Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08151g30430015920.0
Sklu_2251.929930011661e-162
ADL207W36029811521e-159
Kwal_27.1149429929811041e-153
YNL025C (SSN8)32331910951e-151
Scas_666.2633533210911e-150
CAGL0M06875g33933610441e-143
YPR025C (CCL1)3931851303e-08
CAGL0K05115g3671571269e-08
Scas_672.123741541241e-07
KLLA0E06666g3982461223e-07
Kwal_27.106413762431196e-07
AGL273C399174974e-04
YPR119W (CLB2)491128750.22
YGR109C (CLB6)38031710.60
Kwal_0.15558761700.85
CAGL0D04620g476110700.91
YGR108W (CLB1)471110700.92
CAGL0M11044g37992671.7
Scas_684.1833060662.2
Scas_705.1547989662.7
YOR124C (UBP2)1272160653.4
Kwal_23.2880324151644.2
AAR099W55589644.4
KLLA0D15543g539110636.3
CAGL0D02992g313175627.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08151g
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08151g complement(737811..738725) similar to sp|P47821 Sac...   617   0.0  
Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement        453   e-162
ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH] complement(...   448   e-159
Kwal_27.11494                                                         429   e-153
YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C ...   426   e-151
Scas_666.26                                                           424   e-150
CAGL0M06875g complement(699260..700279) highly similar to sp|P47...   406   e-143
YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C ...    55   3e-08
CAGL0K05115g complement(497262..498365) similar to sp|P37366 Sac...    53   9e-08
Scas_672.12                                                            52   1e-07
KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyce...    52   3e-07
Kwal_27.10641                                                          50   6e-07
AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH] (194015..19...    42   4e-04
YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific...    33   0.22 
YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyc...    32   0.60 
Kwal_0.155                                                             32   0.85 
CAGL0D04620g 453500..454930 highly similar to sp|P24869 Saccharo...    32   0.91 
YGR108W (CLB1) [2067] chr7 (703638..705053) G2/M-phase-specific ...    32   0.92 
CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869 Saccha...    30   1.7  
Scas_684.18                                                            30   2.2  
Scas_705.15                                                            30   2.7  
YOR124C (UBP2) [4926] chr15 complement(554824..558642) Ubiquitin...    30   3.4  
Kwal_23.2880                                                           29   4.2  
AAR099W [285] [Homologous to ScYPR119W (CLB2) - SH; ScYGR108W (C...    29   4.4  
KLLA0D15543g 1313760..1315379 similar to sp|P24869 Saccharomyces...    29   6.3  
CAGL0D02992g 311423..312364 similar to sp|P46962 Saccharomyces c...    28   7.8  

>KLLA0E08151g complement(737811..738725) similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8 DNA-directed RNA
           polymerase II holoenzyme and Kornberg s mediator (SRB)
           subcomplex subunit, cyclin C homolog singleton, start by
           similarity
          Length = 304

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQVTTNIPVT 60
           MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQVTTNIPVT
Sbjct: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQVTTNIPVT 60

Query: 61  QRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLIT 120
           QRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLIT
Sbjct: 61  QRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLIT 120

Query: 121 TCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYR 180
           TCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYR
Sbjct: 121 TCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYR 180

Query: 181 SLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCIIH 240
           SLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCIIH
Sbjct: 181 SLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCIIH 240

Query: 241 KPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLRQQT 300
           KPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLRQQT
Sbjct: 241 KPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLRQQT 300

>Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement
          Length = 299

 Score =  453 bits (1166), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 212/300 (70%), Positives = 254/300 (84%), Gaps = 5/300 (1%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQ---VTTNI 57
           MSASYW+S+QRHKW+YTRESLA+E+Q LWL+ECQLFP GL++ + +SK   Q   +T NI
Sbjct: 1   MSASYWESTQRHKWQYTRESLARERQNLWLMECQLFPHGLSIVMENSKNGGQQQSITRNI 60

Query: 58  PVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYL 117
           P++ +DLHYD+DYNLRIYCYFLIMKLGRRLNIRQCAL TAHVYLSRFLL+AS+REVNLYL
Sbjct: 61  PISHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLSRFLLKASIREVNLYL 120

