Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08195g70469333220.0
YIL091C72170121610.0
Kwal_27.1150372754520640.0
Scas_671.1372369920610.0
ADL209C70470419780.0
CAGL0D04180g70054319150.0
Kwal_23.512559871800.15
YGL015C13096710.65
YKR007W184101711.1
Kwal_47.19313107165712.4
CAGL0G06666g145423702.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08195g
         (693 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08195g 742066..744180 similar to sp|P40498 Saccharomyces c...  1284   0.0  
YIL091C (YIL091C) [2584] chr9 complement(191027..193192) Protein...   837   0.0  
Kwal_27.11503                                                         799   0.0  
Scas_671.13                                                           798   0.0  
ADL209C [1532] [Homologous to ScYIL091C - SH] (334819..336933) [...   766   0.0  
CAGL0D04180g complement(411498..413600) similar to sp|P40498 Sac...   742   0.0  
Kwal_23.5125                                                           35   0.15 
YGL015C (YGL015C) [1958] chr7 complement(465046..465438) Protein...    32   0.65 
YKR007W (YKR007W) [3263] chr11 (451077..451631) Protein of unkno...    32   1.1  
Kwal_47.19313                                                          32   2.4  
CAGL0G06666g complement(635311..639675) highly similar to sp|P13...    32   2.7  

>KLLA0E08195g 742066..744180 similar to sp|P40498 Saccharomyces
           cerevisiae YIL091c singleton, start by similarity
          Length = 704

 Score = 1284 bits (3322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/693 (91%), Positives = 634/693 (91%)

Query: 1   MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE 60
           MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE
Sbjct: 1   MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE 60

Query: 61  QHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIENALX 120
           QHRGQAYNALLTLLKSEHPER          DSQRAEEDSPENDGINSEDEQQNIENAL 
Sbjct: 61  QHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALD 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKSSKT 180
                                          HFSKYSESRLYAFDKGFKDKTVKYKSSKT
Sbjct: 121 DVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKT 180

Query: 181 DVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVD 240
           DVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVD
Sbjct: 181 DVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVD 240

Query: 241 PMFQYKXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF 300
           PMFQYK                 LYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF
Sbjct: 241 PMFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF 300

Query: 301 TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ 360
           TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ
Sbjct: 301 TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ 360

Query: 361 GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM 420
           GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM
Sbjct: 361 GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM 420

Query: 421 IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI 480
           IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI
Sbjct: 421 IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI 480

Query: 481 SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR 540
           SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR
Sbjct: 481 SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR 540

Query: 541 FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT 600
           FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT
Sbjct: 541 FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT 600

Query: 601 SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG 660
           SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG
Sbjct: 601 SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG 660

Query: 661 NCDINISTVRCIYSKMDGLSLERVVGSKRAAVL 693
           NCDINISTVRCIYSKMDGLSLERVVGSKRAAVL
Sbjct: 661 NCDINISTVRCIYSKMDGLSLERVVGSKRAAVL 693

>YIL091C (YIL091C) [2584] chr9 complement(191027..193192) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.5616p [2166 bp, 721 aa]
          Length = 721

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/701 (60%), Positives = 513/701 (73%), Gaps = 16/701 (2%)

Query: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPD--NESDSDNAEPSVAAEREDVEQH 62
           R   K GR++LR+I R+   R       T+ D+  D  + SD D      + +  D+E  
Sbjct: 14  RGYRKRGRQELRKIKRSSA-RTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDE 72

Query: 63  RGQ---AYNALLTLLKSEHPERXXXXXXXXXXDSQRAE--EDSPENDGINSEDEQQNIEN 117
            G+    Y+ALLT+LKSEHPE           +   AE  ED  EN      D+Q  IEN
Sbjct: 73  EGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIEN 132

Query: 118 ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKS 177
            L                                HF++  E  +      FK K+VKYKS
Sbjct: 133 GLLGNHEDDNDDDSSGDEKDIDSEDEQDPFES--HFNQVPEKFVDKLSNAFKTKSVKYKS 190

