Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09438g1631617531e-104
Sklu_1938.41641575072e-66
ADR345C1581594923e-64
YLR008C (PAM18)1681624691e-60
Scas_590.71581564472e-57
Kwal_33.152981711664432e-56
CAGL0J00935g1531394402e-56
Scas_716.46144701855e-18
YNL328C (MDJ2)146691822e-17
Sklu_2034.5142681761e-16
CAGL0D02552g143691742e-16
AGR393W142651733e-16
KLLA0E02024g146681691e-15
Kwal_55.22136145681612e-14
Scas_711.1713951730.049
KLLA0C02981g16229631.5
Kwal_14.117428439631.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09438g
         (161 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   294   e-104
Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        199   2e-66
ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   194   3e-64
YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   185   1e-60
Scas_590.7                                                            176   2e-57
Kwal_33.15298                                                         175   2e-56
CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   174   2e-56
Scas_716.46                                                            76   5e-18
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    75   2e-17
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         72   1e-16
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    72   2e-16
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    71   3e-16
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    70   1e-15
Kwal_55.22136                                                          67   2e-14
Scas_711.17                                                            33   0.049
KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces c...    29   1.5  
Kwal_14.1174                                                           29   1.6  

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  294 bits (753), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 147/161 (91%)

Query: 1   MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHP 60
           MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHP
Sbjct: 1   MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHP 60

Query: 61  VLTXXXXXXXXXXXXXXYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLS 120
           VLT              YKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLS
Sbjct: 61  VLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLS 120

Query: 121 KKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161
           KKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV
Sbjct: 121 KKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  199 bits (507), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 103/157 (65%), Positives = 116/157 (73%), Gaps = 2/157 (1%)

Query: 6   IEVPQLPIPGEDNSNRVPEQVVIGHPA-AGVPPIPQQKSGMDLYFDQALDYMGDHPVLTX 64
            +VPQLPIPG DNS R+ E V + +       P P Q SGMDLYFDQALD MG HPVLT 
Sbjct: 7   FDVPQLPIPGADNS-RLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQHPVLTG 65

Query: 65  XXXXXXXXXXXXXYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLSKKKL 124
                        Y+SVS +LGG++   K+LKGGFDPKMNA EAL ILNLNE+ L+KKKL
Sbjct: 66  IGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTLTKKKL 125

Query: 125 KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161
           KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEK+ +
Sbjct: 126 KEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGI 162

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  194 bits (492), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (73%), Gaps = 5/159 (3%)

Query: 1   MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHP 60
           MA   IE+PQLPIPGEDNS    +Q+ +   A     +PQQK GMDLYFD+ +D++G+HP
Sbjct: 1   MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAA-----VPQQKRGMDLYFDKVVDFVGEHP 55

Query: 61  VLTXXXXXXXXXXXXXXYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLS 120
           V+               +++VS R+ G  +  K+LKGGFDPKMN KEALAILNL E+ L+
Sbjct: 56  VVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLT 115

Query: 121 KKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKK 159
           KK++K+VHR+IMLANHPDKGGSPYLATKINEAKDFLEK+
Sbjct: 116 KKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKR 154

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  185 bits (469), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 97/162 (59%), Positives = 113/162 (69%), Gaps = 10/162 (6%)

Query: 5   NIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQ-----QKSGMDLYFDQALDYMGDH 59
           +IE PQLPIPG+ N +     V +    AGV    Q     QK+GMDLYFDQAL+YMG+H
Sbjct: 10  SIEAPQLPIPGQTNGS---ANVTV--DGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEH 64

Query: 60  PVLTXXXXXXXXXXXXXXYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNL 119
           PV+T              YKS+SK L G      +LKGGFDPKMN+KEAL ILNL E  L
Sbjct: 65  PVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLTENTL 124

Query: 120 SKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161
           +KKKLKEVHR+IMLANHPDKGGSP+LATKINEAKDFLEK+ +
Sbjct: 125 TKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166

>Scas_590.7
          Length = 158

 Score =  176 bits (447), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 90/156 (57%), Positives = 102/156 (65%), Gaps = 10/156 (6%)

Query: 6   IEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHPVLTXX 65
           +EVPQL IPGE +          G P   +      K+GMDLYFD+A+ YMG HPV+T  
Sbjct: 11  LEVPQLAIPGEAS----------GSPTMTISQPTSTKNGMDLYFDEAMQYMGRHPVMTGV 60

Query: 66  XXXXXXXXXXXXYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLSKKKLK 125
                       YKS+S +L G      +LKGGFD KMN KEAL ILNL E  L+ KKLK
Sbjct: 61  AAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLK 120

Query: 126 EVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161
           EVHR+IMLANHPDKGGSPYLATKINEAKDFLEKK V
Sbjct: 121 EVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSV 156

>Kwal_33.15298
          Length = 171

 Score =  175 bits (443), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 108/166 (65%), Gaps = 10/166 (6%)

Query: 6   IEVPQLPIPGE---DNSNRVPEQVVIGHPAA-------GVPPIPQQKSGMDLYFDQALDY 55
           IE PQLPIPG+   D +    E V  G   A        +     +K GMD  FD AL +
Sbjct: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSGAGGAEGAEMVGKIANASNEKGGMDQAFDDALAF 63

Query: 56  MGDHPVLTXXXXXXXXXXXXXXYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLN 115
           MG HPVL+              +KSVS+ LGG +   +Y KGGFDPKMN KEA+ ILNLN
Sbjct: 64  MGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123

Query: 116 ETNLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161
           E +L++KKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEK+ V
Sbjct: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGV 169

