNDEKLPLSGCI------ISGVLAG 132
           GF   L+   +  S+       L +  +   + V  N + L  SG +      + GV + 
Sbjct: 182 GFKVSLI-LTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSK 240

Query: 133 WSVSFIAPPIELAKAKLQ----------------VQYDKTTTRYKGPLDVIKKIYSAQGI 176
              + I  P+ ++KA LQ                 + +   + +KG    + K    QG+
Sbjct: 241 VISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGLAPQLSKGILVQGL 300

Query: 177 RGLYKGLISTLIFRTHF 193
             ++KG ++ LI R  F
Sbjct: 301 LFMFKGELTKLIKRCIF 317

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 17/180 (9%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
           +AG   G A  AV +P  TI   LQT +NE R K  L+ + + +   GI G++LG    +
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPK--LETIKEIYNKNGIIGYFLGLESAV 73

Query: 88  VGWILMDSVML----GCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143
            G    + V       C    R L  K      + L     I++  +AG   +  + PI 
Sbjct: 74  YGMATTNFVYYYFYEWCAKTARTLTTK------QYLSTWESILASTIAGSMTAVASNPIW 127

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
           +A  ++ V     +T  +  +D++K      G   L  GL   L+  ++ +  +  YE L
Sbjct: 128 VANTRMTVAKSNHST-LRTVIDIVK----TDGPLTLLNGLKPALVLVSNPIIQYTVYEQL 182

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPL-DCVYKTFRNQGIRGFYLGFT 84
            F+ G    +A     +P+ T+K R+   QN+ + +  +   + +  +  G+ G Y G  
Sbjct: 200 AFLLGAIGKLAATGTTYPYITLKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVA 259

Query: 85  PPLVGWIL 92
             LV  I+
Sbjct: 260 VKLVQSIM 267

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 64/154 (41%), Gaps = 18/154 (11%)

Query: 2   SKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS-QNETRF 60
           S S    TE  + L   E  S +   VAG  SG+   +V  P DT+K+R Q    +E ++
Sbjct: 5   SGSPQLATE--DHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKY 62

Query: 61  KGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL- 119
            G L       R +G+R  + G  P    ++L  S+  G           Y + N     
Sbjct: 63  HGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGT----------YAWLNTAAAS 112

Query: 120 ----PLSGCIISGVLAGWSVSFIAPPIELAKAKL 149
               P +  +  G LAG   S +  P++L + +L
Sbjct: 113 AGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRL 146

>Kwal_14.2210
          Length = 315

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/293 (19%), Positives = 116/293 (39%), Gaps = 21/293 (7%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK-GPLDCVYKTFRNQGIRGFYLGF 83
           + F AG  +G     V  PF+ +K+ LQ   +   +  G    V + +  +G+ G   G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLS-GCIISGVLAGWSVSFIAPPI 142
               +      +V       Y     ++   N + + L+   ++SG L G        P+
Sbjct: 79  GLNCIRIFPYSAVQFLV---YEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPL 135

Query: 143 ELAKAKLQVQYDKTTTRYK----------GPLDVIKKIYSAQ-GIRGLYKGLISTLIFRT 191
           +L + +L +Q       +K          G  ++++K Y+ + GI GLY+G+  T I   
Sbjct: 136 DLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVV 195

Query: 192 HFVYW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQ----VVL 246
            +V   +  YE L  +   +   + A++                 YP D++++    + +
Sbjct: 196 PYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQVLAM 255

Query: 247 CNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
              +    +KS   A+  I +++G  G++KG   +  +  P        +E V
Sbjct: 256 GQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETV 308

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77
           NE Y+ ++GF+    S  A  AV  P D IK R+Q+      +K  L+C Y+ F  +GI 
Sbjct: 322 NEYYAFVLGFI----SSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIP 377

Query: 78  GFYLGFTPPLVGWILMDSVMLG 99
            F+ G+ P L+   L   V  G
Sbjct: 378 KFWKGWAPRLMKVGLSGGVSFG 399

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 62/143 (43%), Gaps = 12/143 (8%)

Query: 146 KAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT--HFVYWWGSYEL 202
           + +L + Y++  T+R+      +K+IY  +G+RG  +G   T IFR   +    + +Y  
Sbjct: 255 RERLFLHYEEHPTSRF---FSTVKEIYLTRGLRGFVQGTAPT-IFRQMGNSAVRFTTYTS 310

Query: 203 LTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD-GSFKSWRTA 261
           L +    N  ++E                     P DV+K  +    KY   ++K+    
Sbjct: 311 LKQLISPNKPLNE--YYAFVLGFISSCAVVAVTQPIDVIKTRM--QSKYAWANYKNSLNC 366

Query: 262 VKDIYQSKGINGFFKGFVPSFLR 284
              I+  +GI  F+KG+ P  ++
Sbjct: 367 AYRIFVEEGIPKFWKGWAPRLMK 389

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 107/292 (36%), Gaps = 34/292 (11%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKG---PLDCVYKTFRNQGIRGFYLGF 83
            +AG F+G+A+++V  P D +K RLQ     +   G   P   + +        G     
Sbjct: 22  LMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEG----- 76

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKY----VYPNDEKLPLS-----GCIISGVLAGWS 134
              +V W  + SV+LG    + +    Y     +  DE    S         SG  A  +
Sbjct: 77  --SMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIA 134

Query: 135 VSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV 194
              +  P ++ K ++Q+  + +        D  K+IYS +G +  Y    +TL     F 
Sbjct: 135 ADALMNPFDVIKQRIQLNTNISV------WDTAKRIYSKEGFQAFYSSYPTTLAINIPFA 188

Query: 195 YW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDG 253
            + +G Y+  TR+F  N                          P D +K  +        
Sbjct: 189 AFNFGIYDTATRYF--NPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKV 246

Query: 254 SFK------SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
           S +      +++ A + IYQ  G  GF+ G  P  L + P        +EF 
Sbjct: 247 SMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFA 298

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 75/178 (42%), Gaps = 18/178 (10%)

Query: 15  LISNETYSRIMGFVAGVFSG----VAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT 70
           LI   T +    F    FSG    +A +A+ +PFD IK R+Q + N + +    D   + 
Sbjct: 109 LIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNISVW----DTAKRI 164

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
           +  +G + FY  +   L   I   +   G          +Y  P+    P   C+  G+ 
Sbjct: 165 YSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTAT----RYFNPSGVYNPFIHCLCGGI- 219

Query: 131 AGWSVSFIAPPIELAKAKLQVQ-YDKTTTRYKGPLDVIKK----IYSAQGIRGLYKGL 183
           +G + + +  P++  K  LQV+  +K +       D  KK    IY   G RG + G+
Sbjct: 220 SGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGV 277

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 14/179 (7%)

Query: 117 EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKG-PLDVIKKIYSAQG 175
           +  PL+  +++G  AG +   +  P++  K +LQ  +  +TT  +  P  +++++ S   
Sbjct: 14  DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISA 73

Query: 176 IRG---LYKGLISTLIFR--THFVYWWGSYELLTRWF-RENTKMSEAA-INXXXXXXXXX 228
             G   L+KG+ S L+     H VY + +YE++  +   E T  S+              
Sbjct: 74  QEGSMVLWKGVQSVLLGAGPAHAVY-FATYEMVKSFLIDEATSTSKYHFFKTAFSGATAT 132

Query: 229 XXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
                   P DV+KQ +  N     +   W TA K IY  +G   F+  +  +   + P
Sbjct: 133 IAADALMNPFDVIKQRIQLNT----NISVWDTA-KRIYSKEGFQAFYSSYPTTLAINIP 186

>Scas_669.6
          Length = 373

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 114/279 (40%), Gaps = 43/279 (15%)

Query: 42  HPFDTIKVRLQTSQNETRFKGPLDCVYKT-FRNQGI-RGFYLGFTPPLVGWILMDSVMLG 99
           H  DT+K R Q +    ++K  +   Y+T F  +GI RG Y G+   ++G     ++  G
Sbjct: 70  HSLDTVKTRQQGAPMTPKYKN-MTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 100 CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQ------Y 153
                +  M   +  ND    LS    +G+L  +  SF+  P E+ K +LQ+Q      +
Sbjct: 129 TYEWCKRKMIGDLGFNDTVSHLS----AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPF 184

Query: 154 DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VYWWGSYELLTRWF----- 207
            ++   Y+     I+ I + +G++ L+ G  +TL     F    +G YE   +       
Sbjct: 185 FQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEK 244

Query: 208 RENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRT------- 260
           ++ TK + +  N                 P DV+K   L   + D +  S  T       
Sbjct: 245 KDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIK-TRLQTQQADINPNSATTVGAISAK 303

Query: 261 ----------------AVKDIYQSKGINGFFKGFVPSFL 283
                           ++K +YQS+G+ GFF G  P F+
Sbjct: 304 TNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFV 342

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 57/145 (39%), Gaps = 13/145 (8%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS--------QNETRFKGPLDCVYK 69
           N+T S +    AG+      + V  P + +K RLQ          Q+   ++     +  
Sbjct: 144 NDTVSHLS---AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRI 200

Query: 70  TFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK--LPLSGCIIS 127
               +G++  + G+   L   +   ++  G    +R    K    +  K  L +   I +
Sbjct: 201 IVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFT 260

Query: 128 GVLAGWSVSFIAPPIELAKAKLQVQ 152
           G +AG     I  P+++ K +LQ Q
Sbjct: 261 GAIAGGLAGIITTPMDVIKTRLQTQ 285

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 44/96 (45%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77
           N+  S    F  GVFS  A  A+  P D +K R+Q+    + ++  L+CVY+TF  +G+ 
Sbjct: 241 NKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLT 300

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVY 113
             + G+ P L    L   V  G       LM    Y
Sbjct: 301 SLWKGWVPRLFKVGLSGGVSFGVYQYVDNLMLSMQY 336

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/153 (18%), Positives = 63/153 (41%), Gaps = 12/153 (7%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQG 75
           +S+   S     +AG  + V +  + HPF+ +K   Q  ++      P    +  F +  
Sbjct: 1   MSDTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSL-----PNAEAFNMFHH-- 53

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG--CIISGVLAGW 133
           ++ ++ G +   +G +L  +           L+     P + + P+SG   I +G + G+
Sbjct: 54  VKSYFAGCSALNIGILLKTATRFATFDKACQLLKD---PENPEAPVSGLRLIAAGSITGF 110

Query: 134 SVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDV 166
             S +  P E  K ++       + RY+  ++ 
Sbjct: 111 MESMLIIPFENIKTRMIENALILSNRYQEEVET 143

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 84/174 (48%), Gaps = 24/174 (13%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           +T+      ++G  +  A +A+ +PFDTIK R+Q + + + ++       + ++++G+  
Sbjct: 126 QTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQ----TTKQIYQSEGLAA 181

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
           FY  +   LV  I   +       +      K++ P++E  PL  C+  G ++G + + I
Sbjct: 182 FYYSYPTTLVMNIPFAAFNFVIYESST----KFLNPSNEYNPLIHCLC-GSISGSTCAAI 236

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKK----------IYSAQGIRGLYKG 182
             P++  K  LQ++  +T +     L++++K          IY   G +G ++G
Sbjct: 237 TTPLDCIKTVLQIRGSQTVS-----LEIMRKADTFSKAASAIYQVYGWKGFWRG 285

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/281 (19%), Positives = 107/281 (38%), Gaps = 22/281 (7%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET-RFKGPLDCVYKTFRNQGIRGFYLGFTP 85
            +AG F+G+ +++V  P D +K R+Q++  ++   K  L  +     ++G    + G   
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQS 96

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL--PLSGCIISGVLAGWSVSFIAPPIE 143
            ++G     +V  G    Y       +  +D +   P     ISG  A  +   +  P +
Sbjct: 97  VILGAGPAHAVYFG---TYEFCKKNLIDSSDTQTHHPFKTA-ISGACATTASDALMNPFD 152

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW-WGSYEL 202
             K ++Q+    +           K+IY ++G+   Y    +TL+    F  + +  YE 
Sbjct: 153 TIKQRIQLNTSASV------WQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYES 206

Query: 203 LTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWR--- 259
            T++   + + +   +                  P D +K V+        S +  R   
Sbjct: 207 STKFLNPSNEYNP--LIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKAD 264

Query: 260 ---TAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
               A   IYQ  G  GF++G+ P  + + P        +E
Sbjct: 265 TFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 78/181 (43%), Gaps = 14/181 (7%)

Query: 114 PNDEKLP----LSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKK 169
           P+ E LP    L   +I+G  AG     +  PI+  K ++Q    K+ +  K  L  I  
Sbjct: 22  PDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSA-KNMLSQISH 80

Query: 170 IYSAQGIRGLYKGLISTLIFR--THFVYWWGSYELLTRWFRENTK-MSEAAINXXXXXXX 226
           I +++G   L+KG+ S ++     H VY +G+YE   +   +++   +            
Sbjct: 81  ISTSEGTLALWKGVQSVILGAGPAHAVY-FGTYEFCKKNLIDSSDTQTHHPFKTAISGAC 139

Query: 227 XXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSF 286
                     P D +KQ +  N     S   W+T  K IYQS+G+  F+  +  + + + 
Sbjct: 140 ATTASDALMNPFDTIKQRIQLNT----SASVWQT-TKQIYQSEGLAAFYYSYPTTLVMNI 194

Query: 287 P 287
           P
Sbjct: 195 P 195

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%)

Query: 12  VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTF 71
           V SL  ++       F AG  S  A  A+  P D IK R+Q+      +K  L+C Y+ F
Sbjct: 237 VQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIF 296

Query: 72  RNQGIRGFYLGFTPPL 87
             +G R  + G+ P L
Sbjct: 297 VEEGFRYMWKGWVPRL 312

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 71/169 (42%), Gaps = 22/169 (13%)

Query: 28  VAGVFSGVAKNAVGH---PFDTIKVRL---QTSQNETRFKGPLDCVYKTFRNQGIRGFYL 81
            A V  G A  A  H   P  T   R       Q  + F G    V + +R +G+RGF  
Sbjct: 157 AAAVSKGPAPKATFHAARPVQTAHERWLLHYERQPSSHFAG---TVLEIYRTRGVRGFLQ 213

Query: 82  GFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN---DEKLPLSGCIISGVLAGWSVSFI 138
           G  P +    L +SV+       R   + ++  +    + L       +G L+  +V  +
Sbjct: 214 GAMPTIFR-QLGNSVV-------RFTTYAWIVQSLSPHKALDEYQAFAAGALSSAAVVAL 265

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
             PI++ K ++Q +    T  YK  L+   +I+  +G R ++KG +  L
Sbjct: 266 TQPIDVIKTRMQSKTAWFT--YKSSLNCAYRIFVEEGFRYMWKGWVPRL 312

