Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08173g48647923980.0
Sklu_2251.1047947412801e-174
Kwal_27.1150047547111811e-159
ADL208W50249711451e-153
YIL090W49148711391e-152
CAGL0D04202g49948911361e-152
Scas_671.1248647811031e-147
Sklu_1261.180343682.9
KLLA0C07491g82943683.0
ADR177C83943664.9
YJL026W (RNR2)399118655.9
CAGL0E00451g209066656.5
Kwal_26.895981743649.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08173g
         (479 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08173g complement(740213..741673) similar to sp|P40499 Sac...   928   0.0  
Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement     497   e-174
Kwal_27.11500                                                         459   e-159
ADL208W [1533] [Homologous to ScYIL090W - SH] complement(337120....   445   e-153
YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknow...   443   e-152
CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces c...   442   e-152
Scas_671.12                                                           429   e-147
Sklu_1261.1 YOR270C, Contig c1261 283-2694 reverse complement          31   2.9  
KLLA0C07491g 653352..655841 similar to sp|P32563 Saccharomyces c...    31   3.0  
ADR177C [1918] [Homologous to ScYOR270C (VPH1) - SH] (1014058..1...    30   4.9  
YJL026W (RNR2) [2883] chr10 (392320..393519) Component of ribonu...    30   5.9  
CAGL0E00451g complement(36999..43271) similar to tr|CAA42248 Sac...    30   6.5  
Kwal_26.8959                                                           29   9.1  

>KLLA0E08173g complement(740213..741673) similar to sp|P40499
           Saccharomyces cerevisiae YIL090w singleton, start by
           similarity
          Length = 486

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/479 (94%), Positives = 455/479 (94%)

Query: 1   MLHRITMEIFKQTXXXXXXXXXLEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYL 60
           MLHRITMEIFKQT         LEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYL
Sbjct: 1   MLHRITMEIFKQTRRRRSQERRLEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYL 60

Query: 61  FLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSALSTLIYYLQHLLIP 120
           FLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSALSTLIYYLQHLLIP
Sbjct: 61  FLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSALSTLIYYLQHLLIP 120

Query: 121 SILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAI 180
           SILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAI
Sbjct: 121 SILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAI 180

Query: 181 GETERWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSI 240
           GETERWLKMSRRSNQWV               FYFYRIYVTPMWELSTPSASLLGFTFSI
Sbjct: 181 GETERWLKMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSI 240

Query: 241 VCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300
           VCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP
Sbjct: 241 VCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300

Query: 301 KKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQ 360
           KKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQ
Sbjct: 301 KKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQ 360

Query: 361 EIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYS 420
           EIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYS
Sbjct: 361 EIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYS 420

Query: 421 PCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNIYSTMLIYAL 479
           PCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNIYSTMLIYAL
Sbjct: 421 PCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNIYSTMLIYAL 479

>Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement
          Length = 479

 Score =  497 bits (1280), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 261/474 (55%), Positives = 326/474 (68%), Gaps = 39/474 (8%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           ++ +S++Q++R  LTT YL LVLITIPISFQVGGL CGLSFTVTLF LYF++TT K+V  
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 102 DRGS---ALSTLIYYLQHLLIPSILFMFLSYFEN------IDSD-TVDSE---------- 141
                  ++++ +YYLQH +IPS+LF+FLS F N      ID D  +  E          
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120

Query: 142 ------YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQ 195
                 ++  ++   VKPWQ  L+HSTP FTLLEG FT+L IQAIGET +WL+  + SN 
Sbjct: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180

Query: 196 WVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGS 254
           W+               +Y YRIYVTP+WELS  +ASLLGFT SIVCG+GLYGI +G GS
Sbjct: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240

Query: 255 VMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMT 310
           V+ESSLFFAY+VR +YEISP++A +AMDEIF IVK+TW+ HQ NLP  DNLL     ++ 
Sbjct: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNVVL 299

Query: 311 KNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMA 370
           KN   IW  IV+ T         M   +  L PLW   KNFT SVP SI+EIF VT KMA
Sbjct: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWLR--LQPLWKFTKNFTISVPSSIREIFRVTLKMA 357