Query: 118 LITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHH 177
           L+TTCIYLACKVEECPQHIRTLVNEARSLWPEF+PPD TKVTEFEFYLIEELQSYLIVHH
Sbjct: 121 LVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYLIVHH 180

Query: 178 PYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSC 237
           PYRS+E I  +L  E Y   LS ++LQ  WSLINDSY TD+HL+Y PHVIA++C+F   C
Sbjct: 181 PYRSMEHIVSSLREEPYQLALSPEDLQNSWSLINDSYITDLHLMYPPHVIAMACMFITVC 240

Query: 238 IIHKPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLR 297
           +  K   S ++   N F+AE+QV+L++VM ++Q+LI+LYDHWDKYNE  I+ LLH +YLR
Sbjct: 241 L--KKSVSHRQQTFNRFMAESQVDLQEVMNVIQDLITLYDHWDKYNEPWIKFLLHTVYLR 298

>ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH]
           complement(339219..340301) [1083 bp, 360 aa]
          Length = 360

 Score =  448 bits (1152), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 245/298 (82%), Gaps = 1/298 (0%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQ-VTTNIPV 59
           MSASYWDSSQR+KW+Y+RESLA+ +QKLW+LECQL+PQG N+ +     + Q VT NIP+
Sbjct: 29  MSASYWDSSQRNKWQYSRESLARTRQKLWMLECQLYPQGTNILMEGGGKDAQPVTKNIPI 88

Query: 60  TQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLI 119
           T RDLHYDRDYNLRIYCYFLIMKLGRRLN+RQ AL TAHVYL+RF L+AS+REVNLYLL+
Sbjct: 89  THRDLHYDRDYNLRIYCYFLIMKLGRRLNVRQYALATAHVYLARFCLKASIREVNLYLLV 148

Query: 120 TTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPY 179
           TTCIYLACKVEECPQHIRTLVNEARSLWPEF+PPD TKVTEFEFYLIEELQSY+IVH+PY
Sbjct: 149 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQSYMIVHYPY 208

Query: 180 RSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCII 239
           R++EQI  AL    YN  LS D+LQ  WSLINDSY TDVHLLY PHVIA++CLF   C+ 
Sbjct: 209 RAMEQIAAALRRPPYNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMACLFITVCLR 268

Query: 240 HKPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLR 297
                   +   N F+A++QV+L +VM  +Q+ I+LYDHWDKYNE  I+ LLH LYLR
Sbjct: 269 SAAGARDLQETFNRFMADSQVDLHEVMDTIQDFITLYDHWDKYNEPWIKFLLHNLYLR 326

>Kwal_27.11494
          Length = 299

 Score =  429 bits (1104), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/298 (68%), Positives = 246/298 (82%), Gaps = 2/298 (0%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQ-VTTNIPV 59
           MSASYW+S+QR KW+YTRE L +E+ +LWLLECQLFPQGL VT+ ++K   + V+ NIP+
Sbjct: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTMENNKGTGEPVSRNIPI 60

Query: 60  TQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLI 119
           T  D+HY +D+NLRIYCYFLIMKLGRRLNIRQ AL TAHVYL+RFLLRASVREVNLYLL+
Sbjct: 61  THIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASVREVNLYLLV 120

Query: 120 TTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPY 179
           TTCIYLACKVEECPQHIRTLVNEARSLWPEF+PPD TKVTEFEFYL+EELQSYL+VHHPY
Sbjct: 121 TTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQSYLVVHHPY 180

Query: 180 RSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCII 239
           R++EQI  AL +E YN  LS  +LQ  WSLINDSY TD+HLL  PHVIA++ L  + C +
Sbjct: 181 RAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMASLLIIVC-L 239

Query: 240 HKPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYNELRIRALLHELYLR 297
            +P     +   N F+A++QV+L +VM  +Q+LI+LYD+WDKYNE  I+ LLH LYLR
Sbjct: 240 QRPHRPAHQETFNNFMAKSQVDLAEVMDTIQDLITLYDYWDKYNEPWIKFLLHCLYLR 297

>YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C
           homolog, component of RNA polymerase holoenzyme complex
           and Kornberg's mediator (SRB) subcomplex [972 bp, 323
           aa]
          Length = 323