>Scas_691.4
          Length = 334

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/323 (19%), Positives = 114/323 (35%), Gaps = 54/323 (16%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET--RFKGPLDCVYKTFRNQ 74
           +++  S ++  VAG  +G+ +    HP DTIKVR+Q ++     R  G +      + ++
Sbjct: 7   NDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHE 66

Query: 75  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWS 134
           G    Y G    ++G I   ++       YR  +          +      ++GV AG +
Sbjct: 67  GFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTD---KETRTITTGNTFLAGVGAGIT 123

Query: 135 VS-FIAPPIELAKAKLQVQY------------------DKTTTRYKGPLDVIKKIYSAQG 175
            +  +  P+E+ K +LQ Q+                    T  +Y   +     I   +G
Sbjct: 124 EAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEG 183

Query: 176 IRGLYKGLISTLI--------------FRTHFVYWWGSYELLTRWFRENTKMSEAAINXX 221
              LY+G+  T                +   ++  + + E L  W      +   AI   
Sbjct: 184 AGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPF 243

Query: 222 XXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAV---KDIYQSKGINGFFKGF 278
                          P D +K   L  DK   S  +W+        + + +G    +KG 
Sbjct: 244 SNA------------PLDTIK-TRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGI 290

Query: 279 VPSFLRSFPXXXXXXXXFEFVLR 301
            P  +R  P        +EFV +
Sbjct: 291 TPRVMRVAPGQAVTFTVYEFVRK 313

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 76/197 (38%), Gaps = 30/197 (15%)

Query: 13  NSLISNETYSRIMG--FVAGVFSGVAKNA-VGHPFDTIKVRLQTSQ-------------- 55
           N+L   ET +   G  F+AGV +G+ +   V +P + +K+RLQ                 
Sbjct: 98  NALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAA 157

Query: 56  ------NETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMH 109
                  + ++   +   Y   + +G    Y G +                    +  + 
Sbjct: 158 GTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQ 217

Query: 110 KYVYPNDEKLPL--SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDV 166
           KY   N E LP   + CI  G+++G    F   P++  K +LQ      + + +K    +
Sbjct: 218 KY--HNRESLPSWETSCI--GLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYII 273

Query: 167 IKKIYSAQGIRGLYKGL 183
             ++   +G R LYKG+
Sbjct: 274 GTQLIKEEGFRALYKGI 290

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%)

Query: 114 PNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSA 173
           PND+K      +++G  AG   +    P++  K ++Q+       R  G +   + IYS 
Sbjct: 6   PNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSH 65

Query: 174 QGIRGLYKGLISTLI 188
           +G   LYKGL + +I
Sbjct: 66  EGFLALYKGLGAVVI 80

>Scas_715.45
          Length = 305

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 75/190 (39%), Gaps = 19/190 (10%)

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
           + C + G++A         P++L K +LQV      +   G + ++KK    +G+  L+ 
Sbjct: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK----EGLGKLFT 72

Query: 182 GLISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDV 240
           G+ +T I +       +G YEL  R +  +    EA                  +  ++ 
Sbjct: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEAT-----AYKYRTSIYLLSSATAEF 127

Query: 241 VKQVVLC-----NDKYDGSFKSWRTAV----KDIYQSKGINGFFKGFVPSFLRSFPXXXX 291
              ++LC       K   +   W   V    K +Y  +G+NGF+KG  P + R  P    
Sbjct: 128 FADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187

Query: 292 XXXXFEFVLR 301
               FE ++ 
Sbjct: 188 KFTSFERIVE 197

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           PF+ IKV+ QT+         ++   K +  +G+ GFY G TP     I     M     
Sbjct: 135 PFEAIKVKQQTTM-PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI--PYTMCKFTS 191

Query: 103 NYRMLMHKYVYPNDEKLPLSG------CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKT 156
             R++   Y     +K  +S         + G +AG   + ++ P ++  +K+  +    
Sbjct: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE---- 247

Query: 157 TTRYKGPLDV-IKKIYSAQGIRGLYKGL-ISTLIFRTHFVYWWGSYE 201
             +    ++V +K+IYS  G  GL+ GL +  L+  T   + W  Y+
Sbjct: 248 -RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293

>Scas_717.20
          Length = 356

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 97/233 (41%), Gaps = 55/233 (23%)

Query: 13  NSLISNETY-SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ--TSQNETRFKGPLDCVYK 69
           N+LI ++ Y S     ++G  +G+      +P D I+VRL   T        G +  +YK
Sbjct: 120 NTLIPSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYK 179

Query: 70  -----TFRNQGIR--------GFYLGFTPPLVGWILMDSVML---GCLHNYRMLMHKYVY 113
                T   +G           FY G+TP ++G I    V       LH+  +L H  + 
Sbjct: 180 EPASTTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHD--VLKHPILA 237

Query: 114 P----------------NDEKLPLS--GCIISGVLAGWSVSFIAPPIELAKAKLQVQ--- 152
           P                  ++LPL     ++SG LAG +    A P E+ + +LQV    
Sbjct: 238 PYSVLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLS 297

Query: 153 ----YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL------ISTLIFRTHFVY 195
               YD    R++   ++ K IY  +G RG + GL      ++ ++  + FVY
Sbjct: 298 VSQMYDH---RFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVY 347

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 10/129 (7%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ-NETRFKGPL----DCVYKTFRNQGIRGFY 80
           G   G+    AK  +  P D IK+  QTS  + T++ G L    +     + N GIRGF+
Sbjct: 36  GLAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G +  L+      +V        R      + P+ E       ++SG LAG    F   
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIR----NTLIPSKEYESHWRRLMSGSLAGLCSVFTTY 150

Query: 141 PIELAKAKL 149
           P++L + +L
Sbjct: 151 PLDLIRVRL 159

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 250 KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 302
           KY GS    + A K I+ + GI GFF+G   + +R FP        +E +  T
Sbjct: 69  KYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNT 121

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 235 AYPSDVVKQ-----VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           AYP +++++      +  +  YD  F+S     K IY+ +G  GFF G    +++  P
Sbjct: 281 AYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTP 338

>Kwal_47.19228
          Length = 281

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77
           NE Y+  +GF+    S  A  AV  P D IK R+Q+    + +K  L+C Y+ F  +G  
Sbjct: 183 NEYYAFALGFI----SSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFT 238

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLM 108
            F+ G+ P L+   L   V  G       LM
Sbjct: 239 KFWKGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 11/121 (9%)

Query: 64  LDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG 123
           L  V + +R++GIRGF  G  P ++      +V      + + +    + PN    PL+ 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQM----ISPNK---PLNE 184

Query: 124 --CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
                 G ++  +V  +  PI++ K ++Q +Y  T + YK  L+   +I+  +G    +K
Sbjct: 185 YYAFALGFISSCAVVAVTQPIDVIKTRMQSKY--TWSNYKNSLNCAYRIFVEEGFTKFWK 242

Query: 182 G 182
           G
Sbjct: 243 G 243

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (75%)

Query: 256 KSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           + + T V++IY+S+GI GF +G +P+ +R
Sbjct: 129 RQFLTTVQEIYRSRGIRGFLQGTMPTIIR 157

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 62/141 (43%), Gaps = 8/141 (5%)

Query: 146 KAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRT-HFVYWWGSYELLT 204
           + K  + YD+  +R    L  +++IY ++GIRG  +G + T+I +T +    + +Y  L 
Sbjct: 116 RQKWALYYDEHPSRQF--LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLK 173

Query: 205 RWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD-GSFKSWRTAVK 263
           +    N  ++E                     P DV+K  +    KY   ++K+      
Sbjct: 174 QMISPNKPLNE--YYAFALGFISSCAVVAVTQPIDVIKTRM--QSKYTWSNYKNSLNCAY 229

Query: 264 DIYQSKGINGFFKGFVPSFLR 284
            I+  +G   F+KG+ P  ++
Sbjct: 230 RIFVEEGFTKFWKGWAPRLMK 250

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/305 (20%), Positives = 108/305 (35%), Gaps = 46/305 (15%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ-----NETRFKGPLDCVYKTFRNQGIRGF 79
           +  +AG  +G+ +    HP DTIKVR+Q  +        +  G +      ++ +G    
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVS-FI 138
           Y G    ++G I   ++       YR L+   V      +      ++GV AG + +  +
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYEFYRTLL---VNKESGIVSTGNTFVAGVGAGITEAVLV 128

Query: 139 APPIELAKAKLQVQYDKTTTRYKGP-----LDVIKKIYSAQGIRGLYKGLISTLIFRT-- 191
             P+E+ K +LQ Q+   +    GP     +     I   +G+  LY+G+  T   +   
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 192 ------------HFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSD 239
                        F+  +   ++L  W      +   AI                  P D
Sbjct: 189 QGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNA------------PLD 236

Query: 240 VVKQVVLCNDKY-----DGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXX 294
            +K   L  DK          K   T    + + +G    +KG  P  +R  P       
Sbjct: 237 TIK-TRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFT 295

Query: 295 XFEFV 299
            +E+V
Sbjct: 296 VYEYV 300

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 18/192 (9%)

Query: 20  TYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGF 79
           T+  +   V+GV + VA +A+ +PFDTIK RLQ  Q+++         +  ++N+G   F
Sbjct: 131 THQPLKTAVSGVAATVAADALMNPFDTIKQRLQL-QSKSSDSSMWRMAFNIYKNEGPMAF 189

Query: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA 139
           +  +   L   I   ++      +      K+  P +   P   C+  G+ AG + + + 
Sbjct: 190 FYSYPTTLAMNIPFAALNFVIYESST----KFFNPTNAYNPWIHCLCGGI-AGATCAAVT 244

Query: 140 PPIELAKAKLQ--------VQYDKTTTRYKGPLDVIKKIYSAQGI-RGLYKGLISTLIFR 190
            P++  K  LQ        V+  KT   +K     I + Y  +G  RGL   +IS +   
Sbjct: 245 TPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNI--- 301

Query: 191 THFVYWWGSYEL 202
                 W SYE 
Sbjct: 302 PATAISWTSYEF 313

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 59/300 (19%), Positives = 105/300 (35%), Gaps = 36/300 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQN------------------ETRFKGPLDCVY 68
            +AG F+G+ ++++  P D +K R+Q                             L  + 
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 69  KTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPND--EKLPLSGCII 126
           +    +G    + G    ++G     +V       Y     + +   D     PL   + 
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFA---TYEFCKEQLIDAKDFNTHQPLKTAV- 139

Query: 127 SGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLIST 186
           SGV A  +   +  P +  K +LQ+Q   + +       +   IY  +G    +    +T
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKSSDSSM---WRMAFNIYKNEGPMAFFYSYPTT 196

Query: 187 LIFRTHFVYW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVV 245
           L     F    +  YE  T++F   T      I+                 P D +K V+
Sbjct: 197 LAMNIPFAALNFVIYESSTKFFNP-TNAYNPWIHCLCGGIAGATCAAVTT-PLDCIKTVL 254

Query: 246 L---CNDKYDGSFKSWRT---AVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFV 299
                +  +  SFK+  T   A + I+QS G  GF++G  P  + + P        +EF 
Sbjct: 255 QIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSYEFA 314

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            V+G F G+A      P D +K RLQ +Q  +     L  V +  R    R  + G  P 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASS-----LRSVLREVRT--TRELWRGTLPS 64

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDE-----KLPLSGCIISGVLAGWSVSFIAPP 141
            +   +  ++ L  L+  R  + +            +L     +++G L+  +V  +  P
Sbjct: 65  ALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMP 124

Query: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           I + K    V+Y+ T   Y G  +  + I+ ++G RG +KG  +T +
Sbjct: 125 ITVIK----VRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTL 167

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 261 AVKDIYQSKGINGFFKGFVPSFLRSFP 287
           A + I++S+G  GFFKG   + LR  P
Sbjct: 145 ATRHIWRSEGARGFFKGAAATTLRDAP 171

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 110/281 (39%), Gaps = 22/281 (7%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQ-NETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
            +AG F+G+ ++++  P D +K R+Q +  N+    G +  + K    +G    + G   
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKL--PLSGCIISGVLAGWSVSFIAPPIE 143
            ++G     +V  G    Y     + + P D +   P+    +SG +A  +   +  P +
Sbjct: 87  VILGAGPAHAVYFG---TYEFCKARLISPEDMQTHQPMKTA-LSGTIATIAADALMNPFD 142

Query: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW-WGSYEL 202
             K +LQ+    T  R     +V K+IY  +G    Y    +TL     F  + +  YE 
Sbjct: 143 TVKQRLQLD---TNLRV---WNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYES 196

Query: 203 LTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK------ 256
            +++F  N + S   +                  P D +K V+        S +      
Sbjct: 197 ASKFF--NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDAN 254

Query: 257 SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
           ++  A + I +  G  GF++G  P  + + P        +E
Sbjct: 255 TFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 87/203 (42%), Gaps = 25/203 (12%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           +T+  +   ++G  + +A +A+ +PFDT+K RLQ   N   +    +   + ++N+G   
Sbjct: 116 QTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVW----NVTKQIYQNEGFAA 171

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138
           FY  +   L   I   +       +      K+  P +   PL  C+  G+ +G + + +
Sbjct: 172 FYYSYPTTLAMNIPFAAFNFMIYESAS----KFFNPQNSYNPLIHCLCGGI-SGATCAAL 226

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKK----------IYSAQGIRGLYKGLISTLI 188
             P++  K  LQV+  +T +     ++++K           I    G +G ++GL   ++
Sbjct: 227 TTPLDCIKTVLQVRGSETVS-----IEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIV 281

Query: 189 FRT-HFVYWWGSYELLTRWFREN 210
                    W +YE    +  +N
Sbjct: 282 ANIPATAISWTAYECAKHFLMKN 304

>Scas_582.7
          Length = 329

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/289 (20%), Positives = 108/289 (37%), Gaps = 34/289 (11%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
            +AG F+G+ +++   P D +K R+Q++  +   +     + +  +   + G        
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEG-------S 92

Query: 87  LVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG--------CIISGVLAGWSVSFI 138
           L  W  + SV+LG    + +    Y +     +P S           +SG  A  +  F 
Sbjct: 93  LALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFF 152

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYW-W 197
             P +  K ++Q+   K    Y    +V KKIY+ +G+   Y    +T+     F  + +
Sbjct: 153 MNPFDTIKQRMQISDLKKEKVY----NVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNF 208

Query: 198 GSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCND-------- 249
             YE  +++F  N       +                  P D +K V+            
Sbjct: 209 MIYESASKFF--NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEV 266

Query: 250 -KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFE 297
            K   +FK   +A+  +Y   G  GF++G  P  L + P        +E
Sbjct: 267 MKKANTFKKATSAILMVY---GWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 74/183 (40%), Gaps = 38/183 (20%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           ET+  I   V+G  + VA +   +PFDTIK R+Q S  + + +   +   K +  +G+  
Sbjct: 131 ETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQIS--DLKKEKVYNVAKKIYNLEGLSA 188