Query: 371 KESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYT 429
            ES+ P VVINLVFR+L+FYSATRIIP LQ+ N   R+S RR+M  +YWYSPCI+IAMYT
Sbjct: 358 TESVTPTVVINLVFRILVFYSATRIIPALQKDNPNGRKSSRRLMRLIYWYSPCIVIAMYT 417

Query: 430 HLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSWSFWNWCNIYSTMLIYAL 479
           HLIL+YSG+L NDLC+WGCFP+    +   K+VVD+W FWNWCN++ T+ IY L
Sbjct: 418 HLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGL 471

>Kwal_27.11500
          Length = 475

 Score =  459 bits (1181), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 249/471 (52%), Positives = 318/471 (67%), Gaps = 39/471 (8%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           +I +S+LQ++R+ LT+ YL L+LITIPI+FQVGGL CGLSFTVTLF LY ++TT K+   
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 102 DRGSA-LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSE------------- 141
            RG A L++  YY QH  IPS+LF+FLS F N      ID++T   E             
Sbjct: 61  ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120

Query: 142 ---YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVX 198
              ++  +++ +V+PWQ  L+ STP FTLLEG FT+L IQA+GET RWL     SN WV 
Sbjct: 121 PWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180

Query: 199 XXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257
                         +Y YRIYVTP+WELS  +ASLLGFTFSIV G+G++GI +G GS +E
Sbjct: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240

Query: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313
           SSLFFAY+VR +YEISP++A +AMDEI ++VK+TW     +L   D  L    +++ KN 
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300

Query: 314 RAIWSQIVEHTPRNHKYIKMMDQCKWI----LNPLWNSVKNFTKSVPISIQEIFVVTFKM 369
             IW  ++  T  N   +       WI    + PLW  VK+FT SVP SIQEIF++T  M
Sbjct: 301 EMIWDAVLARTNVN---VSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSM 357

Query: 370 AKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYT 429
           A+E++ PAVVINL FR+LIFYSATRIIP LQR  K +R  RR M  +YWYSPCI+IAMYT
Sbjct: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQR--KHKRRSRRFMRMLYWYSPCIVIAMYT 415

Query: 430 HLILRYSGQLKNDLCIWGCFPYE--TEPKIVVDSWSFWNWCNIYSTMLIYA 478
           HLI++YSGQ+ NDLC+WGCFP+      K+VVDSW FWNWCNI+ TM IYA
Sbjct: 416 HLIMQYSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466

>ADL208W [1533] [Homologous to ScYIL090W - SH]
           complement(337120..338628) [1509 bp, 502 aa]
          Length = 502

 Score =  445 bits (1145), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 237/497 (47%), Positives = 314/497 (63%), Gaps = 60/497 (12%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           ++ K +L++LR  L + YLFLVLIT+PISFQ+GGL CGLSFTVTLF LYFV+TT K+   
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 102 DRGSA---LSTLIYYLQHLLIPSILFMFLSYFEN-------IDSDTVDSEYFKVF----- 146
            RG     +++ +YYLQH L+PSILF+FLS F N       + SD   +    +F     
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120

Query: 147 ----------------------WNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETE 184
                                 +  +V+PWQ  L+H+TP FTL EG FT+LAIQ IGET 
Sbjct: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 185 RWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGI 244
           RWL+  R S  WV               +Y YRIYVTP+W LS  +A+LLGFT S+V G+
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 245 GLYGI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKK- 302
           GLYGI +G GS +ESSLFFAYMV  +YEISP++A+ AM EIF +V  TW++ Q  LPK  
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300

Query: 303 ------------DNLLELMTKNYRAIWSQIVEHTPRNH--KYIKMMDQCKW--ILNPLWN 346
                       +NL +++ K    + S  ++  P +   K   ++ Q +W      LW+
Sbjct: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360

Query: 347 SVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKER 406
             KNF+  +P SI EIF+VT  +A+ES+  AVV NLVFR+++FYSATRIIP LQR T   
Sbjct: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420