Query: 178 SKTDVSEEESLIYSKPCLDDEEVL---PVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTE 233
            K  +S+ ES IY+KP +  EE L   P +   ++ SYF+KQ+LK+ N   +    PLT 
Sbjct: 191 VKGSLSDSESYIYAKPVVIGEEALVESPYRS-SSIYSYFLKQRLKVQNGLLDKKTDPLTA 249

Query: 234 IQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENND 292
           +QK+LVDPMFQYK                  LY+LH LNH+YKTRDRILKNNQ+LQ+N D
Sbjct: 250 LQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPD 309

Query: 293 EELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKP 352
            E LDQGFTRPKVLIVVPTR+ A+++V KI+ KSG+DQ DKK KF DQF +DSLPP SKP
Sbjct: 310 TEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKP 369

Query: 353 KSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDD 412
           KSFQHIF+GNTNDFFV+GLKFTRK++K+YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDD
Sbjct: 370 KSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDD 429

Query: 413 FLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQ 472
           FLSSIE+M+IDQLHSIEYQN  H+ TIF H+NKIP+QQ EADFSRIRMWYINEQAK FRQ
Sbjct: 430 FLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQ 489

Query: 473 TIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGT 532
           T+VFTKYISP ANS++NG+CRN+AGRWKNH+ I  E SSIGQ GLK+RQIFQRFD+ G +
Sbjct: 490 TMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNS 549

Query: 533 ALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINE 592
            ++EPDYRFKFFTSVI+P IVKSTGYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+INE
Sbjct: 550 IIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINE 609

Query: 593 YSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRN 652
           YS+Q+QL +NR+ FQ G++KV+LYTERLHH+RRYEIK VKSV+FYKPP NPEFY+EVVR 
Sbjct: 610 YSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRF 669

Query: 653 IGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVL 693
           IGKN FLGN D+NISTVRCIYSK+DGLSLER+VG+KRAAVL
Sbjct: 670 IGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVL 710

>Kwal_27.11503
          Length = 727

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/545 (67%), Positives = 456/545 (83%), Gaps = 3/545 (0%)

Query: 152 HFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCLDDEEVLPVK---GKQT 208
           HF+   E    A D+ FK K V+Y+SSK  +S+ E  IYS+P L+ E   P++   G Q+
Sbjct: 172 HFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQS 231

Query: 209 LSSYFIKQKLKLANDFQNNGLPLTEIQKELVDPMFQYKXXXXXXXXXXXXXXXXXLYSLH 268
           LS YFIKQ+LK+ ND  ++   LT +QK++VDP+FQY+                 LY+LH
Sbjct: 232 LSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLYALH 291

Query: 269 ALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGL 328
           AL+H+YKTRDRILKNNQ+LQ+N D+E+LDQGFTRPKVLIVVPTRD A+ ++ KI+EKSGL
Sbjct: 292 ALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGL 351

Query: 329 DQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSD 388
           DQ DKKSKF DQF++DSLPP  KPKSFQ +F+GNTNDFFVLG KFTRK++K+YSNFYQSD
Sbjct: 352 DQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSD 411

Query: 389 IIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPE 448
           II+CSPLGIQLILENTDKKKRQDDFLSSIE+++IDQLHSIE+QN +H+T+IF+HINKIP+
Sbjct: 412 IIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQ 471

Query: 449 QQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPE 508
           QQ +ADFSRI+MWYIN+QAK FRQT++FT++ +PFANS++NGKCRN AGRWKNH  +  E
Sbjct: 472 QQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAE 531

Query: 509 QSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPD 568
           +SS+ QLG++ R +FQRFD+AGG A DEPD+RFK F SVIVP+IV+STGYEDGILLYIPD
Sbjct: 532 KSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPD 591

Query: 569 YTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEI 628
           YTDFIRVRNYL+EKTTI+FG+I+EYS Q+QLT+NRA FQ G+VKVLLYTERLHHFRRYEI
Sbjct: 592 YTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEI 651

Query: 629 KNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSK 688
           K VK+VIFYKPP NPEF+ E VR + K+ FLG  D+NIS VRC+YSK+DGL+LER+VG++
Sbjct: 652 KGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTE 711