Query: 79  FY------LGFTPPLVGWILM----DSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISG 128
           FY      +    P   +  M     S     LH+Y  L+H              C+  G
Sbjct: 189 FYYSYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPLIH--------------CLCGG 234

Query: 129 VLAGWSVSFIAPPIELAKAKLQV--------QYDKTTTRYKGPLDVIKKIYSAQGIRGLY 180
           + +G   + +  P++  K  +Q+        +  K    +K     I  +Y   G +G +
Sbjct: 235 I-SGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVY---GWKGFW 290

Query: 181 KGL 183
           +GL
Sbjct: 291 RGL 293

 Score = 34.3 bits (77), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 70/172 (40%), Gaps = 8/172 (4%)

Query: 120 PLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP-LDVIKKIYSAQGIRG 178
           PLS  +++G  AG        PI+  K ++Q    K T +     +  I KI + +G   
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 179 LYKGLISTLIFR--THFVYWWGSYELL-TRWFRENTKMSEAAINXXXXXXXXXXXXXXXA 235
           L+KG+ S ++     H VY + +YE        ++ + +   I                 
Sbjct: 95  LWKGVQSVILGAGPAHAVY-FATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFM 153

Query: 236 YPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
            P D +KQ +  +D      K +  A K IY  +G++ F+  +  +   + P
Sbjct: 154 NPFDTIKQRMQISDLKKE--KVYNVA-KKIYNLEGLSAFYYSYPTTIAMNIP 202

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/307 (18%), Positives = 120/307 (39%), Gaps = 17/307 (5%)

Query: 10  EPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPL-DCVY 68
           +P N + +       + FVAG   G     V  P + +K+ LQ   + T + G L   V 
Sbjct: 3   QPENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVK 62

Query: 69  KTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISG 128
           + ++ +G++G + G     +      +V        +  +        E+L     ++ G
Sbjct: 63  QVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGG 122

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK----------GPLDVIKKIYSAQ-GIR 177
            L G +   +  P++L + +L +Q       ++          G ++++++I+  + G+R
Sbjct: 123 ALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLR 182

Query: 178 GLYKGLISTLIFRTHFVYW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAY 236
           G Y+G+  T +    FV   +  YE L      +      A                  Y
Sbjct: 183 GWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVY 242

Query: 237 PSDVVK---QVVLCNDKYDG-SFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXX 292
           P D+++   QV+       G  + S   A+  I + +G+ G++KG   + ++  P     
Sbjct: 243 PFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQ 302

Query: 293 XXXFEFV 299
              +E +
Sbjct: 303 WFVYELI 309

>Scas_613.24
          Length = 177

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 77/174 (44%), Gaps = 18/174 (10%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQG 75
           +S+++    +  V+G   G++      P D +K R+Q  +  T +    D          
Sbjct: 1   MSDKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDI------KDP 54

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGCLHNYR-MLMHKYVYPND------EKLPLSGCIISG 128
           I+ F+ G  P  +   +  ++ L CL+  R  L+H              +L +   +++G
Sbjct: 55  IQ-FWRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTG 113

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKG 182
            +A   V +I  PI +    L+V+Y+ T   YK   + IK IY  +GI G +KG
Sbjct: 114 AMARGLVGYITMPITI----LKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKG 163

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 23/28 (82%)

Query: 254 SFKSWRTAVKDIYQSKGINGFFKGFVPS 281
           S+KS   A+KDIY+ +GI+GFFKGF P+
Sbjct: 140 SYKSMNEAIKDIYKMEGISGFFKGFGPT 167

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 61/135 (45%), Gaps = 15/135 (11%)

Query: 159 RYKGPLDVIKKIYSAQGIRGLYKGLISTLI--FRTHFVY-WWGSYELLTR-WFRENTKMS 214
           RYK  LDVI K+Y  +G  GLY GL ++L+  F   F Y +W  Y L+ R +FR      
Sbjct: 86  RYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFW--YTLIRRHYFRVKKVKG 143

Query: 215 EAA----INXXXXXXXXXXXXXXXAYPSDVV--KQVVLCNDKYDGSFKSWRTAVKDIYQS 268
           EAA    I                  P ++V  KQ      + D SFK+     K++Y  
Sbjct: 144 EAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKA---IAKEVYDE 200

Query: 269 KGINGFFKGFVPSFL 283
            GI GF+K    S +
Sbjct: 201 DGITGFWKSLKVSLV 215

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 91/243 (37%), Gaps = 24/243 (9%)

Query: 57  ETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSV-----MLGCLHNYRMLMHKY 111
           E R+K  LD + K +RN+G  G Y G +  L+G  +          L   H +R+   K 
Sbjct: 84  EQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRV---KK 140

Query: 112 VYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-KTTTRYKGPLDVIKKI 170
           V     +      ++  +LA  +      PI +   K Q +   +    +K    + K++
Sbjct: 141 VKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKA---IAKEV 197

Query: 171 YSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL------TRWFRENTKMSEAAI---NXX 221
           Y   GI G +K L  +L+   +    + S E L        W  ++   S   +      
Sbjct: 198 YDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNF 257

Query: 222 XXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPS 281
                         +P  V K  +    +    F S++  +  +Y+ +G +  +KG +P 
Sbjct: 258 LIGVLSKIISTCLTHPLIVAKASL---QRSSSKFTSFQEVLTYLYRHEGAHALWKGLLPQ 314

Query: 282 FLR 284
             +
Sbjct: 315 LTK 317

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 73/176 (41%), Gaps = 17/176 (9%)

Query: 21  YSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS---QNETRFKGPLDCVYKTFRNQGIR 77
           +S I   +  + +        +P + +  + QT    + +  FK     VY      GI 
Sbjct: 148 FSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYD---EDGIT 204

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYP----NDEKLPLS--GCIISGVLA 131
           GF+      LV   +  S+        + +++   +     ND  L L      + GVL+
Sbjct: 205 GFWKSLKVSLV-LTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLS 263

Query: 132 GWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
               + +  P+ +AKA LQ    ++++++    +V+  +Y  +G   L+KGL+  L
Sbjct: 264 KIISTCLTHPLIVAKASLQ----RSSSKFTSFQEVLTYLYRHEGAHALWKGLLPQL 315

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 75/172 (43%), Gaps = 19/172 (11%)

Query: 39  AVGHPFDTIKVRLQTSQNE--TRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSV 96
           A+ +P  TI  +LQT  N+   + K  L+ + + +R  G+ GFY G    + G  L + V
Sbjct: 29  ALTYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV 88

Query: 97  -----MLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQV 151
                 L   +  ++  HK +  N  +  L+GC+     AG   +  + PI +A  ++ V
Sbjct: 89  YYYFYELTSRNVLKVRKHKKL--NTLESMLTGCV-----AGSVTAIASNPIWVANTRMTV 141

Query: 152 QYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
                T   K  L  I +I      + L+ GL   L+   + +  +  +E L
Sbjct: 142 -----TKSEKTALATIIEIVKKDSAKTLFNGLKPALVLVMNPIVQYTVFEQL 188

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL--IFRTHFVYWWG 198
           P+     KLQ Q +    + K  L+ IK+IY   G+ G Y GL S +  +  T+FVY++ 
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYY- 91

Query: 199 SYELLTR 205
            YEL +R
Sbjct: 92  FYELTSR 98

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 112/335 (33%), Gaps = 74/335 (22%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET------------------------- 58
           ++  VAG  +G+ +    HP DTIKVR+Q  + +                          
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 59  ------RFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV 112
                 +  G +      +  +G    Y G    ++G I   ++       YR L+    
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD-- 129

Query: 113 YPNDEKLPLSGCIISGVLAGWSVS-FIAPPIELAKAKLQVQY-----DKTTTRYKGPLDV 166
                 +  S   I+GV AG + +  +  P+E+ K +LQ Q+     D    +Y   +  
Sbjct: 130 -KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQA 188

Query: 167 IKKIYSAQGIRGLYKGLISTLIFRT--------------HFVYWWGSYELLTRWFRENTK 212
              I   +GI  LY+G+  T   +                F+  +   E L  W      
Sbjct: 189 GYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIG 248

Query: 213 MSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFK---SWRTAVK---DIY 266
           +   AI                  P D +K   L  DK   SFK    W+        + 
Sbjct: 249 LISGAIGPFSNA------------PLDTIK-TRLQKDK-STSFKGESGWKRIAHIGTQLL 294

Query: 267 QSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           + +G    +KG  P  +R  P        +EFV R
Sbjct: 295 KEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 329

>Scas_705.9
          Length = 323

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 108/292 (36%), Gaps = 36/292 (12%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ--TSQNET-----------RFKGPLDCVY 68
           S +   + G  +    N + +P D  K  +Q  T   ET           R +  + C+ 
Sbjct: 2   SNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLI 61

Query: 69  KTFRNQGIRGFYLGFTPPLVGWILMDSVMLGC-LHNYRMLMHKY----VYPNDEKLPLSG 123
           + FR +G+RG Y G +      +    V   C    Y  L  KY    +  N +  P++ 
Sbjct: 62  RIFRKRGLRGLYQGMSTS----VFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINS 117

Query: 124 C-----IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIY--SAQGI 176
                 +I GV A      +  PIE+   K Q   DK    +     V+K+IY  S   +
Sbjct: 118 ISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDF---YSVLKQIYVESNGKL 174

Query: 177 RGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAY 236
              +KG   +LI   +    + +Y+       +    SE + +                 
Sbjct: 175 SSYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKI 234

Query: 237 PSDVVKQVVLCN----DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
            S ++ Q ++       + +  FK +   ++ +Y+ +G+   +KG  P   +
Sbjct: 235 ISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

>Scas_687.15*
          Length = 328

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77
           NE Y+    F  G+FS  A  A+  P D +K R+Q+      +K  L+C Y+ F  +G+ 
Sbjct: 232 NEVYA----FGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMV 287

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLMH 109
             + G+ P L    L   +  G       L H
Sbjct: 288 SLWKGWLPRLFKVGLSGGISFGVYQYVENLSH 319

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 73/202 (36%), Gaps = 47/202 (23%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
           +AG  + V +  + +PF+ +K   Q  +     K P + +      + I+ ++ G T   
Sbjct: 13  LAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAK-PFEAL------RPIKVYFAGCTALN 65

Query: 88  VGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKA 147
           +  I+  SV          ++     P D  L     +++G+L G   S    P E  K 
Sbjct: 66  LSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESLCIIPFENVKV 125

Query: 148 KL-------------------------------------QVQYDKTTTRYKGP--LDVIK 168
            +                                     Q Q+ +  ++Y       V+K
Sbjct: 126 TMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIFSVVK 185

Query: 169 KIYSAQGIRGLYKGLISTLIFR 190
           +IY  +G+RG  +G + T +FR
Sbjct: 186 EIYLTRGLRGFAQGAMPT-VFR 206

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 9/122 (7%)

Query: 67  VYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCII 126
           V + +  +G+RGF  G  P +   +   +V        + L+     P +E         
Sbjct: 184 VKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISP-TQPLNEVYAFG---- 238

Query: 127 SGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTR-YKGPLDVIKKIYSAQGIRGLYKGLIS 185
            G+ +  +V  +  PI++ K ++Q    KT    YK  L+   +++  +G+  L+KG + 
Sbjct: 239 IGLFSSCAVVALTQPIDVVKTRMQ---SKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLP 295

Query: 186 TL 187
            L
Sbjct: 296 RL 297

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 118/311 (37%), Gaps = 60/311 (19%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQ-NETRFKGPL----DCVYKTFRNQGIRGFYLG 82
           +AG  SG     +  P D IK+  QTS  + T++ G L    +     + N G+RGF+ G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPI 142
            +  L+      +V        R  +     P+ E       ++SG LAG    FI  P+
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTL----IPSKEFESHWRRLVSGSLAGLCSVFITYPL 153

Query: 143 ELAKAKLQVQYDKTTTRYKGPLDVIKKIY----SAQGIR------------GLYKGLIST 186
           +L + +L  + +    +      +IKKIY    SA  I+              Y+G + T
Sbjct: 154 DLVRVRLAYETEHKRVKLG---RIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 187 LI---------FRTHFVY-------WWGSYELLTRWFRENTKMSEAAINXXXXXXX---- 226
           ++         F  H +        ++  Y +L     E+ ++                 
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLE--LSEDDELERVQKKQRRPLRTWAEL 268

Query: 227 -----XXXXXXXXAYPSDVVK---QVVLCNDK--YDGSFKSWRTAVKDIYQSKGINGFFK 276
                        AYP ++++   QV   + K  YD  F+S       I++ +G+ GFF 
Sbjct: 269 ISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFV 328

Query: 277 GFVPSFLRSFP 287
           G    +++  P
Sbjct: 329 GLSIGYIKVTP 339

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 94/230 (40%), Gaps = 49/230 (21%)

Query: 13  NSLI-SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRL--QTSQNETRFKGPLDCVYK 69
           N+LI S E  S     V+G  +G+    + +P D ++VRL  +T     +    +  +YK
Sbjct: 121 NTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYK 180

Query: 70  T------FRNQGIRG-------FYLGFTPPLVGWILMDSVML---GCLHNYRMLMHKYVY 113
                   +N  I         FY G+ P ++G I    V       LH+  +L   +  
Sbjct: 181 EPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHD--VLKSPFFA 238

Query: 114 P--------NDE--------KLPLS--GCIISGVLAGWSVSFIAPPIELAKAKLQVQYDK 155
           P        +DE        + PL     +ISG LAG +    A P E+ + +LQV    
Sbjct: 239 PYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALS 298

Query: 156 TTTRYKGPLDVIKK----IYSAQGIRGLYKGL------ISTLIFRTHFVY 195
             T Y      I +    I+  +G+RG + GL      ++ ++  + FVY
Sbjct: 299 PKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVY 348

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%)

Query: 250 KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLRT 302
           KY GS      A K I+ + G+ GFF+G   + LR FP        +E +  T
Sbjct: 70  KYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNT 122

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 105/268 (39%), Gaps = 25/268 (9%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78
           ++ S ++   +G  +G + +    P DT+K RLQ        KG        F N G +G
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQA-------KGGF------FANGGYKG 48

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRM----LMHKYVYPNDEKLPLSGCIISGVLAGWS 134
            Y G    ++      S+      + ++    ++ KYV  N++       + S  +   S
Sbjct: 49  VYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVS 108

Query: 135 VSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV 194
              +  P E+ K + Q    KT + ++    +++       +R LY+G  +T++    F 
Sbjct: 109 ACLVRVPAEVIKQRTQTH--KTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFT 166

Query: 195 -YWWGSYELLTR-WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
              +  YE L + W + N +   A                    P DV+K  ++ + K  
Sbjct: 167 CIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHK-- 224

