Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E09394g1401387211e-100
ADR348C1901332073e-21
Scas_533.4d171151790.008
Kwal_26.863986234612.8
CAGL0M08888g17593594.1
Scas_707.4566572579.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E09394g
         (138 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E09394g 836226..836648 no similarity, hypothetical start         282   e-100
ADR348C [2089] [Homologous to NOHBY] (1318681..1319253) [573 bp,...    84   3e-21
Scas_533.4d                                                            35   0.008
Kwal_26.8639                                                           28   2.8  
CAGL0M08888g complement(886536..887063) similar to sp|P40993 Sac...    27   4.1  
Scas_707.45                                                            27   9.7  

>KLLA0E09394g 836226..836648 no similarity, hypothetical start
          Length = 140

 Score =  282 bits (721), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%)

Query: 1   MSKIITDLDTIAGKIEEYAGDTLLRLRIFAQFQDISHSHERTDGIYLHFSNVPDFNAETN 60
           MSKIITDLDTIAGKIEEYAGDTLLRLRIFAQFQDISHSHERTDGIYLHFSNVPDFNAETN
Sbjct: 1   MSKIITDLDTIAGKIEEYAGDTLLRLRIFAQFQDISHSHERTDGIYLHFSNVPDFNAETN 60

Query: 61  RERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRCCYRKYDKVVEIMHLKVISIADLD 120
           RERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRCCYRKYDKVVEIMHLKVISIADLD
Sbjct: 61  RERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRCCYRKYDKVVEIMHLKVISIADLD 120

Query: 121 SLREFLAKADDDSEIRSF 138
           SLREFLAKADDDSEIRSF
Sbjct: 121 SLREFLAKADDDSEIRSF 138

>ADR348C [2089] [Homologous to NOHBY] (1318681..1319253) [573 bp,
           190 aa]
          Length = 190

 Score = 84.3 bits (207), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 6/133 (4%)

Query: 1   MSKIITDLDTIAGKIE-EYAGDTLLRLRIFAQFQDISHSHERTDGIYLHFSNVPDFNAET 59
           MS+I+TDL  + G +    + + L+ LRIFAQ++ I  S +      L F  +P F   T
Sbjct: 54  MSRIVTDLAMLEGVLSGATSAERLVLLRIFAQYEGIEPSAQERAAPLLCFRTIPYFGTAT 113

Query: 60  NRERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRCCYRKYDKVVEIMHLKVISIADL 119
              R+Y   IDE  Y   FI       P++GDILD+RC     +  VEIMH+ V+S+ +L
Sbjct: 114 EEVRTYRLAIDEKTYYARFIERLP---PYQGDILDLRCGVIHGE--VEIMHIDVVSMREL 168

Query: 120 DSLREFLAKADDD 132
             LR FLA  D  
Sbjct: 169 ARLRSFLATEDGQ 181

>Scas_533.4d
          Length = 171

 Score = 35.0 bits (79), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 22/151 (14%)

Query: 1   MSKIITD---LDTIAGKIEEYAGDTLL----RLRIFAQFQDI-SHSHERTDGIY--LHFS 50
           MS+++ D   L+ +   + E + +       R R+ AQ  DI  +  E  +G    L   
Sbjct: 1   MSQLVVDICKLNQVLLNLNERSKEIFTNSSRRFRVVAQLLDIQPYDDEENEGFLCKLIVG 60

Query: 51  NVPDFNAETNRERSYY---------FLIDETIYDEAFINTKSGERPHKGDILDMRCCYRK 101
           N+PDF+A+   + +++           + E++Y   F    S   P   D +D+      
Sbjct: 61  NLPDFHAQILDDVAHFTQVKNVRLELYVSESLYRSTFDINCSNRTPELYDAVDLTVAIWN 120

Query: 102 YDKV---VEIMHLKVISIADLDSLREFLAKA 129
              +    E++ ++++++ +++ LREF+A  
Sbjct: 121 NGFINIKCEVIDIEILNLEEVNQLREFIASP 151

>Kwal_26.8639
          Length = 862

 Score = 28.1 bits (61), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 104 KVVEIMHLKVISIADLDSLREFLAKADD-DSEIR 136
           KV+EIM    +S  D DSL EF+  +D  D++I+
Sbjct: 731 KVIEIMDEYFLSKEDWDSLMEFMIGSDKTDAQIK 764

>CAGL0M08888g complement(886536..887063) similar to sp|P40993
           Saccharomyces cerevisiae YDR478w RNA binding protein of
           RNase MRP, start by similarity
          Length = 175

 Score = 27.3 bits (59), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 51  NVPDFNAETNR----ERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRC--CYRKYDK 104
           N+PD   + ++    E  Y  + D ++     IN  SGERP    I   +C  C   YD+
Sbjct: 50  NLPDHIVQPDKKFCGECGYIQIPDHSVD----INIISGERPEISSIAKFKCKKCGHHYDE 105

Query: 105 VVEIMHLKVISIADLDSLREFLAKADDDSEIRS 137
            V     KV   A++      + K  +++++R+
Sbjct: 106 TVLCRKQKVADSANISKDIGQVKKKTNNAKMRA 138

>Scas_707.45
          Length = 665

 Score = 26.6 bits (57), Expect = 9.7,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 11/72 (15%)

Query: 26  LRIFAQFQDISHSHERTDGIYLHFSNVPDFNAETNRERSYYFLIDETIYDEAFINTKSGE 85
           L++F + QD + S      I      +P++N +T         I  T+ + A  +T  GE
Sbjct: 595 LKLFDEIQDCTFSLNTMTEIVQ--KTLPNYNKQT---------IKNTVKEYAVRSTGKGE 643

Query: 86  RPHKGDILDMRC 97
            P K D+ +  C
Sbjct: 644 TPRKWDVKETSC 655

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,644,480
Number of extensions: 194267
Number of successful extensions: 452
Number of sequences better than 10.0: 9
Number of HSP's gapped: 450
Number of HSP's successfully gapped: 9
Length of query: 138
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 47
Effective length of database: 13,445,871
Effective search space: 631955937
Effective search space used: 631955937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (26.2 bits)