Query: 689 RAAVL 693
           RAA+L
Sbjct: 712 RAAIL 716

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDV---EQHRGQ 65
          K GRKQLR I +A     RYD +    +     E + +  E  V  ER +V   ++  G+
Sbjct: 21 KGGRKQLRSIRKAS----RYDSKKPEDEPVETPEEEINEVE-DVHEERTEVSRKQESNGE 75

Query: 66 AYNALLTLLKSEH 78
          AY ALLTLLK+EH
Sbjct: 76 AYAALLTLLKAEH 88

>Scas_671.13
          Length = 723

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/699 (57%), Positives = 507/699 (72%), Gaps = 16/699 (2%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQAYN 68
           K GR++LR I R+   +V    E   + +  D E + + +  S   E  D E+ + + Y 
Sbjct: 16  KRGRQELRTIRRSAGAKVS-SQEVFNSSIVDDEEQELNESNESEQEEDIDEEEKKNKVYG 74

Query: 69  ALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPE---NDGINSE-DEQQNIENALXXXXX 124
           ALLT+LKSEHPE           DS+  E+   E   +DG + E DE Q IE+ L     
Sbjct: 75  ALLTILKSEHPE-LKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQIEDGLARGSD 133

Query: 125 XXXXXXXXXXXXXXXXXXXXXXXXX---XXHFSKYSESRLYAFDKGFKDKTVKYKSSKTD 181
                                         HF++ SE      +  F   +VKYKS+K+ 
Sbjct: 134 GQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSV 193

Query: 182 VSEEESLIYSKPCL-----DDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTEIQ 235
           + + +++I S P +      +EE        ++ SYF+KQ+L++AND  ++   PL  +Q
Sbjct: 194 IGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPLGPLQ 253

Query: 236 KELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENNDEE 294
           KELVDPMFQY+                  LY+LHALNHVYKTRDRILK+N +LQ+N+D E
Sbjct: 254 KELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTE 313

Query: 295 LLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKS 354
             DQGFTRPKVLIVVPTRD A++++ KI+ KSGLDQ DKK KF DQF +++LPP+SKPKS
Sbjct: 314 YFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKS 373

Query: 355 FQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 414
           FQHIF+GNTNDFFVLG+KFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFL
Sbjct: 374 FQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFL 433

Query: 415 SSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTI 474
           SSIEV+IIDQLHSIEYQN  HV TIF H+NKIPEQQ EADFSRIRMWYIN+QA+ FRQT+
Sbjct: 434 SSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTM 493

Query: 475 VFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTAL 534
           +FTKY++P AN+++N +CRN AGRWKNH  I+PE S+I QLGLKV+Q FQRFD+ GG+ +
Sbjct: 494 IFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVI 553

Query: 535 DEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYS 594
           DEPDYRFK F+SVI+PSIVKST Y DGIL+YIPDYTD++R+RNYLKEKTT++FG+INEYS
Sbjct: 554 DEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYS 613

Query: 595 NQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIG 654
            Q++L SNR+ FQ G+VKVLLYTERLHH+RRYE+K VKSV+FYKPP NPEFY+EVVR IG
Sbjct: 614 EQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIG 673

Query: 655 KNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVL 693
           K+ FLGN D+NISTVR +Y K+DGLSLER+VGSKRA +L
Sbjct: 674 KSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGIL 712

>ADL209C [1532] [Homologous to ScYIL091C - SH] (334819..336933)
           [2115 bp, 704 aa]
          Length = 704

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/704 (55%), Positives = 497/704 (70%), Gaps = 42/704 (5%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEAT-----VADLTPDNESDSDNAEPSVAAEREDVEQHR 63
           K GRKQLR ITR G+     +DEA        +     E  S+    +  AE +D     
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAE-DDGGARE 71

Query: 64  GQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEED----------SPENDGINSEDEQQ 113
            Q+Y ALLTLL +EH ++          ++  A E           + EN   ++ED + 
Sbjct: 72  SQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEEAITAALENSAQDAEDAED 131

Query: 114 NIENALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTV 173
             +++                                 HF++ S + +   D  FK+   
Sbjct: 132 AFDDS---------------------GESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRA 170