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVP 280
            S    + A K+IY  +G   FF G  P
Sbjct: 225 -SIPVAQLA-KNIYAEEGFKVFFSGVGP 250

>Kwal_26.7972
          Length = 358

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 68/159 (42%), Gaps = 13/159 (8%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQ-NETRFKGPLDCVYKT----FRNQGIRGFY 80
           G   G+    AK  +  P D IK+  QTS  +  ++ G    + +       + GIRGFY
Sbjct: 31  GLAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G +  L+      ++        R  M     P+ E    +  + SG +AG    F+  
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRHFM----IPSKEYETHARRLASGSMAGLCSVFMTY 145

Query: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGL 179
           P++L + +L    D++  +    L VIK+IY+ +    L
Sbjct: 146 PLDLIRVRLAYVTDRSRIKM---LPVIKQIYTERASESL 181

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 88/201 (43%), Gaps = 38/201 (18%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK--GPLDCVYKTFRNQGI 76
           ET++R +   +G  +G+    + +P D I+VRL    + +R K    +  +Y    ++ +
Sbjct: 124 ETHARRLA--SGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESL 181

Query: 77  RG-------------FYLGFTPPLVGWILMDSV------MLGCLHNYRMLMHKYVYP-ND 116
                          FY GFTP ++G I    V      + G +     L    V P +D
Sbjct: 182 TSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISD 241

Query: 117 EKL----------PLS--GCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTT--RYKG 162
           E+L          PL     +++G LAG +    + P E+ + +LQV     T+   ++ 
Sbjct: 242 EELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQT 301

Query: 163 PLDVIKKIYSAQGIRGLYKGL 183
             D+I+ IY  +G RG + GL
Sbjct: 302 IPDMIRIIYKERGWRGFFVGL 322

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTS----QNETRFKGPLDCVYKTFRNQGIRGFYLG 82
            VAG  +G+A     +PF+ I+ RLQ S     +   F+   D +   ++ +G RGF++G
Sbjct: 262 LVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVG 321

Query: 83  FTPPLVGWILMDSVMLGC 100
            +   +G+I + + M+ C
Sbjct: 322 LS---IGYIKV-TPMVAC 335

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 104/255 (40%), Gaps = 26/255 (10%)

Query: 40  VGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG 99
           +G P + +K  +  ++N T     L+ V   +   GI G+Y G  P    W  +++   G
Sbjct: 37  LGQPLEVVKTTMAANRNFTF----LESVKHVWSRGGILGYYQGLIP----WAWIEASTKG 88

Query: 100 CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTR 159
            +  +     +Y + +      +  I+ GV  G + +++          +++   K+ + 
Sbjct: 89  AVLLFVSAEAEYRFKSLGLNNFASGILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASA 148

Query: 160 YKGPLD---VIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKM--- 213
              P     V K IY  +GIRG+ KG+ +  I +   +  WGS   L+R   +  +    
Sbjct: 149 GGVPQSSWSVFKNIYKKEGIRGINKGVNAVAIRQ---MTNWGSRFGLSRLVEDGIRKITG 205

Query: 214 ---SEAAINXXXXXXXXXXXXXXXAY--PSDVVKQVVLCNDKYDGSFKSWRTAVKD---I 265
               +  +N               A+  P +V++ V + + K D +     T  K    I
Sbjct: 206 KTNKDDKLNPFEKIGASALGGGLSAWNQPIEVIR-VEMQSKKEDPNRPKNLTVGKTFKYI 264

Query: 266 YQSKGINGFFKGFVP 280
           YQS G+ G ++G  P
Sbjct: 265 YQSNGLKGLYRGVTP 279

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 80/219 (36%), Gaps = 50/219 (22%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQT---------------------------------- 53
           ++G  +    N V +P D +K  +QT                                  
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 54  -SQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMD-------SVMLGCLHNYR 105
              N  ++    D +YK ++ +GIRG Y G T  ++             S +  C    +
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 106 MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLD 165
           ++  K     + K      ++ G++A  +      PI L  A+ Q +  +        L 
Sbjct: 128 LINRK-----NTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTR--QGIDGDNDFLT 180

Query: 166 VIKKIYSAQ-GIRGLYKGLISTLIFRTHFVYWWGSYELL 203
           V K+IY  Q  I+G +KGL  +L+   +    + SYE L
Sbjct: 181 VAKEIYKEQRSIKGFWKGLKVSLMLTINPSITYTSYEKL 219

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 16/136 (11%)

Query: 159 RYKGPLDVIKKIYSAQGIRGLYKGLISTLI---FRTHFVYWWGSYELLTRWF-------R 208
           +Y    D I KIY  +GIRGLY+GL ++++   F+T   ++W  Y  + + +       R
Sbjct: 74  QYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFW--YSFVRKCYFRVKLINR 131

Query: 209 ENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIY-Q 267
           +NTK +   I                  P  ++          DG    + T  K+IY +
Sbjct: 132 KNTKFT--TIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGD-NDFLTVAKEIYKE 188

Query: 268 SKGINGFFKGFVPSFL 283
            + I GF+KG   S +
Sbjct: 189 QRSIKGFWKGLKVSLM 204

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI 76
           S+   S    F  GV S +    +  P    K  LQ  +N + F      +Y  ++N+G+
Sbjct: 238 SSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ--RNGSNFSSFQQVLYYLYKNEGL 295

Query: 77  RGFYLGFTPPLVGWILMDSVM 97
           R ++ G +P L   +L+  ++
Sbjct: 296 RSWWKGLSPQLAKGVLVQGLL 316

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 31/181 (17%)

Query: 16  ISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKG--PLDCVYKTFRN 73
           +++ T   I GF  G+ S VA      P D +K R Q ++  T ++    LD  ++ +R 
Sbjct: 1   MASSTGHLIGGFAGGLSSAVAL----QPLDLLKTRFQQTKGGTLWQTVKSLDTPWQLWR- 55

Query: 74  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVY------------PNDEKLPL 121
                   G  P  +   +  ++ L  L+  R  + K                N  +L +
Sbjct: 56  --------GTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSM 107

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
              +++G  A  +V +I  PI + K    V+Y+ T   YK   +  K I + +GIRG ++
Sbjct: 108 YENLVTGAFARGTVGYITMPITIIK----VRYESTLYNYKSIAEAAKSIAAQEGIRGFFR 163

Query: 182 G 182
           G
Sbjct: 164 G 164

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 240 VVKQVVLCNDKYDGS---FKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           +   + +   +Y+ +   +KS   A K I   +GI GFF+GF P+ LR  P
Sbjct: 124 ITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAP 174

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/285 (19%), Positives = 106/285 (37%), Gaps = 34/285 (11%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTS--------QNE------TRFKGPLDCVYKTFRN 73
           + G  +    N   +P D  K  +Q+          NE       R+K  +DC+   F+ 
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 74  QGIRGFYLGFTPPLVGWILMDSV-------MLGCLHNYRMLMHKYVYPNDEKLPLSGC-- 124
           +GI G Y G T   V   + + V       +      +++L  + +   D  +  S    
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG--IRGLYKG 182
           ++ GV A         P+ +   + Q  +   + ++    +VIK IY      I   +KG
Sbjct: 128 LVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFT---NVIKDIYRENNGDITAFWKG 184

Query: 183 LISTLIFRTHFVYWWGSYELLTRWF---RENTKMSEAAINXXXXXXXXXXXXXXXAYPSD 239
           L + L    +    + S++ L   F     N   S +A+                  P  
Sbjct: 185 LRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLI 244

Query: 240 VVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284
           V K ++         F +++ A+  +Y+++G+   +KG +P   +
Sbjct: 245 VAKAML---QSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>Kwal_33.14050
          Length = 314

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 81/193 (41%), Gaps = 21/193 (10%)

Query: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPL-DCVYKTFRNQGIR 77
           +T+  +    +G+ + VA + + +PFDTIK R+Q     T  K  +     + +RN+G+ 
Sbjct: 116 QTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQL---RTFSKDRMWSVASRIYRNEGLA 172

Query: 78  GFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSF 137
            F+  +   +   I   +       +      K+  P +   PL  C+  G+ +G + + 
Sbjct: 173 AFFYSYPTTIAMNIPFAAFNFAIYES----ATKFFNPENTYNPLIHCLCGGI-SGATCAA 227

Query: 138 IAPPIELAKAKLQVQYDKTTT--------RYKGPLDVIKKIYSAQGI-RGLYKGLISTLI 188
           I  P++  K  LQV+  ++           +      I K+Y   G  RGL   +IS + 
Sbjct: 228 ITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNM- 286

Query: 189 FRTHFVYWWGSYE 201
                   W +YE
Sbjct: 287 --PATAISWTAYE 297

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/314 (20%), Positives = 114/314 (36%), Gaps = 44/314 (14%)

Query: 11  PVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT------SQNETRFKGPL 64
           P N+ ++++         AG F+G+ ++++  P D IK R+Q       S N    K P 
Sbjct: 11  PTNAPLTHQ-------LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAA-KLPS 62

Query: 65  DCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGC-------LHNYRMLMHKYVYPND- 116
           + V +  R     G        +  W  + SV+LG           Y M     + P D 
Sbjct: 63  NIVQQIARISTTEG-------SMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDF 115

Query: 117 -EKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG 175
               PL     SG+ A  +   +  P +  K ++Q++       +     V  +IY  +G
Sbjct: 116 QTHQPLKTA-ASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMW----SVASRIYRNEG 170

Query: 176 IRGLYKGLISTLIFRTHFVYW-WGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXX 234
           +   +    +T+     F  + +  YE  T++F  N + +   +                
Sbjct: 171 LAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF--NPENTYNPLIHCLCGGISGATCAAI 228

Query: 235 AYPSDVVK---QVVLCNDKYDGSFKSWRT---AVKDIYQSKGINGFFKGFVPSFLRSFPX 288
             P D +K   QV       D  F+   T   A   I +  G +GF++G  P  + + P 
Sbjct: 229 TTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPA 288

Query: 289 XXXXXXXFEFVLRT 302
                  +E    T
Sbjct: 289 TAISWTAYECAKHT 302

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 75/179 (41%), Gaps = 16/179 (8%)

Query: 38  NAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI-RGFYLGFTPPLVGWILMDSV 96
           ++V H  DT+K R Q +  E +++  +         +G+ RG Y G+   ++G     +V
Sbjct: 68  DSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 97  MLGCLH--NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQ-- 152
             G       +M+    ++     L       +G L     S +  P E+ K +LQ+Q  
Sbjct: 128 FFGTYEWVKRQMINEWQIHETYSHL------AAGFLGDLFSSVVYVPSEVLKTRLQLQGC 181

Query: 153 ----YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHF-VYWWGSYELLTRW 206
               + ++   Y+G  D ++ I   +G+  L+ G  +TL     F    +  YE   +W
Sbjct: 182 YNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKW 240

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 109/268 (40%), Gaps = 36/268 (13%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           +   V+G  +G + + V  P DT+K RLQ        KG        F N G RG Y G 
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQA-------KGGF------FHNGGYRGIYRGL 52

Query: 84  TPPLVG--------WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
              +V         ++  DS+        R +M ++   +++   +   ++S  L   S 
Sbjct: 53  GSAVVASAPGASLFFVTYDSMK----QQLRPVMGRWT-ASEQLAEVLTHMLSSSLGEMSA 107

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG-IRGLYKGLISTLIFRTHFV 194
             +  P E+ K + Q  +  ++ +    L +I +  + +G +RGLY+G  +T++    F 
Sbjct: 108 CLVRVPAEVIKQRTQTHHTNSSLQ---TLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT 164

Query: 195 -YWWGSYELLTRWFRENTKMSE-AAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
              +  YE L + +    ++   +A                   P DV+K  ++ +++  
Sbjct: 165 CIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRV 224

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVP 280
                 RT    +++ +G   FF+G  P
Sbjct: 225 PMLHLART----LFREEGARVFFRGIGP 248

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 35/184 (19%), Positives = 71/184 (38%), Gaps = 27/184 (14%)

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
           ++SG  AG S   +  PI+  K +LQ +                  +   G RG+Y+GL 
Sbjct: 9   LVSGAAAGTSTDVVFFPIDTLKTRLQAK---------------GGFFHNGGYRGIYRGLG 53

Query: 185 S---------TLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXA 235
           S         +L F T+         ++ RW   + +++E  +                 
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRW-TASEQLAEV-LTHMLSSSLGEMSACLVR 111

Query: 236 YPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXX 295
            P++V+KQ    +   + S ++ R  ++D      + G ++G+  + +R  P        
Sbjct: 112 VPAEVIKQRTQTHHT-NSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPL 170

Query: 296 FEFV 299
           +E++
Sbjct: 171 YEYL 174

>Kwal_27.11419
          Length = 298

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 76/172 (44%), Gaps = 21/172 (12%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
           F+ G   G+    +  PFD +K RLQ  QN++     LD V ++    G    + G  P 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQ--QNKS--SNLLDVV-RSIETPG--QLWKGTLPS 63

Query: 87  LVGWILMDSVMLGCLHNYR-MLMHKYVYPNDEK---------LPLSGCIISGVLAGWSVS 136
            +   +  ++ L  L+  R  +  K V     K         L +   +ISG +   +V 
Sbjct: 64  ALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVG 123

Query: 137 FIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
               PI +    L+V+++ T   YK   +    IY ++GIRGL+ G  +T++
Sbjct: 124 VATMPITV----LKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVM 171

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 254 SFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           ++KS   A   IY+S+GI G F G   + +R  P
Sbjct: 142 NYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

>Kwal_47.18216
          Length = 333

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/316 (19%), Positives = 109/316 (34%), Gaps = 46/316 (14%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQ----TSQNETRFKGPLDCVYKTFRNQGIRGFY 80
           +  VAG  +G+ +    HP DTIKVR+Q      +   R +G +         +G    Y
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVS-FIA 139
            G    ++G I   ++       +R L+          +      ++GV AG + +  + 
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVV 128

Query: 140 PPIELAKAKLQVQYDK------------------------------TTTRYKGPLDVIKK 169
            P+E+ K +LQ Q+ +                               T +Y+  +     
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYV 188

Query: 170 IYSAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRE--NTKMSEAAINXXXXXXX 226
           I   +G R LY+G+  T   + T+    +  Y  L    +E   T M  +          
Sbjct: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248

Query: 227 XXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAV---KDIYQSKGINGFFKGFVPSFL 283
                   A P D +K   L  DK       W   +   + + + +G    +KG  P  +
Sbjct: 249 GALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306

Query: 284 RSFPXXXXXXXXFEFV 299
           R  P        +E +
Sbjct: 307 RVAPGQAVTFTVYELI 322

>Kwal_34.15907
          Length = 312

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 106/256 (41%), Gaps = 28/256 (10%)