Query: 407 RSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSW 462
           +S R++M  +YWYSPCI+IAMYTH+ILRYSG+L N+LCIWGCFP+        + VVD+W
Sbjct: 421 QS-RKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAW 479

Query: 463 SFWNWCNIYSTMLIYAL 479
            FWNWCN++ T+LIYA+
Sbjct: 480 GFWNWCNLFFTLLIYAV 496

>YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.4010p [1476 bp, 491 aa]
          Length = 491

 Score =  443 bits (1139), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/487 (49%), Positives = 303/487 (62%), Gaps = 52/487 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + KS +Q+ RI     YL   L++IPISF+VGGL CGLSFTVTLF LYF++TT  ++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENIDSDTV------DSEYF------ 143
               G  L    +  +YY QH +I S+L++FLS F N +   V      +SE F      
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 144 ------------KVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
                         ++  +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIYVTP+W LS  +ASLLG   S+VCG+GLYGI +
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI ++ K+ W+ HQ NLP  DNLL    
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 307 ELMTKNYRAIWSQIVEHTPRNHK----------YIKMMDQCKWILNPLWNSVKNFTKSVP 356
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 301 NVILKNAEVLWGSFI---PRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVP 357

Query: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKG 417

Query: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIY 471
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC    F  + +P+I+VDSW FWNWCNI+
Sbjct: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVD-QPEIIVDSWGFWNWCNIF 476

Query: 472 STMLIYA 478
            T+L+YA
Sbjct: 477 CTILVYA 483

>CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces
           cerevisiae YIL090w, start by similarity
          Length = 499

 Score =  442 bits (1136), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 241/489 (49%), Positives = 318/489 (65%), Gaps = 53/489 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M LI + V +++RI    +YL L L++IPISF++GGL CGLSFTVTLF LY +STT  ++
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 100 L---LDRGSALST-LIYYLQHLLIPSILFMFLSYFEN---------------IDSDTVDS 140
                +RG   +T ++YY QHL+I  +LF+FLS F N               +D D    
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 141 EYFK-------------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIG 181
           +  K                    ++  +V+PWQ  L +STP FTLLEG FTILAIQAIG
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 182 ETERWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIV 241
           ET +WL     SN W+               +Y YRIYVTP+W+L+  SASLLGF  SIV
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 242 CGIGLYGI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300
             +GLYGI +  GSV+ESSLFFAY+VR +YEISPK+A  A +EI D+VK+ W+ HQ NL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 301 KKDNLL----ELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILN--PLWNSVKNFTKS 354
            +DNLL     ++ KN   +W   +   PR+   +  M++ ++ L+  P+W   KNFT S
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFI--LPRSRS-LNAMEKIRFWLDVTPVWKFFKNFTVS 357

Query: 355 VPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNT-KERRSFRRIM 413
           VP SI E+  VT+KMA ESL PAV++NL FR+LIFYSATRIIP LQR++ KE+R  RRI+
Sbjct: 358 VPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRIL 417

Query: 414 NFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCN 469
             +YWYSPC++IAMYTHLIL+YSG+LK +LC+WGC    F  + +P+IV DSWSFWNWCN
Sbjct: 418 KLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCN 477

Query: 470 IYSTMLIYA 478
           I+ T+L+YA
Sbjct: 478 IFWTVLVYA 486

>Scas_671.12
          Length = 486

 Score =  429 bits (1103), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 234/478 (48%), Positives = 308/478 (64%), Gaps = 45/478 (9%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           +I  S ++ +RI   T YL   LI+IPISF++GGL+CGL+FTV+LF LYF+STT  +   
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYFEN--------IDSDTVDS--EYFK--- 144
             GS     L+ ++YY QH +I S+L++FLS F N          +  +DS  + FK   
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 145 ------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRR 192
                        ++   V+PWQ  L +STP FTL EG FTILAIQAIGET +WL     
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 193 SNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NG 251
           SN WV               +Y YRIYVTP+W+LS  +ASLLGFT S+V G+G+YGI   
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 252 SGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLE---- 307
            GSV+ESS+FFAY+VR +YEISPK+A  A +EI ++ KE W+ HQANL   +NLL     
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 308 LMTKNYRAIWSQIVEHTPRNHKYIKMM--DQCKWILNPLWNSVKNFTKSVPISIQEIFVV 365
           ++ KN   IW         ++ +I     ++   I  P+W  +K FT +VP SI E+  V
Sbjct: 301 VVLKNIETIWESF---KINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFV 357