Query: 174 KYKSSKTDVSEEESLIYSKPCLDDEEV-LPVK-GKQTLSSYFIKQKLKLANDFQNNG--L 229
           +Y+  K    EEE ++YSKP    E    PV+   ++L  Y IKQ+L++ N    +    
Sbjct: 171 QYRVQKEARGEEE-ILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEK 229

Query: 230 PLTEIQKELVDPMFQYKXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQE 289
           PLT  QK L+DPMFQY+                 LY+LH LNHVYKTRDRILKNNQKLQ+
Sbjct: 230 PLTPQQKVLLDPMFQYQDILYEYEGYDREREYRELYTLHILNHVYKTRDRILKNNQKLQD 289

Query: 290 NNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPT 349
           N D+ELLDQGFTRPK L+VVPTR  A+ +V  ++++SG++Q DKKSKF+DQF++ SLPP 
Sbjct: 290 NPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPA 349

Query: 350 SKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKR 409
           SKPKSFQH+F+GNTNDFFVLG+KFTRK++++YSNFYQSD+I+CSPLG+QLI+ENTDKKKR
Sbjct: 350 SKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKR 409

Query: 410 QDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKF 469
           QDDFLSSIEVM++DQLHSIE+QN  HV+ IF HINKIP+QQR+ADFSRIRMWYI +QAK 
Sbjct: 410 QDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKL 469

Query: 470 FRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLA 529
           FRQT+VFT+YISPFAN++LN KC N AGR K+HR +  E+S IGQLGLK+RQIFQRF++ 
Sbjct: 470 FRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVL 529

Query: 530 GGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGE 589
           GG+ +DEPD+RFKFFTSV+VP I K+TGY+ GILLYIP+YTDFIRVRNYLK+KT I+FG+
Sbjct: 530 GGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGD 589

Query: 590 INEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEV 649
           INEYS+Q+QLTSNRA FQ G++KVLLYTERLHHFRR+E+K VKSVI YKPP NPEFY E+
Sbjct: 590 INEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQEL 649

Query: 650 VRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVL 693
           +R IGK+ FLG  D+NI+TVRC+YSKMD L+LER+VG+KRAAVL
Sbjct: 650 LRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVL 693

>CAGL0D04180g complement(411498..413600) similar to sp|P40498
           Saccharomyces cerevisiae YIL091c, hypothetical start
          Length = 700

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/543 (64%), Positives = 438/543 (80%), Gaps = 14/543 (2%)

Query: 163 AFDKGFKDKTVKYKSSKTDVSE------EESLIYSKPCLDDE--EVLPVKGKQTLSSYFI 214
           A     KD  ++YKS K  V        +E  I+S P ++ E  ++   K K +LSSYF+
Sbjct: 149 ALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLKCSLSSYFL 208

Query: 215 KQKLKLAN---DFQNNGLPLTEIQKELVDPMFQYKXXXXXXXXX-XXXXXXXXLYSLHAL 270
           K++L++ N   D ++N L  T++Q+++VDPM QYK                  LY+LH L
Sbjct: 209 KKRLRIQNNLLDTESNAL--TDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVL 266

Query: 271 NHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQ 330
           NHVYKTRD+I+KNNQKLQ+N D E LDQGFTRPKVLI+ PTRD+A++IV K++EKSGLDQ
Sbjct: 267 NHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQ 326

Query: 331 FDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDII 390
            DKK KF DQF++ S PP+SKPKSFQHIF+GNTND+FVLG+KFTRK++K+YSNFYQSDII
Sbjct: 327 VDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDII 386

Query: 391 ICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQ 450
           +CSPLG+Q+I+ENTDKKKRQDDFLSS+EV IIDQ HSIEYQN  H+ TIF H+NKIP++Q
Sbjct: 387 VCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQ 446

Query: 451 READFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQS 510
            +ADFSRIRMWYIN+QAKFFRQT++FTKYISP ANS+LN KCRNL GRWKNH+ +  E S
Sbjct: 447 HDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDS 506

Query: 511 SIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYT 570
           S+G +GLKVRQIFQRF++ G +  DEPDYRFKFFTSV++ +I KSTGY+DG L+YIP+Y+
Sbjct: 507 SVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYS 566