Query: 40  VGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG 99
           +G P + IK  +  ++N   F      V   +   G+ GFY G  P    W  +++   G
Sbjct: 35  LGQPLEVIKTTMAANRN-LNFG---QSVKHVWSRGGVFGFYQGLIP----WAWIEASTKG 86

Query: 100 CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA-------PPIELAKAKLQVQ 152
            +  +     +Y +           I+ GV  G + +++          +E+ KAK  V 
Sbjct: 87  AVLLFVSAEAEYQFKRLGLGNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVA 146

Query: 153 YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRENT 211
                + +       K+IYS +GI+G+ KG+ +  I + T++   +G   L+ +  R+ T
Sbjct: 147 GAIPQSSW----SAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFT 202

Query: 212 KMS--EAAINXXXXXXXXXXXXXXXAY--PSDVVKQVVLCNDKYDGSFKSWRT---AVKD 264
             +  +  +                A+  P +V++ V + + K D +     T   A K 
Sbjct: 203 GKTNPDDKLTALEKIFASALGGGLSAWNQPIEVIR-VEMQSKKEDPNRPKKLTVGSAFKY 261

Query: 265 IYQSKGINGFFKGFVP 280
           IYQS GI G ++G  P
Sbjct: 262 IYQSSGIKGLYRGVAP 277

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 76/184 (41%), Gaps = 12/184 (6%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPL-----DCVYKTFRNQGIRGFY 80
           G + GV  GVA+  +   F T    ++ ++ ++   G +         + +  +GI+G  
Sbjct: 111 GIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGIN 170

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN--DEKLPLSGCIISGVLAGWSVSFI 138
            G     +  +       G        +  +      D+KL     I +  L G  +S  
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGG-GLSAW 229

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPL-DVIKKIYSAQGIRGLYKGL---ISTLIFRTHFV 194
             PIE+ + ++Q + +      K  +    K IY + GI+GLY+G+   I   +++T F+
Sbjct: 230 NQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKGLYRGVAPRIGLGVWQTVFM 289

Query: 195 YWWG 198
             +G
Sbjct: 290 VGFG 293

>Scas_645.9
          Length = 391

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 100/274 (36%), Gaps = 27/274 (9%)

Query: 50  RLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMH 109
            L    +  RF G L+   K ++ +GI   + G +  L+  I  + V       Y  L  
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVY---FTGYEYLRD 175

Query: 110 KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQV--QYDKTTTRYKGPLDVI 167
               P     P    ++ G +A    +    P+EL K KLQ   +  K+TT +    +++
Sbjct: 176 N--SPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELL 233

Query: 168 KKIYSAQGIRG----LYKGLISTLIFRTHF-VYWWGSYELLTRWFRENTKMSEAA----I 218
           K+      I G    L+KGL  TL     F   +WGSYE        +T  S +     I
Sbjct: 234 KETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFI 293

Query: 219 NXXXXXXXXXXXXXXXAYPSDVVK---QVVLCNDKYDGSFKSWRTA--------VKDIYQ 267
           N                +P DV K   Q+    +      KS            +++I++
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWK 353

Query: 268 SKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
            +G    + G VP  ++  P        +E   R
Sbjct: 354 LEGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 12/77 (15%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS----QNETRFKGP----LDCVYKTFRN-- 73
           I  F+ G  SG     V HPFD  K R Q S     +++  K P       ++K  RN  
Sbjct: 293 INSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIW 352

Query: 74  --QGIRGFYLGFTPPLV 88
             +G    Y G  P +V
Sbjct: 353 KLEGWGALYTGLVPRMV 369

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 103/279 (36%), Gaps = 47/279 (16%)

Query: 38  NAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR-GFYLGFTPPLVGWILMDSV 96
           ++  H  DT+K R Q + +  ++K  +         +G+R G Y G++            
Sbjct: 70  DSAMHSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYS----------GA 119

Query: 97  MLGCLHNYRMLMHKYVYPNDEKLPLSGC------IISGVLAGWSVSFIAPPIELAKAKLQ 150
           MLG   +  +    Y Y   + +   G       + +G L  +  SF+  P E+ K +LQ
Sbjct: 120 MLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQ 179

Query: 151 VQ------YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI---------FRTHFVY 195
           +Q      + ++   YK   D +  I   +G   L+ G  +TL          F  +  +
Sbjct: 180 LQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKF 239

Query: 196 WWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLC-------- 247
              ++ +  + F E+  +S   I                  P DVVK  +          
Sbjct: 240 RQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITT----PLDVVKTRIQTQLPDIPEN 295

Query: 248 ---NDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFL 283
              N K      S    +  +Y+++G+ G F G  P F+
Sbjct: 296 SSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFI 334

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 71/190 (37%), Gaps = 32/190 (16%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPL-----------DC 66
           NET+S +    AG       + V  P + +K RLQ    + R+  P            D 
Sbjct: 148 NETFSHL---TAGFLGDFISSFVYVPSEVLKTRLQL---QGRYNNPFFRSGYNYKNLTDA 201

Query: 67  VYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPN---DEKLPLSG 123
           V    R +G    + G+   L   +    +       +R L   +   N   DE L LS 
Sbjct: 202 VTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQL--AFAVENKTFDEDLSLSN 259

Query: 124 CIISGVLAGWSVSFIAPPIELAKAKLQVQYD----------KTTTRYKGPLDVIKKIYSA 173
            II+G  AG     I  P+++ K ++Q Q            K  T        +  +Y  
Sbjct: 260 EIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKT 319

Query: 174 QGIRGLYKGL 183
           +G+ GL+ G+
Sbjct: 320 EGLAGLFSGV 329

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 74/175 (42%), Gaps = 13/175 (7%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFK-GPLDCVYKTFRNQGIRGFYLGF 83
           + F+AG  +G     V  PF+ +K+ LQ   + + +  G ++ V + ++ +G+ G + G 
Sbjct: 13  IAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 84  TPPLVGWILMDSVMLGCLH-NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPI 142
               V      +V         + + H       E+L     + +G L G        P+
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 143 ELAKAKLQVQY----------DKTTTRYKGPLDVIKKIYSAQ-GIRGLYKGLIST 186
           +L + +L +Q            K   +  G  +++ K +  + GIRGLY+G+  T
Sbjct: 133 DLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

Query: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130
           F+++G+RG Y G    L+   +  +V L    + +  + ++V P+   L      ++  L
Sbjct: 168 FKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV-PDGMAL----YTLASAL 222

Query: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           +  +V     P ++A  ++   Y      Y+GPLD + K    +G   LYKG ++ L+
Sbjct: 223 SSVAVCIAMNPFDVAMTRM---YHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLL 277

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/289 (20%), Positives = 101/289 (34%), Gaps = 52/289 (17%)

Query: 42  HPFDTIKVRLQTSQNE------TRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDS 95
           +P +T+K RLQ  Q E        + GP   V   +R +G+RG   G        IL++ 
Sbjct: 30  NPIETVKTRLQL-QGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88

Query: 96  VMLGCLHNYRMLMHKYVYPNDEKLPLSGCIIS-----GVLA-----------GWSVSFIA 139
             LG     R               L GC++S     G  A           G   + + 
Sbjct: 89  SRLGLYDPLRA-------------ALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALG 135

Query: 140 PPIELAKAKLQVQYDKTTTRYKGPLD-VIKKIYSAQGIRGLYKGLISTLIFRT------H 192
            P++L K ++Q    +      G +   +  ++  +G+RGLY+G+ + L+ RT       
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALL-RTGVGSAVQ 194

Query: 193 FVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
              +  + E L+R   +   +   A                   P DV   +        
Sbjct: 195 LAVYSHAKEALSRHVPDGMALYTLA------SALSSVAVCIAMNPFDVA--MTRMYHHRG 246

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           G ++     +    + +G +  +KG +   LR  P         E  LR
Sbjct: 247 GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 28  VAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPL 87
           +A   S VA     +PFD    R+   +    ++GPLDC+ KT R +G    Y G    L
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGGL-YRGPLDCLCKTVRQEGFSALYKGHLAQL 276

Query: 88  V 88
           +
Sbjct: 277 L 277

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 113/278 (40%), Gaps = 39/278 (14%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTS--QNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           G  AG+F+ +    V HP D  KVRLQ +     T F+     +     N+G+ G Y G 
Sbjct: 20  GGAAGIFATM----VTHPLDLAKVRLQAAPMPKPTLFR----MLESILANEGVVGLYSGL 71

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDE------KLPLSGCIISGVLAGWSVSF 137
           +  ++      +V  G       L+ + V P ++       LP S  + SG + G + +F
Sbjct: 72  SAAVLRQCTYTTVRFGAYD----LLKENVIPREQLTNMAYLLPCS--MFSGAIGGLAGNF 125

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ-GIRGLYKG----LISTLIFRTH 192
            A  + +               YK  +D + KIY  + G++ L+ G    ++  ++    
Sbjct: 126 -ADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTAS 184

Query: 193 FVYWWGSYELLTRWFRENTKMS-EAAINXXXXXXXXXX--XXXXXAYPSDVVKQVVLCND 249
            V    +Y++   +    TK+  +A+ N                   P+DV+K  ++   
Sbjct: 185 QVV---TYDVFKNYLV--TKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNG- 238

Query: 250 KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
              G  +     + D  + +G +  F+G++PSF R  P
Sbjct: 239 --SGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 74/185 (40%), Gaps = 20/185 (10%)

Query: 124 CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
           C + G++A         P++L K +LQV     T+  +G     +KI + +G + +Y G 
Sbjct: 21  CTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQG----FRKIIANEGWKKVYTGF 76

Query: 184 ISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK 242
            +T + +       +G YE     +  ++ +S                      P + +K
Sbjct: 77  GATFVGYSLQGAGKYGGYEYFKHLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIK 134

Query: 243 ---QVVL---CNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXF 296
              Q  +   CN+  DG    W+   K   +S G+  F+KG VP + R  P        F
Sbjct: 135 VKQQTTMPPFCNNVVDG----WK---KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSF 187

Query: 297 EFVLR 301
           E +++
Sbjct: 188 EKIVQ 192

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 94/247 (38%), Gaps = 24/247 (9%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P D +K RLQ   N   +   L    K   N+G +  Y GF    VG+ L  +   G   
Sbjct: 38  PLDLVKCRLQV--NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95

Query: 103 NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKG 162
            ++ L   ++ P      ++  +++   A +    +  P E  K K Q            
Sbjct: 96  YFKHLYSSWLSPG-----VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNV-- 148

Query: 163 PLDVIKKIYS-AQGIRGLYKGLI---------STLIFRTHFVYWWGSYELLTRWFRENTK 212
            +D  KK+Y+ + G++  YKG++         +   F +        Y +L +   E   
Sbjct: 149 -VDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA 207

Query: 213 MSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGIN 272
           + + +++               ++P+DV+   +    K +   +S   A K IYQ  G  
Sbjct: 208 LQQISVS-FVGGYLAGILCAAVSHPADVMVSKINSERKAN---ESMSVASKRIYQKIGFT 263

Query: 273 GFFKGFV 279
           G + G +
Sbjct: 264 GLWNGLM 270

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 63/149 (42%), Gaps = 10/149 (6%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET-RFKGPLDCVYKTFRNQG 75
           S E       FVAG  +G  +  V +PF+  K RLQ +Q  +   + PL  +Y+T R QG
Sbjct: 4   SREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQG 63

Query: 76  IRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSG--CIISGVLAGW 133
               Y+G    +VG      V        R  +       DE+  LSG   +++G+ AG 
Sbjct: 64  AGALYVGCPAFVVGNTCKAGVRFLGFDALRRALQ------DERGALSGPRGMLAGLGAGL 117

Query: 134 SVSFIA-PPIELAKAKLQVQYDKTTTRYK 161
             S +A  P E  K  L         RY+
Sbjct: 118 LESVLAVTPFEAVKTALIDDRQAARPRYQ 146

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 69/170 (40%), Gaps = 11/170 (6%)

Query: 26  GFVAGVFSGVAKNAVG-HPFDTIKVRLQTSQNETR------FKGPLDCVYKTFRNQGIRG 78
           G +AG+ +G+ ++ +   PF+ +K  L   +   R       +G         R  G+RG
Sbjct: 108 GMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRG 167

Query: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYV-YPNDEKLPLSGCIISGVLAGWSVSF 137
            Y G  P  +      +V  GC    +  + +Y   P D+ L      + G L+G    +
Sbjct: 168 LYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVY 227

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTL 187
              P++  K ++Q        RY   +   + +   +G+R L++G    L
Sbjct: 228 ATMPVDTVKTRMQA---LDAARYGSTVGCFRAVVREEGVRALWRGATPRL 274

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 80/195 (41%), Gaps = 40/195 (20%)

Query: 21  YSRIMGF---VAGVFSGVAKNAVGHPFDTIKVRLQTS---------QNE----------- 57
           + R+ G+   +AG  +G+ ++    PF+ IK  L  S         +N+           
Sbjct: 70  FQRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHK 129

Query: 58  --------TRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMH 109
                    R +  L  V   ++ +G   F  G T  +   I   S+       ++ L+ 
Sbjct: 130 VATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ 189

Query: 110 KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKK 169
                ND+    +  +I+G+   +++  +  PI++ K ++  Q  KT   YK  L+ + +
Sbjct: 190 AR---NDK----ASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKT--EYKNTLNCMYR 240

Query: 170 IYSAQGIRGLYKGLI 184
           I+  +G+   +KG I
Sbjct: 241 IFVQEGMATFWKGSI 255

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 18  NETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIR 77
           N+  S ++  +A  F+ VA   +  P D +K R+ +   +T +K  L+C+Y+ F  +G+ 
Sbjct: 192 NDKASSVITGLATSFTLVA---MTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMA 248

Query: 78  GFYLG 82
            F+ G
Sbjct: 249 TFWKG 253

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 71/163 (43%), Gaps = 16/163 (9%)

Query: 49  VRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF-TPPLVGWILMDSVM----LGCLHN 103
           + L++ Q   ++KG LD + + +  +G+ G Y G  +  + G+I   S      L   H 
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY 120

Query: 104 YRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGP 163
           +R+   K     D +      ++ G++A  +      PI +   + Q     T  +  G 
Sbjct: 121 FRL---KQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQ-----TRGQAAGA 172

Query: 164 LD---VIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203
            D   V +++++  G RG + GL  +L+   +    + +YE L
Sbjct: 173 ADMRTVAREVHAENGWRGFWAGLKVSLVLTVNPSITYATYERL 215

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 59/135 (43%), Gaps = 7/135 (5%)

Query: 155 KTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI--FRTHFVYWWGSYELLTRWFR-ENT 211
           +   +YKG LD +++IY A+G+ GLY+GL S+ +  F   F Y++    +   +FR +  
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQA 126

Query: 212 KMSEAAINXXXXXXXXXXXXXXXAY---PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQS 268
           +  +A  +                    P +VV        +  G+    RT  ++++  
Sbjct: 127 RGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGA-ADMRTVAREVHAE 185