 Score =  426 bits (1095), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 250/319 (78%), Gaps = 23/319 (7%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKAN---KQVTTNI 57
           MS S+W S+QRH W+YT+ SLAKE+QKLWLLECQLFPQGLN+ + DSK N   + +T NI
Sbjct: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVM-DSKQNGIEQSITKNI 59

Query: 58  PVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYL 117
           P+T RDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ AL TAH+YLSRFL++ASVRE+NLY+
Sbjct: 60  PITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYM 119

Query: 118 LITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHH 177
           L+TTC+YLACKVEECPQ+IRTLV+EAR+LWPEFIPPD TKVTEFEFYL+EEL+SYLIVHH
Sbjct: 120 LVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELESYLIVHH 179

Query: 178 PYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSC 237
           PY+SL+QI + L    +   LS D+LQ  WSLINDSY  DVHLLY PH+IA++CLF    
Sbjct: 180 PYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITIS 239

Query: 238 I-----------------IHKPEDSTKRANI--NMFIAETQVNLEQVMFILQELISLYDH 278
           I                 I  P++S+    I  N F+AE+ V+LE+VM  +QE I+LYDH
Sbjct: 240 IHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDTIQEQITLYDH 299

Query: 279 WDKYNELRIRALLHELYLR 297
           WDKY+E  I+ LLH LYLR
Sbjct: 300 WDKYHEQWIKFLLHTLYLR 318

>Scas_666.26
          Length = 335

 Score =  424 bits (1091), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 249/332 (75%), Gaps = 32/332 (9%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKAN---------- 50
           MS SYW S+QRH W++T+ SLAKE+QKLW+LECQLFPQGLN+T+   K N          
Sbjct: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60

Query: 51  KQVTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASV 110
           +  T NIP+T RDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCAL TAH+YLSRFLLR SV
Sbjct: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120

Query: 111 REVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQ 170
           REVNLYLL+TT +YLACKVEECPQ+IRTLV+EARSLWPEF+PPD TKVTEFEFYL+EEL+
Sbjct: 121 REVNLYLLVTTTVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTEFEFYLLEELE 180

Query: 171 SYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAIS 230
           SYLIVHHPYR LEQI + L  E +   L+ D+LQ  WSLINDSY TD +L+Y PH+IA+S
Sbjct: 181 SYLIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240

Query: 231 CLFAVSCI----IHKPEDSTKRANI------------------NMFIAETQVNLEQVMFI 268
           CLF    +     +    +TK  N+                  N+++A++QV+LE+VM  
Sbjct: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300

Query: 269 LQELISLYDHWDKYNELRIRALLHELYLRQQT 300
           +QE I+LYDHWDKY+E  ++ LLH LYLR  +
Sbjct: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSS 332

>CAGL0M06875g complement(699260..700279) highly similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8, start by
           similarity
          Length = 339

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 244/336 (72%), Gaps = 40/336 (11%)

Query: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKANKQ-------- 52
           MS SYW S QR KW++T+ SLA+E+Q+LW++ECQLFPQGLN+ + DSK N          
Sbjct: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIV-DSKPNSADSSNGNAA 59

Query: 53  -------------VTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHV 99
                         T NIP+T RDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ AL TAH+
Sbjct: 60  NNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHI 119

Query: 100 YLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVT 159
           YLSRFLL+ASVREVNLYLL+TTC+YLACKVEECPQ+IRTLV+EARSLWPEFIPPD TKVT
Sbjct: 120 YLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVT 179

Query: 160 EFEFYLIEELQSYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVH 219
           EFEFYLIEELQ YLIVHHPY+S+EQI +AL  E +    + DELQ  WSLINDS+  DVH
Sbjct: 180 EFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVH 239

Query: 220 LLYSPHVIAISCLFAVSCIIHK-----------PEDSTKRANIN-------MFIAETQVN 261
           L Y+PH+IA++CLF    I               E  T ++++         F+AE+ V+
Sbjct: 240 LTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSSLTPQQQTFFRFLAESHVD 299

Query: 262 LEQVMFILQELISLYDHWDKYNELRIRALLHELYLR 297
           LE+VM  +Q+ I LYDHWD+Y+E  I+ LLH LYLR
Sbjct: 300 LEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLR 335

>YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C
           component of RNA polymerase transcription initiation
           factor TFIIH, required for PolII transcription, for
           nucleotide excision repair, and for activity of Kin28p
           [1182 bp, 393 aa]
          Length = 393