Query: 366 TFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIMNFVYWYSPCII 424
           T+KMA ES+ PAV++NL FR+LIFYSATRIIP LQ R+  E R  RRIM  +YWYSPCI+
Sbjct: 358 TYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCIL 417

Query: 425 IAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIYSTMLIYA 478
           IAMY HLIL+YSG+LK++LC+WGC    FP + +PKI+VDSW FWNWCNI+ T+L+YA
Sbjct: 418 IAMYAHLILQYSGELKDELCLWGCNSKIFPSD-QPKIIVDSWGFWNWCNIFFTILVYA 474

>Sklu_1261.1 YOR270C, Contig c1261 283-2694 reverse complement
          Length = 803

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI ISF + G+  G+  TV LFA++FV T   LV+++  SA+
Sbjct: 725 MTIEISFGMSGV-VGVIMTVILFAMWFVLTCAVLVVMEGTSAM 766

>KLLA0C07491g 653352..655841 similar to sp|P32563 Saccharomyces
           cerevisiae YOR270c VPH1 H+-ATPase V0 domain 95K subunit,
           vacuolar, start by similarity
          Length = 829

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI I+F + G   G+  TV LFA++FV T   LV+++  SA+
Sbjct: 749 MTIEIAFGMSGF-VGVVMTVALFAMWFVLTCVILVVMEGTSAM 790

>ADR177C [1918] [Homologous to ScYOR270C (VPH1) - SH]
           (1014058..1016577) [2520 bp, 839 aa]
          Length = 839

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI I+F + G   G+  TV LFA++FV T   LV+++  SA+
Sbjct: 761 MTIKIAFGMNG-TVGVIMTVVLFAMWFVLTCVILVVMEGTSAM 802

>YJL026W (RNR2) [2883] chr10 (392320..393519) Component of
           ribonucleotide reductase (ribonucleoside-diphosphate
           reductase) small subunit, which consists of an
           Rnr2p-Rnr4p heterodimer [1200 bp, 399 aa]
          Length = 399

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 49/118 (41%), Gaps = 12/118 (10%)

Query: 271 EISPKMAMNAM------DEIFDIVKETWKIHQANLPKKDNLLELMTKNYRAIWSQIVEHT 324
           E   K A +A+      D   ++ KE   + + N  K D L E ++K+     + +  H 
Sbjct: 4   ETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLKSHQ 63

Query: 325 PRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINL 382
              HK  +M  +      PL N  K  T   PI   EI+   +K A+ S   A  I+L
Sbjct: 64  VHRHKLKEMEKE-----EPLLNEDKERTVLFPIKYHEIWQA-YKRAEASFWTAEEIDL 115

>CAGL0E00451g complement(36999..43271) similar to tr|CAA42248
           Saccharomyces cerevisiae YCR093w nuclear protein,
           hypothetical start
          Length = 2090

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 128 SYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWL 187
           S F  +DS ++  E+F   W+V VK   + L+H    +++ EG F IL  Q I +    +
Sbjct: 290 SLFAILDSGSIIDEFFSCDWHVSVKLQLVVLLHK---WSVSEGCFDILNSQNIRKVSNKI 346

Query: 188 KMSRRS 193
           + ++ S
Sbjct: 347 ENTKMS 352

>Kwal_26.8959
          Length = 817

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI I F + G+  G+  TV LF ++FV T   LVL++  SA+
Sbjct: 739 MTIQIGFSMTGV-VGVIMTVILFGMWFVLTCVILVLMEGTSAM 780

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,317,941
Number of extensions: 585834
Number of successful extensions: 2110
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2109
Number of HSP's successfully gapped: 26
Length of query: 479
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 374
Effective length of database: 12,961,219
Effective search space: 4847495906
Effective search space used: 4847495906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)