Query: 269 KGINGFFKGFVPSFL 283
            G  GF+ G   S +
Sbjct: 186 NGWRGFWAGLKVSLV 200

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 64/166 (38%), Gaps = 15/166 (9%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           ++G VA   S +  N    P + +  R QT               +     G RGF+ G 
Sbjct: 140 VLGIVAAATSQLFVN----PINVVATRQQTRGQAAGAADMRTVAREVHAENGWRGFWAGL 195

Query: 84  TPPLVGWILMDSVMLGCLHNYRMLM------HKYVYPNDEKLPLSGCIISGVLAGWSVSF 137
              LV   +  S+        R  +        ++  +   L      + GVL+    + 
Sbjct: 196 KVSLV-LTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVLSKIVSTV 254

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
           +  P+ +AKA LQ    ++ + ++    V+  +YS +G   L+KGL
Sbjct: 255 LTQPLIIAKASLQ----RSGSCFQDFHQVLHHLYSTEGPLSLWKGL 296

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
           FV+ +F   A   V  P D IK R+Q+   E+   G    V  T +N+G   F+ G TP 
Sbjct: 212 FVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESG-FTIVKNTLKNEGATAFFKGLTPK 270

Query: 87  LV 88
           L+
Sbjct: 271 LL 272

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +   +    S +S  T VK+  +++G   FFKG  P  L + P
Sbjct: 228 PLDVIKTRIQSRNFE--SAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGP 276

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI 76
           +NE ++ ++G +    S  A      P D IK R+Q   +   ++  ++C Y+ F  +G 
Sbjct: 232 NNEYFATLLGLI----SSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGF 287

Query: 77  RGFYLGFTPPLVGWILMDSVMLG 99
              + G+ P L+   L  SV  G
Sbjct: 288 AMLWKGWLPRLMKVGLSGSVSFG 310

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 70/180 (38%), Gaps = 19/180 (10%)

Query: 15  LISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQ 74
           +  N+    +    AG  SG+    + +PF+ +K  LQ  +N    K P + +       
Sbjct: 1   MTQNKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVAAK-PFEVL-----GY 54

Query: 75  GIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGC--IISGVLAG 132
            +R ++ G +   +G ++  S+           +       D   PLSG   +++G L G
Sbjct: 55  QVRTYFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDA--PLSGVQLLMAGALTG 112

Query: 133 WSVSFIAPPIELAKAKL-------QVQYDKTTTRYKGPL--DVIKKIYSAQGIRGLYKGL 183
              S    P E  K  +         + + TT+  +G +  +V K  +    +R  Y+ L
Sbjct: 113 TMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEAL 172

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 99/254 (38%), Gaps = 24/254 (9%)

Query: 40  VGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG 99
           +G P +  K    T+    R  G    V   +   G+ GFY G  P    W  +++   G
Sbjct: 34  LGQPLEVTK----TTMAANRQFGFSQAVRHVWSRGGVFGFYQGLIP----WAWIEASTKG 85

Query: 100 CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTR 159
            +  +     +Y +           I+ GV  G + +++          +++   K  + 
Sbjct: 86  AVLLFVSAEAEYQFRRLGLSNFGAGILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASA 145

Query: 160 YKGP----LDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWF-----REN 210
              P    L V K+I++A+G+RG+ KG+ +  I +   +  WGS   L+R       R  
Sbjct: 146 PGVPVPSSLQVFKQIFAAEGLRGINKGVNAVAIRQ---MTNWGSRFGLSRLVEDGIRRVT 202

Query: 211 TKMSEAAINXXXXXXXXXXXXXXXAY--PSDVVKQVVL--CNDKYDGSFKSWRTAVKDIY 266
            K S+  ++               A+  P +V++  +    ND       +     + IY
Sbjct: 203 HKRSDEKLSAMEKIVASALGGGLSAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIY 262

Query: 267 QSKGINGFFKGFVP 280
           ++ G+ G ++G  P
Sbjct: 263 ENNGLRGLYRGVTP 276

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR---- 72
           S+E  S +   VA    G   +A   P + I+V +Q+  N+      L  V KTFR    
Sbjct: 206 SDEKLSAMEKIVASALGG-GLSAWNQPIEVIRVEMQSRTNDPNRPKNL-TVGKTFRYIYE 263

Query: 73  NQGIRGFYLGFTP 85
           N G+RG Y G TP
Sbjct: 264 NNGLRGLYRGVTP 276

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 77/187 (41%), Gaps = 18/187 (9%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETR------FKGPLDCVYKTFRNQGIRGF 79
           G + GV  GVA+  +   F T    ++ ++++            L    + F  +G+RG 
Sbjct: 110 GILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGI 169

Query: 80  YLGFTP----PLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
             G        +  W     +        R + HK    +DEKL     I++  L G  +
Sbjct: 170 NKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKR---SDEKLSAMEKIVASALGG-GL 225

Query: 136 SFIAPPIELAKAKLQVQY-DKTTTRYKGPLDVIKKIYSAQGIRGLYKGL---ISTLIFRT 191
           S    PIE+ + ++Q +  D    +        + IY   G+RGLY+G+   I   +++T
Sbjct: 226 SAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRIGLGVWQT 285

Query: 192 HFVYWWG 198
            F+  +G
Sbjct: 286 IFMVGFG 292

>Scas_702.10
          Length = 302

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 109/275 (39%), Gaps = 32/275 (11%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
           G  AG+F+ V    + HP D  KVRLQ +       G +  +    RN+ + G Y G + 
Sbjct: 16  GGAAGIFACV----MTHPLDLAKVRLQAAPLPKPTLGRM--LTTILRNENVMGLYSGLSA 69

Query: 86  PLVGWILMDSVMLGCLHNYRMLMHKYVYP----NDEKLPLSGCIISGVLAGWSVSFIAPP 141
            ++      +V  G       LM + + P    ND    L   + SG + G   +F A  
Sbjct: 70  AVLRQCTYTTVRFGAYD----LMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNF-ADV 124

Query: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ-GIRGLYKG----LISTLIFRTHFVYW 196
           + +          +    Y+  +D + KIY  + GI+ L  G    ++  ++     V  
Sbjct: 125 VNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVT 184

Query: 197 WGSYE--LLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKY--D 252
           +  ++  L+T+   +  K S                      P+DV+K  ++   K   +
Sbjct: 185 YDVFKNYLVTKLSFDPKKNS----THLSASLLAGLVATTICSPADVIKTRIMNAHKTESE 240

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
            + K   +A+K     +G +  F+G++P F R  P
Sbjct: 241 SAIKILTSAIK----KEGPSFMFRGWLPIFTRLGP 271

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 64/162 (39%), Gaps = 10/162 (6%)

Query: 27  FVAGVFSGVAKNAVGH----PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLG 82
           + A    GV      H    P D +K RLQ   N   ++  LD      R++G+   + G
Sbjct: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQV--NPQLYRSNLDGWKTIVRSEGLSKVFTG 72

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPI 142
                +G+ L  +   G    ++      + P       +   +    A  S  F+A  +
Sbjct: 73  VGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC---ASASAEFLADIL 129

Query: 143 ELAKAKLQVQYDKTTTRY-KGPLDVIKKIYSAQGIRGLYKGL 183
                 ++V+   T   + K  L+   KI +A+G+ GLYKG+
Sbjct: 130 LCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGI 171

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 72/190 (37%), Gaps = 21/190 (11%)

Query: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181
           + C + GV+A         P++L K +LQV        Y+  LD  K I  ++G+  ++ 
Sbjct: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFT 71

Query: 182 GLISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDV 240
           G+ +T I +       +G YE   + +  N    E A                 +  ++ 
Sbjct: 72  GVGATFIGYSLQGACKYGGYEYFKQTY-SNLLSPETA------HRHRTAVYLCASASAEF 124

Query: 241 VKQVVLC---------NDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXX 291
           +  ++LC                 K++      I  ++G++G +KG  P + R  P    
Sbjct: 125 LADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMC 184

Query: 292 XXXXFEFVLR 301
               FE ++ 
Sbjct: 185 KFTSFERIVE 194

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 76/178 (42%), Gaps = 12/178 (6%)

Query: 13  NSLISNETYSRIMGFVAGVFSGVAK---NAVGHPFDTIKVRLQTSQNETRFKGPLDCVYK 69
           ++L+S ET  R    V    S  A+   + +  P++ IKV+ QT+      K  L+   K
Sbjct: 99  SNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT-IPPFCKNFLEGWSK 157

Query: 70  TFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCI---- 125
               +G+ G Y G TP     I               +++  +  + +++  S  I    
Sbjct: 158 ITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSF 217

Query: 126 ISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183
           + G LAG   + ++ P ++  +K+     +  +     ++  K+IYS  G  GL+ GL
Sbjct: 218 VGGYLAGILCAVVSHPADVMVSKVNADRKQGESM----VEASKRIYSRIGFGGLWNGL 271

>Scas_562.12
          Length = 300

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 19  ETYSRI---MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQG 75
           E YS+      F++ +        V  P D IK R+Q    +    G L  V  TF+N+G
Sbjct: 203 EDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETG-LTIVKNTFKNEG 261

Query: 76  IRGFYLGFTPPLV 88
           I  F+ G TP L+
Sbjct: 262 ITAFFKGLTPKLL 274

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 75/180 (41%), Gaps = 18/180 (10%)

Query: 13  NSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFR 72
           +S    +T   +    AG   G+ +  V  P D +K++ QT  N   FKG      K  +
Sbjct: 109 DSAFGEKTGKAMRSATAGSLIGIGE-IVLLPLDVLKIKRQT--NPEAFKG--RGFVKILK 163

Query: 73  NQGIRGFYLGFTPPLVGWILMDSVMLG-CLHNYRMLMHKYVYPNDE--KLPLSGCIISGV 129
           ++GI   Y G+     GW    +      L        +Y+   ++  +   S   IS +
Sbjct: 164 DEGIFNLYRGW-----GWTAARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSI 218

Query: 130 LAGWSVSFIAPPIELAKAKLQVQ-YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           +       ++ P+++ K ++Q + +D   T     L ++K  +  +GI   +KGL   L+
Sbjct: 219 VGASCSLIVSAPLDVIKTRIQNRSFDNPET----GLTIVKNTFKNEGITAFFKGLTPKLL 274

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +  N  +D   ++  T VK+ ++++GI  FFKG  P  L + P
Sbjct: 230 PLDVIKTRI-QNRSFDNP-ETGLTIVKNTFKNEGITAFFKGLTPKLLTTGP 278

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 97/265 (36%), Gaps = 31/265 (11%)

Query: 59  RFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK 118
           R +G L+ + K  + +G+   + G    LV  +  + V       Y  L      P   +
Sbjct: 79  RLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNS--PLASR 133

Query: 119 LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQ-VQYDKTTTR----YKGPLDVIKKIYSA 173
           LP++  ++ G  A    +    P+EL + +LQ V   + T R        L  ++   S 
Sbjct: 134 LPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSV 193

Query: 174 QGIRGLYKGLISTLIFRTHF-VYWWGSYELLTRWFRENTKMSEAA------INXXXXXXX 226
            G R L+KGL  TL     F   +WG+YE     F      +  A      I        
Sbjct: 194 MGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSM 253

Query: 227 XXXXXXXXAYPSDVVK---QVVLCN----------DKYDGSFKSWRTAVKDIYQSKGING 273
                    +P DV K   Q+ + +           K D S +   + +  I +S+GI  
Sbjct: 254 GGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDS-RGMFSFLNAIRKSEGIRA 312

Query: 274 FFKGFVPSFLRSFPXXXXXXXXFEF 298
            + G +P  ++  P        +E 
Sbjct: 313 LYTGLLPRVMKIAPSCAIMISTYEL 337

>Kwal_23.4354
          Length = 343

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 12  VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-TSQNETRFKGPLDCVYKT 70
           VNS  SN  +  +  FV G F G     + HPFD  K R+Q T  N T  K P   ++K 
Sbjct: 241 VNSSNSNWNHF-VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKY 299

Query: 71  F----RNQGIRGFYLGFTPPLV 88
                +++G+   Y G  P ++
Sbjct: 300 LNQMRKSEGLAALYTGLVPRVI 321

 Score = 31.2 bits (69), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 107/279 (38%), Gaps = 40/279 (14%)

Query: 49  VRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVML---GCLHNYR 105
           VR +TS    R+    D   K  + +G++  + G +  L+     + V       L +  
Sbjct: 75  VRCKTS--PVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKS 132

Query: 106 MLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQV--QYDKTTTRYKGP 163
            L  KY   N    PL    ++ VLA  +V+    P+EL + +LQ   +    +T     
Sbjct: 133 RLQDKYPTLN----PLMCGALARVLAATTVA----PLELFRTRLQSIPRSSPKSTTAMMI 184

Query: 164 LDVIKKI---YSAQGIRGLYKGLISTLIFRTHF-VYWWGSYELLTRWFRENTKM-SEAAI 218
            D+IK+     S  G + L++GL  TL     F   +WG YE    +++ N  + SE +I
Sbjct: 185 KDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYE----FYKSNVSIDSEKSI 240

Query: 219 ------------NXXXXXXXXXXXXXXXAYPSDVVK---QVVLCNDKYDGS-FKSWRTAV 262
                       N                +P DV K   Q+   N   +    K+    +
Sbjct: 241 VNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYL 300

Query: 263 KDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
             + +S+G+   + G VP  ++  P        +E   R
Sbjct: 301 NQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKR 339

>Kwal_27.11626
          Length = 299

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI 76
           S+ T+S+   FV+ +    A   V  P D IK R+Q    +    G    V  T +N+GI
Sbjct: 204 SSATWSQ--NFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESG-FRIVQNTLKNEGI 260

Query: 77  RGFYLGFTPPLV 88
             F+ G TP L+
Sbjct: 261 TAFFKGLTPKLL 272

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +  N  +D     +R  V++  +++GI  FFKG  P  L + P
Sbjct: 228 PLDVIKTRI-QNRHFDNPESGFRI-VQNTLKNEGITAFFKGLTPKLLTTGP 276

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 96/268 (35%), Gaps = 34/268 (12%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           I   V+G  +G + +    P DT+K RLQ        KG        F N G +G Y G 
Sbjct: 7   IASLVSGAAAGTSTDLAFFPIDTLKTRLQA-------KGGF------FANGGYKGVYRGL 53

Query: 84  TPPLVG--------WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
              +V         ++  DS+          L+ K     D+       ++S      S 
Sbjct: 54  GSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPK---GEDQTADTLSHMVSSSFGEISA 110

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGI-RGLYKGLISTLIFRTHFV 194
             +  P E+ K + Q     ++ +    L  + +  + +G+ R LY+G  +T++    F 
Sbjct: 111 CMVRVPAEVIKQRTQTHRTNSSLQ---TLQALLRNENGEGLRRNLYRGWSTTIMREIPFT 167