Query: 571 DFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKN 630
           D++RVRNY+KEKT+I+FG+INEYS Q+ LTSNR  F  G++KVLLYTERLHHFRRYE+K 
Sbjct: 567 DYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKG 626

Query: 631 VKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRA 690
           VK+V+FYKPP +PEFY EVVR IGK VFLG+ D+NISTVRC YSK+DGL+LE++VG+KR 
Sbjct: 627 VKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRT 686

Query: 691 AVL 693
            VL
Sbjct: 687 GVL 689

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAERED---VEQHRGQ 65
          K GRK+LR I RA  KR + + EA   D   ++      A P+V  + +D    E  + Q
Sbjct: 3  KRGRKELRSIRRA--KRTKIEPEA---DAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQ 57

Query: 66 AYNALLTLLKSEHPE 80
           YNALLT+LKSEH E
Sbjct: 58 VYNALLTILKSEHKE 72

>Kwal_23.5125
          Length = 598

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 9/71 (12%)

Query: 568 DYTDFIRVRNYLKEKTTIIFGEINEYSN--QKQLTSNRARFQHGKVKVLLYTERLHHFRR 625
           DY DF+ V+N   ++ T  F  I+++ +  +K + ++RARF+H  VK  +       F R
Sbjct: 381 DYVDFLEVKNIELKEMTCAFTPIDQFESLFRKWILADRARFEHS-VKAYV------AFIR 433

Query: 626 YEIKNVKSVIF 636
           Y  K+  S IF
Sbjct: 434 YYSKHSASSIF 444

>YGL015C (YGL015C) [1958] chr7 complement(465046..465438) Protein of
           unknown function [393 bp, 130 aa]
          Length = 130

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 41/96 (42%), Gaps = 12/96 (12%)

Query: 571 DFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKN 630
           D IR  NY   +T+   G IN       L S+  +F        +  ER+HHFR+++ K 
Sbjct: 3   DTIRPLNYADIETS---GPINLLETTNNLKSSLKKFSQKAKGSHISRERIHHFRKWKNKT 59

Query: 631 VK-SVIFYKPPGNPEFYSEVVRN------IGKNVFL 659
              S    KPP  P+  S    N      +  NVFL
Sbjct: 60  ESLSENHLKPP--PDVDSLCFSNCFQPDALSGNVFL 93

>YKR007W (YKR007W) [3263] chr11 (451077..451631) Protein of unknown
           function [555 bp, 184 aa]
          Length = 184

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 307 IVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDF 366
           IV+   D    + ++  E+ G  + D++S  +D     S+P +   ++  H     TN F
Sbjct: 82  IVIQGTDLQEALDKRQQEEGGDSREDERSAGDDNLSGHSVPSSGSAQATTHQTAPRTNTF 141

Query: 367 FVL----GLKFTRKSL-KIYSN-----FYQSDIIICSPLGI 397
            +L      K +++ L K++SN     F QS +    PL +
Sbjct: 142 TLLTSPDSAKISKEQLKKLHSNILNEIFSQSQVNKPGPLTV 182

>Kwal_47.19313
          Length = 1071

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 387 SDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKI 446
           ++++I +P    L+  N D    Q+ FL ++ +M++D++HSI+ +    +  I   +N +
Sbjct: 180 TNLVIMTPEKCDLLSRNRDI---QNIFLHTLSLMLVDEVHSIKEERGAILEVIIMRLNLL 236

Query: 447 PEQQR 451
               R
Sbjct: 237 SNTLR 241

>CAGL0G06666g complement(635311..639675) highly similar to sp|P13382
           Saccharomyces cerevisiae YNL102w CDC17, start by
           similarity
          Length = 1454

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 344 DSLPPTSKPKSFQHIFQGNTNDF 366
           D++PP    ++F H+F GNTN F
Sbjct: 446 DTIPPDLSSETFHHVFGGNTNIF 468

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,425,658
Number of extensions: 1007925
Number of successful extensions: 3513
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3583
Number of HSP's successfully gapped: 30
Length of query: 693
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 584
Effective length of database: 12,822,747
Effective search space: 7488484248
Effective search space used: 7488484248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)