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  174 bits (440), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 95/139 (68%), Gaps = 4/139 (2%)

Query: 27  VIGHPAAGVPP----IPQQKSGMDLYFDQALDYMGDHPVLTXXXXXXXXXXXXXXYKSVS 82
           V G  AAG P      P  K GMDLYFD AL YMG+HPVL               YK V 
Sbjct: 12  VTGDAAAGFPAGATQAPGSKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQ 71

Query: 83  KRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLSKKKLKEVHRRIMLANHPDKGGS 142
            RL G     ++LKGGFDPKMNAKEAL ILNL E NL+ KKLKEVHR+IMLANHPDKGGS
Sbjct: 72  TRLNGGKAATQFLKGGFDPKMNAKEALQILNLKENNLTTKKLKEVHRKIMLANHPDKGGS 131

Query: 143 PYLATKINEAKDFLEKKVV 161
           PYLATKINEAKDFLEKK +
Sbjct: 132 PYLATKINEAKDFLEKKGI 150

>Scas_716.46
          Length = 144

 Score = 75.9 bits (185), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 95  LKGGFDPKMNAKEALAILNLNETNLSK---KKLKEVHRRIMLANHPDKGGSPYLATKINE 151
            +GGF P M   EA+ IL+++  ++ K   K LK  HR  M+ NHPDKGGSPYLATKINE
Sbjct: 71  FQGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNHPDKGGSPYLATKINE 130

Query: 152 AKDFLEKKVV 161
           A++ LE+ V+
Sbjct: 131 AREVLERSVL 140

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 74.7 bits (182), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 3/69 (4%)

Query: 96  KGGFDPKMNAKEALAILNLN--ETN-LSKKKLKEVHRRIMLANHPDKGGSPYLATKINEA 152
           +GGF P+M   EAL IL+++  E N L +K LK+ HR+ M+ NHPD+GGSPY+A KINEA
Sbjct: 74  QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEA 133

Query: 153 KDFLEKKVV 161
           K+ LE+ V+
Sbjct: 134 KEVLERSVL 142

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 72.4 bits (176), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 97  GGFDPKMNAKEALAILNLNET---NLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 153
           GGF  +M   EAL IL ++     +L+   LK  HRR ML NHPDKGGSPYLA KINEA+
Sbjct: 70  GGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRAMLQNHPDKGGSPYLAMKINEAR 129

Query: 154 DFLEKKVV 161
           + LE+ ++
Sbjct: 130 ETLERGIM 137

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 71.6 bits (174), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 96  KGGFDPKMNAKEALAILNLNE---TNLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEA 152
           +GGF   M+  EAL ILN+ +    +L+   LK+ HR  ML NHPDKGGSPYL+ KINEA
Sbjct: 72  EGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHPDKGGSPYLSAKINEA 131

Query: 153 KDFLEKKVV 161
           K+ LEK V+
Sbjct: 132 KELLEKSVL 140

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 71.2 bits (173), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 44/65 (67%), Gaps = 3/65 (4%)

Query: 97  GGFDPKMNAKEALAILNLNETN---LSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 153
           GGF  +MN  EA+ IL +       L +  LK+ HRR ML NHPDKGGSPY+A KINEA+
Sbjct: 73  GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYVAMKINEAR 132

Query: 154 DFLEK 158
           D +E+
Sbjct: 133 DVMEQ 137

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 69.7 bits (169), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 97  GGFDPKMNAKEALAILNLNETN---LSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 153
           GGF  KM+  EAL IL ++      L ++ L++ HRR M+ NHPDKGGSP++A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 154 DFLEKKVV 161
           D L   V+
Sbjct: 133 DLLANSVI 140

>Kwal_55.22136
          Length = 145

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 97  GGFDPKMNAKEALAILNLNETN---LSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAK 153
           GGF  KM   EAL IL ++ +    L +  LK  HR+ ++ NHPD+GGSPYLA KINEA+
Sbjct: 75  GGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGSPYLALKINEAR 134

Query: 154 DFLEKKVV 161
           D L   ++
Sbjct: 135 DILSHSIM 142

>Scas_711.17
          Length = 139

 Score = 32.7 bits (73), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 107 EALAILNLNE-TNLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFL 156
           E+  ILN+ +  NLS +K+ E  + +   N  +KGGS YL +KI  A + L
Sbjct: 57  ESCKILNVEDGKNLSPEKVNERFQYLFDINDKEKGGSFYLQSKIYRASERL 107

>KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces
           cerevisiae YJR097w singleton, start by similarity
          Length = 162

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 116 ETNLSKKKLKEVHRRIMLANHPDKGGSPY 144
           E++ S  ++K  +R ++L  HPDK G  Y
Sbjct: 12  ESDASNIEIKRAYRAMLLETHPDKSGLNY 40

>Kwal_14.1174
          Length = 284

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 4/39 (10%)

Query: 101 PKMNAKEALAILNLNETNLSKKKLKEVHRRIMLANHPDK 139
           P +N  E L +    ET++S+ +L++ +R+ ML  HPDK
Sbjct: 9   PDLNPYEELQV----ETSVSEAQLRKSYRKRMLLYHPDK 43

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,965,932
Number of extensions: 184590
Number of successful extensions: 495
Number of sequences better than 10.0: 26
Number of HSP's gapped: 482
Number of HSP's successfully gapped: 26
Length of query: 161
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 68
Effective length of database: 13,376,635
Effective search space: 909611180
Effective search space used: 909611180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 57 (26.6 bits)