Query: 195 -YWWGSYELL-TRWFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
              +  YE +  RW     K   A                    P DV+K  ++ + K  
Sbjct: 168 CIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSV 227

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVP 280
            +        K + Q +G+  FF G  P
Sbjct: 228 SALH----LAKTMLQEEGVKVFFSGVGP 251

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/258 (19%), Positives = 96/258 (37%), Gaps = 33/258 (12%)

Query: 40  VGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG 99
           +G P + +K  +  ++  T F+     +   +   G+ GFY G  P    W  +++   G
Sbjct: 32  LGQPLEVVKTTMAANRQFTFFQ----AINHIWSRGGVFGFYQGLIP----WAWIEASTKG 83

Query: 100 CLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA-------PPIELAKAKLQVQ 152
            +  +     +Y +           I+ GV  G + +++          +E+ K K    
Sbjct: 84  AVLLFVSAEAEYHFKKLGLNNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAA 143

Query: 153 YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTK 212
             K ++         K+IY+ +GIRG+ KG+ +  I +   +  WGS    +R   E  +
Sbjct: 144 GAKQSS-----WAAFKEIYNKEGIRGINKGVNAVAIRQ---MTNWGSRFGFSRLVEEGLR 195

Query: 213 MSEAAINXXXXXXXXXXXXXXX--------AYPSDVVKQVVL--CNDKYDGSFKSWRTAV 262
                 N                         P +V++  +    ND       +   A 
Sbjct: 196 KFTGKTNPDDKLTALEKIFASAIGGGLSAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAF 255

Query: 263 KDIYQSKGINGFFKGFVP 280
           + IYQS G+ G ++G  P
Sbjct: 256 RYIYQSNGVKGLYRGVTP 273

 Score = 34.3 bits (77), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 78/187 (41%), Gaps = 27/187 (14%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRN----QGIRGFYL 81
           G + GV  GVA+  +   F T    ++ +++++   G     +  F+     +GIRG   
Sbjct: 108 GIMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGIRGINK 167

Query: 82  GFTPPLVGWILMDSVMLGCLHNYRMLMHKYV---YPNDEKLPLS---GCIISGVLAGWSV 135
           G     +  +       G        + K+     P+D+   L       I G L+ W+ 
Sbjct: 168 GVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAWN- 226

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVI-----KKIYSAQGIRGLYKGL---ISTL 187
                PIE+ + ++Q + +        P D+      + IY + G++GLY+G+   I   
Sbjct: 227 ----QPIEVIRVEMQSKTNDPNR----PKDLTVGKAFRYIYQSNGVKGLYRGVTPRIGLG 278

Query: 188 IFRTHFV 194
           I++T F+
Sbjct: 279 IWQTVFM 285

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 42  HPFDTIKVRLQTSQNETRFKGPLD-CVYKTFR----NQGIRGFYLGFTPPLVGWILMDSV 96
            P + I+V +Q+  N+     P D  V K FR    + G++G Y G TP +   I     
Sbjct: 227 QPIEVIRVEMQSKTNDPNR--PKDLTVGKAFRYIYQSNGVKGLYRGVTPRIGLGIWQTVF 284

Query: 97  MLGCLHNYRMLMHK 110
           M+GC    R  + K
Sbjct: 285 MVGCGDIAREFVGK 298

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI 76
           S  T+S+   F++ +    +   V  P D IK R+Q    +    G L  V  T +N+G+
Sbjct: 206 SQATWSQ--NFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESG-LRIVKNTLKNEGV 262

Query: 77  RGFYLGFTPPLV 88
             F+ G TP L+
Sbjct: 263 TAFFKGLTPKLL 274

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +  N  +D      R  VK+  +++G+  FFKG  P  L + P
Sbjct: 230 PLDVIKTRI-QNRNFDNPESGLRI-VKNTLKNEGVTAFFKGLTPKLLTTGP 278

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI 76
           S  T+S+   FV+ +    A   +  P D IK R+Q    E    G    V  T +N+G 
Sbjct: 204 SQATWSQ--NFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESG-FTIVKNTLKNEGF 260

Query: 77  RGFYLGFTPPLV 88
             F+ G TP L+
Sbjct: 261 SAFFKGLTPKLL 272

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +  N  ++   +S  T VK+  +++G + FFKG  P  L + P
Sbjct: 228 PLDVIKTRI-QNKNFENP-ESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ----TSQNETRFKGPLDCVYKTFRNQGIRGFYLG 82
            +AG  +G+A     +PF+ I+ RLQ    T+  E +F    +     F  +G RGF++G
Sbjct: 294 LLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVG 353

Query: 83  FTPPLVGWILMDSVMLGC 100
            +   +G+I + + M+ C
Sbjct: 354 LS---IGYIKV-TPMVAC 367

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 61/159 (38%), Gaps = 13/159 (8%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE-----TRFKGPLDCVYKTFRNQGIRGFY 80
           G   GV    AK  +  P D IK+  QTS          F+G L+     +    +RG +
Sbjct: 57  GLAGGVAGSCAKTLIA-PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAP 140
            G +  L+      +V        R +    + P+ E       + SG LAG    F   
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNV----IIPSKEYETHFRRLCSGSLAGLCSVFCTY 171

Query: 141 PIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGL 179
           P++L + +L    +    R   PL  +K+IYS      L
Sbjct: 172 PLDLIRVRLAYVTEHHKVRV-WPL--VKQIYSEPASEAL 207

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 90/228 (39%), Gaps = 50/228 (21%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ--TSQNETRFKGPLDCVYKTFRNQ 74
           S E  +      +G  +G+      +P D I+VRL   T  ++ R    +  +Y    ++
Sbjct: 146 SKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASE 205

Query: 75  GIRG-------------FYLGFTPPLVGWILMDSVMLGCLHN--YRMLMHKYVYP----- 114
            +               FY G+ P ++G I    V     H+  + +L H  + P     
Sbjct: 206 ALSSKAYVPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFA-HDLFHDILRHPVIAPYSVLR 264

Query: 115 -----------------NDEKLPLS--GCIISGVLAGWSVSFIAPPIELAKAKLQVQY-- 153
                              +++PL+    +++G LAG +    A P E+ + +LQV    
Sbjct: 265 VDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVT 324

Query: 154 DKTTTRYKGPLDVIKKIYSAQGIRGLYKGL------ISTLIFRTHFVY 195
           +    ++    ++ K I+  +G RG + GL      ++ ++  + FVY
Sbjct: 325 NPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVY 372

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 93/269 (34%), Gaps = 25/269 (9%)

Query: 50  RLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMH 109
            L    +  +F G L+   K    +GI   + G +  L+  I  + V        R    
Sbjct: 92  ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR---- 147

Query: 110 KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQV--QYDKTTTRYKGPLDVI 167
             V P     P    +  G +A    +    P+EL K KLQ   +  K+T  +    D++
Sbjct: 148 -DVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLL 206

Query: 168 KKIYSAQGI----RGLYKGLISTLIFRTHF-VYWWGSYELLTR--WFRENTKMSEAA--- 217
            +      +    R L+KGL  TL     F   +W SYEL     W       S+ A   
Sbjct: 207 NETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWV 266

Query: 218 --INXXXXXXXXXXXXXXXAYPSDVVK---QVVLCNDKYDGSFKSWRTAVK---DIYQSK 269
             IN                +P DV K   Q+ + N+         R   K    I++++
Sbjct: 267 HFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTE 326

Query: 270 GINGFFKGFVPSFLRSFPXXXXXXXXFEF 298
           G+   + G     ++  P        +E 
Sbjct: 327 GLAALYTGLAARVIKIRPSCAIMISSYEI 355

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 28/72 (38%), Gaps = 7/72 (9%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS-------QNETRFKGPLDCVYKTFRNQGI 76
           I  F +G  SG+      HPFD  K R Q S       +   R +     +   +R +G+
Sbjct: 269 INSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGL 328

Query: 77  RGFYLGFTPPLV 88
              Y G    ++
Sbjct: 329 AALYTGLAARVI 340

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 71/172 (41%), Gaps = 23/172 (13%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRN-QGIRGFYLG 82
           I GF  G+ S +    +  PFD +K RLQ  +  T        ++KT ++ +     + G
Sbjct: 12  IGGFSGGLVSAI----ILQPFDLLKTRLQQDKTST--------LWKTLKSIETPSQLWRG 59

Query: 83  FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDE------KLPLSGCIISGVLAGWSVS 136
             P  +   +  ++ L  L++ R  + K             +L +   + SG +      
Sbjct: 60  ALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTG 119

Query: 137 FIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
            I  PI + K    V+Y+ T  +Y         I+  +G+RG ++G  +T +
Sbjct: 120 LITMPITVIK----VRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATAL 167

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 69/176 (39%), Gaps = 10/176 (5%)

Query: 116 DEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYS-AQ 174
            E+   +  +I G   G   + I  P +L K +LQ   DKT+T +K     +K I + +Q
Sbjct: 2   SEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQ--QDKTSTLWK----TLKSIETPSQ 55

Query: 175 GIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINXXXXXXXXXXXXXXX 234
             RG     I T +    ++    S        +       + +                
Sbjct: 56  LWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTR 115

Query: 235 AYPSDVVKQVVLCNDKYDGS---FKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           A    +   + +   +Y+ +   + S R A   I++++G+ GFF+GF  + LR  P
Sbjct: 116 ALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAP 171

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 102/265 (38%), Gaps = 30/265 (11%)

Query: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFT 84
           +  ++G  +G + + V  P DTIK RLQ        KG        F N G +G Y G  
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQA-------KGGF------FANGGYKGIYRGLG 52

Query: 85  PPLVGWILMDSVMLGCLHNYRMLMHK------YVYPNDEKLPLSGCIISGVLAGWSVSFI 138
             +V      S+     ++Y  +  +      Y   +++ +  +  ++S  +       +
Sbjct: 53  SAVVASAPGASLFF-ISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLV 111

Query: 139 APPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIR-GLYKGLISTLIFRTHFV-YW 196
             P E+ K + QV    ++ +    L  I +  + +G+R  LY+G  +T++    F    
Sbjct: 112 RVPAEVVKQRTQVHSTNSSWQ---TLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQ 168

Query: 197 WGSYELLTR-WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYDGSF 255
           +  YE L + W + N +                        P D +K  ++ N     + 
Sbjct: 169 FPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNK----TT 224

Query: 256 KSWRTAVKDIYQSKGINGFFKGFVP 280
            S  + +  IY+ +G   FF G  P
Sbjct: 225 ASLGSVIIRIYREEGPAVFFSGVGP 249

>Scas_558.2
          Length = 289

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 55/268 (20%), Positives = 102/268 (38%), Gaps = 30/268 (11%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           +M  ++G  +G + + V  P DT+K RLQ        KG        F+N G  G Y G 
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQA-------KGGF------FQNGGYHGIYRGL 53

Query: 84  TPPLVG--------WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
              +V         ++  DS+ +    +   +++     +   +     +I+  +   + 
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAA 113

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFV- 194
             +  P E+ K + QV    T + ++    ++K       IR LY+G  +T++    F  
Sbjct: 114 CLVRVPAEVIKQRTQVH--STNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTC 171

Query: 195 YWWGSYELLTR-W-FRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKYD 252
             +  YE + + W   +N                          P D +K  ++ N K  
Sbjct: 172 IQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-KDS 230

Query: 253 GSFKSWRTAVKDIYQSKGINGFFKGFVP 280
              KS    +++IY+ +G   FF G  P
Sbjct: 231 IPIKSL---IRNIYKEEGFKIFFSGIYP 255

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/187 (19%), Positives = 70/187 (37%), Gaps = 28/187 (14%)

Query: 125 IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
           ++SG  AG S   +  PI+  K +LQ +                  +   G  G+Y+GL 
Sbjct: 10  LLSGAAAGTSTDLVFFPIDTLKTRLQAK---------------GGFFQNGGYHGIYRGLG 54

Query: 185 STLIFR----THFVYWWGSYELLTRWFRENTKMSEAA--------INXXXXXXXXXXXXX 232
           S ++      + F   + S ++  R   E    S           I              
Sbjct: 55  SAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAAC 114

Query: 233 XXAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXX 292
               P++V+KQ    +   + S++++RT +K+  Q   I   ++G+  + +R  P     
Sbjct: 115 LVRVPAEVIKQRTQVHST-NSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQ 173

Query: 293 XXXFEFV 299
              +EF+
Sbjct: 174 FPLYEFM 180

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTP 85
           G + G  +G    A   P D +K RL  +++    K  +  +YK    +G + F+ G  P
Sbjct: 199 GAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIPIKSLIRNIYK---EEGFKIFFSGIYP 255

Query: 86  PLVGWI 91
             + WI
Sbjct: 256 RTM-WI 260

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 98/269 (36%), Gaps = 38/269 (14%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83
           ++  ++G  +G + + V  P DT+K RLQ        KG        FRN G RG Y G 
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQA-------KGGF------FRNGGYRGVYRGL 52

Query: 84  TPPLVG--------WILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135
              +V         +I  D+        +R L+     P+     +   + S  +   + 
Sbjct: 53  GSAVVASAPGASLFFITYDTCKAETRGFFRGLL-----PSSNVADVVTHMFSSSMGEIAA 107

Query: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGI-RGLYKGLISTLIFRTHFV 194
             +  P E+ K + Q     ++      L  I K  + +G+ R LY+G  +T++    F 
Sbjct: 108 CMVRVPAEVVKQRSQTHASHSSWE---TLREILKNENGEGVRRNLYRGWSTTIMREIPFT 164

Query: 195 -YWWGSYELLTR-WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVK-QVVLCNDKY 251
              +  YE + + W   +                          P D +K +++LC    
Sbjct: 165 CIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSI 224

Query: 252 DGSFKSWRTAVKDIYQSKGINGFFKGFVP 280
                   T V  IY+ +G   FF G  P
Sbjct: 225 P-----LGTLVSTIYKEEGFKVFFSGVGP 248

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 17  SNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGI 76
           S  T+S+   F++ +    A   V  P D IK R+Q    +    G    V  T +N+G 
Sbjct: 206 SQATWSQ--NFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG-FKIVKNTLKNEGF 262

Query: 77  RGFYLGFTPPLV 88
             F+ G TP L+
Sbjct: 263 TAFFKGLTPKLL 274

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +  N  +D     ++  VK+  +++G   FFKG  P  L + P
Sbjct: 230 PLDVIKTRI-QNRNFDNPESGFKI-VKNTLKNEGFTAFFKGLTPKLLTTGP 278

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 96/256 (37%), Gaps = 27/256 (10%)

Query: 40  VGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLG 99
           +G P + +K  +  +  E  F   L      +   GI GFY G  P    W  +++   G
Sbjct: 29  LGQPLEVVKTTM-AAHREFNF---LQATKHVWSRGGIFGFYQGLIP----WAWIEASTKG 80

Query: 100 CLHNYRMLMHKYVYP----NDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDK 155
            +  +     +Y +     N+    + G I  GV   +        ++  +   Q   + 
Sbjct: 81  AVLLFVSAEAEYRFKVLGLNNFGAGIMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANV 140

Query: 156 TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKM-- 213
                +    V K IY  +GIRG+ KG+ +  I +   +  WGS   L+R   +  +   
Sbjct: 141 PGVIPQSSWQVFKSIYKKEGIRGINKGVNAVAIRQ---MTNWGSRFGLSRLVEDGIRKLT 197

Query: 214 ----SEAAINXXXXXXXXXXXXXXXAY--PSDVVKQVVLCNDKYDGSFKSWRTAVKD--- 264
                +  +                A+  P +V++ V + + K D +     T  K    
Sbjct: 198 GKTGKDDKLTALEKIMASAIGGGLSAWNQPIEVIR-VEMQSKKEDPNRPKNLTVGKTFKY 256

Query: 265 IYQSKGINGFFKGFVP 280
           IYQS G+ G ++G  P
Sbjct: 257 IYQSNGLKGLYRGVTP 272

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 1/62 (1%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPP 86
           FV+ +    A   V  P D IK R+Q    +    G    +  T +N+G   F+ G TP 
Sbjct: 213 FVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESG-FKIIKNTLKNEGFTAFFKGLTPK 271

Query: 87  LV 88
           L+
Sbjct: 272 LL 273

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 237 PSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287
           P DV+K  +  N  +D     ++  +K+  +++G   FFKG  P  L + P
Sbjct: 229 PLDVIKTRI-QNRNFDNPESGFKI-IKNTLKNEGFTAFFKGLTPKLLTTGP 277

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 64/167 (38%), Gaps = 31/167 (18%)

Query: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKG--PLDCVYKTFRNQGIRGFYLGFT 84
            + G F G+       P D +K R+Q  +  T +K    +D   + +R         G  
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEIDSPLQLWR---------GTL 64

Query: 85  PPLVGWILMDSVMLGCLHNYRMLMHK-------------YVYPNDEKLP---LSGCIISG 128
           P  +   +  ++ L CL+  R  + K              VY     LP   +   +++G
Sbjct: 65  PSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTG 124

Query: 129 VLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQG 175
             A   V +I  PI + K    V+Y+ T   Y    + I  IY+ +G
Sbjct: 125 AFARGLVGYITMPITVIK----VRYESTLYNYSSLKEAITHIYTKEG 167

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 33.1 bits (74), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 11 PVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQT---SQNET--RFKGPLD 65
          PV        Y   MG ++G   GVA+  V +PFD ++ R Q      NE   R+K   D
Sbjct: 2  PVTDPNLANLYKLAMGAISG---GVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSD 57

Query: 66 CVYKTFRNQGIRGFYLGFTPPL 87
           +    + +G +G+Y G T  L
Sbjct: 58 ALITIGKTEGPKGYYKGLTANL 79

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 128 GVLAGWSVSFIAPPIELAKAKLQVQY---DKTTTRYKGPLDVIKKIYSAQGIRGLYKGLI 184
           G ++G     +  P +L + + QV     ++   RYK   D +  I   +G +G YKGL 
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLT 76

Query: 185 STL 187
           + L
Sbjct: 77  ANL 79

>Scas_696.9
          Length = 312

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 109/253 (43%), Gaps = 20/253 (7%)

Query: 39  AVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVML 98
           ++G P + +K  +  ++N   F   +  V+      GI GFY G  P    W  +++   
Sbjct: 34  SLGQPLEVVKTTMAANRN-LNFVNSMKYVWS---RGGIVGFYQGLIP----WAWIEASTK 85

Query: 99  GCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTT 158
           G +  +     +Y +        +  I+ GVL G + S++          +++   K+ +
Sbjct: 86  GAVLLFVSAESEYRFKLLGMGNFTSGILGGVLGGVTQSYLTMGFCTCMKTVEITRLKSAS 145

Query: 159 R---YKGPLDVIKKIYSAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRENTKMS 214
                +   +V + IY+ +G+RG+YKG+ +  I + T++   +G   L+  W R+ T  +
Sbjct: 146 AGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKT 205

Query: 215 --EAAINXXXXXXXXXXXXXXXAY--PSDVVKQVVLCNDKYDGSFKSWRTAVKD---IYQ 267
             E  +N               A+  P +V++ V + + K D +     T  K    I +
Sbjct: 206 KPEDRLNAWEKIGATAVGGGLSAWNQPIEVIR-VEMQSKKEDPNRPKNLTVAKTFKYIMK 264

Query: 268 SKGINGFFKGFVP 280
           + G+ G ++G  P
Sbjct: 265 TNGVKGLYRGVTP 277

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 97/274 (35%), Gaps = 42/274 (15%)

Query: 59  RFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEK 118
           +F G L+   K  + +G+   + G +  L+  I  + V              Y Y  D  
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYF----------TGYEYVRDRS 158

Query: 119 LPLSGC------IISGVLAGWSVSFIAPPIELAKAKLQ-----VQYDKTTTRYKGPLDVI 167
            PL+G       +I G  A    +    P+EL K KLQ        + +   Y+   + I
Sbjct: 159 -PLNGLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEI 217

Query: 168 KKIYSAQGI-RGLYKGLISTLIFRTHF-VYWWGSYE--------LLTRWFRENTKMSEAA 217
           K   + +G+ + ++KGL  TL     F   +W SYE        L    F +N+      
Sbjct: 218 KSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHF 277

Query: 218 INXXXXXXXXXXXXXXXAYPSDVVK---QVVLCNDKYD-------GSFKSWRTAVKDIYQ 267
            N                +P DV K   Q+ L  DK         GS  +    +  I +
Sbjct: 278 TNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRK 337

Query: 268 SKGINGFFKGFVPSFLRSFPXXXXXXXXFEFVLR 301
           ++GI   + G  P   +  P        +E   R
Sbjct: 338 TEGIGALYTGLAPRVAKIAPSCAIMISSYELTKR 371

>Sklu_1982.3 YDL238C, Contig c1982 3793-5223
          Length = 476

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 251 YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRS 285
           YD S K W   V D ++ +G   FF GFV + + +
Sbjct: 60  YDASLKPWEIGVVDTFREQGSTFFFPGFVDTHVHA 94

>Kwal_23.5757
          Length = 307

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 61/164 (37%), Gaps = 9/164 (5%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P++ IKVR QT+      +   D   K    +G    Y G TP     I           
Sbjct: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFE 195

Query: 103 N-YRMLMHKYVYPNDEKLPLSGCIIS---GVLAGWSVSFIAPPIELAKAKLQVQYDKTTT 158
               M+  +   P  E   L    +S   G LAG   + ++ P ++  +K+  +     +
Sbjct: 196 RIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSGES 255

Query: 159 RYKGPLDVIKKIYSAQGIRGLYKGL-ISTLIFRTHFVYWWGSYE 201
                L    +IY   G  GL+ GL +  L+  T   + W  Y+
Sbjct: 256 T----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

>Kwal_0.232
          Length = 274

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 96/269 (35%), Gaps = 33/269 (12%)

Query: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYL 81
           S I   +AG  +G + +    P DT+K RLQ +                F N G  G Y 
Sbjct: 5   SFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAGG-------------FFANGGYLGVYR 51

Query: 82  GFTPPLVGWILMDSVML----GCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSF 137
           G    +V      S+      G     R + +  +  +D+    +  + S      +   
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 138 IAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIY---SAQGI-RGLYKGLISTLIFRTHF 193
           +  P E+ K + Q      T +    L  +KK+    + +GI R LY+G  +T++    F
Sbjct: 112 VRVPAEVIKQRTQ------THKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPF 165

Query: 194 V-YWWGSYELLTR-WFRENTKMSEAAINXXXXXXXXXXXXXXXAYPSDVVKQVVLCNDKY 251
               +  YE L + W     +   A                    P DV+K  ++ +   
Sbjct: 166 TCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHT- 224

Query: 252 DGSFKSWRTAVKDIYQSKGINGFFKGFVP 280
             S      A + IY ++G   FF G  P
Sbjct: 225 --SVPVLHLA-RQIYATEGWKVFFSGVGP 250

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 54/146 (36%), Gaps = 6/146 (4%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P D +K R+Q  +     KG +    +   ++G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 103 NYRML-MHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK 161
            ++ L +    Y N      +  I S  +A +       P+E  + +L  Q     T   
Sbjct: 92  LFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQ----PTFAN 147

Query: 162 GPLDVIKKIYSAQGIRGLYKGLISTL 187
           G      +I   +G+   Y G    L
Sbjct: 148 GLFGGFSRILKEEGVGSFYNGFTPIL 173

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 79/192 (41%), Gaps = 28/192 (14%)

Query: 26  GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPL-----DCVYKTFRNQGIRGFY 80
           G + GV  GVA+  +   F T    ++ ++ ++   G +         + ++  GI+G  
Sbjct: 111 GIMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGIN 170

Query: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVY-------PNDEKLPL---SGCIISGVL 130
            G     +          G    +  L+ + +        P+D+   L   +   I G L
Sbjct: 171 KGVNAVAI----RQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGL 226

Query: 131 AGWSVSFIAPPIELAKAKLQVQ-YDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL---IST 186
           + W+      PIE+ + ++Q +  D    +        K IY + GI+GLY+G+   I  
Sbjct: 227 SAWN-----QPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAPRIGL 281

Query: 187 LIFRTHFVYWWG 198
            +++T F+  +G
Sbjct: 282 GVWQTVFMVGFG 293

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 31.2 bits (69), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 14/76 (18%)

Query: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTS---QNETR-----------FKGPLDCVYK 69
           I  F+ G  SG +   + HPFD  K R+Q +   +N+ R            +G    +Y 
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 70  TFRNQGIRGFYLGFTP 85
             + +G    Y G  P
Sbjct: 326 IKQTEGYGALYTGLIP 341

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 64/159 (40%), Gaps = 15/159 (9%)

Query: 150 QVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFR--THFVYWWGSYELLTRWF 207
            +Q   +  R+    +   KI   +G+  L++GL  TL+     + VY+ G YE+    F
Sbjct: 87  DIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSG-YEM----F 141

Query: 208 RENTKMSEA--AINXXXXXXXXXXXXXXXAYPSDVVKQVV--LCNDKYDGS----FKSWR 259
           R+++ M ++  ++N                 P +++K  +  +   + D +    FK   
Sbjct: 142 RDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLL 201

Query: 260 TAVKDIYQSKGINGFFKGFVPSFLRSFPXXXXXXXXFEF 298
              ++  +S G    FKG   +  R  P        +EF
Sbjct: 202 KETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEF 240

>Scas_673.17
          Length = 314

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 67/153 (43%), Gaps = 16/153 (10%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P +  ++RL +    T   G +    +  + +G+  FY GFTP L   I  +        
Sbjct: 138 PLEATRIRLVS--QPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 195

Query: 103 NYRMLMHKYVYPNDEKLPLSGC---IISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTR 159
               + +  V   +    ++     ++SG+ AG++ +F++ P +   +K+    +KT   
Sbjct: 196 RASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKV----NKTK-- 249

Query: 160 YKGP----LDVIKKIYSAQGIRGLYKGLISTLI 188
            K P    + ++ ++    G+ G + GL + LI
Sbjct: 250 -KAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLI 281

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 55/146 (37%), Gaps = 6/146 (4%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P D +K R+Q  +     KG +    K   ++G      GF P L+G+ +  +   G   
Sbjct: 40  PVDVVKTRIQL-EPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYE 98

Query: 103 NYRMLMHKYV-YPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK 161
            ++ L    + Y N      S  + S  +A +       P+E  + +L  Q     T   
Sbjct: 99  VFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQ----PTFAN 154

Query: 162 GPLDVIKKIYSAQGIRGLYKGLISTL 187
           G +    +I   +G+   Y G    L
Sbjct: 155 GLVGGFSRILKEEGVGSFYSGFTPIL 180

>Kwal_33.15597
          Length = 305

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 54/146 (36%), Gaps = 6/146 (4%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P D +K R+Q  +     KG +    +   ++G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 103 NYRML-MHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK 161
            ++ L +    Y        S  I S  +A +       P+E  + +L  Q     T   
Sbjct: 92  VFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQ----PTFAN 147

Query: 162 GPLDVIKKIYSAQGIRGLYKGLISTL 187
           G +    +I   +G+   Y G    L
Sbjct: 148 GLVGGFSRILKEEGLSSFYNGFTPIL 173

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 1/65 (1%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P D +K R+Q  +     KG +    +   ++G      GF P L+G+ L  S   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYE 91

Query: 103 NYRML 107
            ++ L
Sbjct: 92  VFKKL 96

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 46/110 (41%), Gaps = 5/110 (4%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P +  ++RL +    T   G +    +  + +G+  FY GFTP L   I  +        
Sbjct: 131 PLEATRIRLVS--QPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFE 188

Query: 103 NYRMLMHKYVYPND--EKLPLSGC-IISGVLAGWSVSFIAPPIELAKAKL 149
               L      P D   +  L+   ++SG+ AG + + ++ P +   +K+
Sbjct: 189 RASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKV 238

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 52/146 (35%), Gaps = 6/146 (4%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P D +K R+Q  +     KG +    K    +G      GF P L+G+ +  +   G   
Sbjct: 33  PIDVVKTRIQL-EPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYE 91

Query: 103 NY-RMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK 161
            + +  +    Y    +   S  I S   A +       P+E  + +L  Q     T   
Sbjct: 92  VFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ----PTFAN 147

Query: 162 GPLDVIKKIYSAQGIRGLYKGLISTL 187
           G +    +I   +G+   Y G    L
Sbjct: 148 GLVGGFSRILKEEGVGSFYSGFTPIL 173

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 7/111 (6%)

Query: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102
           P +  ++RL  SQ +    G +    +  + +GI  FY GFTP L   I  +        
Sbjct: 135 PLEATRIRL-VSQPQFA-NGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

Query: 103 NYRMLMHKYVYPNDEKLPLSGC----IISGVLAGWSVSFIAPPIELAKAKL 149
                 + +  P  EKL  +      ++SG+ AG + + ++ P +   +K+
Sbjct: 193 RASEFYYGFAGPK-EKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKV 242

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 142 IELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188
           IE+A   ++ ++  +  RYKG  D  KK+Y  +G   LY   I+ LI
Sbjct: 194 IEIAPGNVETEF--SLVRYKGDTDRAKKVY--EGTNPLYADDIADLI 236

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,925,995
Number of extensions: 349066
Number of successful extensions: 2108
Number of sequences better than 10.0: 209
Number of HSP's gapped: 1361
Number of HSP's successfully gapped: 467
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)