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 87/185 (47%), Gaps = 22/185 (11%)

Query: 5   YWDSSQRHKWKYTRESLAKEK-----QKLWLLECQL--FPQGLNVTIHDSKANKQVTTNI 57
           Y  SSQ   W YT++ L +++     + +  +E  L  F +  N+T  + K  +     I
Sbjct: 49  YRHSSQYRMWSYTKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEEIKVLE--AKAI 106

Query: 58  PVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYL 117
           P+T      + + +L  +    +  + + LN+    + TA  +  RF L  SV +++   
Sbjct: 107 PLT-----MEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLENSVMQIDPKS 161

Query: 118 LITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHH 177
           ++ T I+LACK E     + +   +A+S            V +FEF L+E L+  L+ HH
Sbjct: 162 IVHTTIFLACKSENYFISVDSFAQKAKSTR--------DSVLKFEFKLLESLKFSLLNHH 213

Query: 178 PYRSL 182
           PY+ L
Sbjct: 214 PYKPL 218

>CAGL0K05115g complement(497262..498365) similar to sp|P37366
           Saccharomyces cerevisiae YPR025c Cyclin, hypothetical
           start
          Length = 367

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 17/157 (10%)

Query: 83  LGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNE 142
           + +++++    + T+  +  RF L  SV EV    ++ T I+LACK E     + +   +
Sbjct: 117 IAQKMSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFLACKSENYFISVNSFAEK 176

Query: 143 ARSLWPEFIPPDVTKVT--EFEFYLIEELQSYLIVHHPYRSLE----QIEKALSSEKYNY 196
           A++          TK T  ++EF L+E L+  L+ HHPY+ L      I+K L   K + 
Sbjct: 177 AKA----------TKETILKYEFKLLETLKFTLMNHHPYKPLHGFFLDIQKTLHG-KIDL 225

Query: 197 KLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLF 233
           K      +K    I ++  TD    Y+P  I ++ L 
Sbjct: 226 KYMGKIYEKCKKRITEALLTDAVYFYTPPQITLATLM 262

>Scas_672.12
          Length = 374

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 13/154 (8%)

Query: 83  LGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNE 142
           + + LN+    + T+  +  +F L  SV + +   L+ T I+LACK E     + +   +
Sbjct: 135 ISQHLNLPTEIIATSISFFKKFFLENSVMQYDPKSLVHTTIFLACKAENYFISVDSFAKK 194

Query: 143 ARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLE----QIEKALSSEKYNYKL 198
           A+S        +   + ++EF L+E L+  L++HHPY+ L      I+  L   K +   
Sbjct: 195 AKS--------NREAILKYEFKLLESLKFSLLIHHPYKPLHGFFLDIQNVLHG-KVDLNY 245

Query: 199 SDDELQKIWSLINDSYTTDVHLLYSPHVIAISCL 232
                 K    I ++  TDV  L++P  I ++ L
Sbjct: 246 MGQIYDKCKKKITEAILTDVVYLFTPPQITLAIL 279

>KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyces
           cerevisiae YPR025c CCL1 TFIIH subunit (transcription
           initiation factor), cyclin C component, start by
           similarity
          Length = 398

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 103/246 (41%), Gaps = 38/246 (15%)

Query: 5   YWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLN--VTIHDSKANKQVTT----NIP 58
           Y  SSQ   W +T+E L   ++ L         + L   ++ H+  + +++       +P
Sbjct: 58  YRHSSQYRLWSFTKEQLESRRRALNAKVVDKVNEKLQDIISKHNDLSQEELNAINEKAVP 117

Query: 59  VTQRDLHYDRDYNLRIYCYFL--IMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLY 116
           VT  +        L+   +F   +      LN+      TA  +  RF L  S  E++  
Sbjct: 118 VTMEE-------ELKFVNFFAKKVQSFCHSLNLPTEVCATAISFFRRFFLVNSTMEIHPK 170

Query: 117 LLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVH 176
            ++   I+LACK E     I     + +S          T + ++EF ++E LQ  L+ H
Sbjct: 171 HILLASIFLACKSENYFIGIEAFAKKTKS--------QPTTILKYEFDVLESLQFTLLNH 222

Query: 177 HPYRSLE----QIEKALSSE-KYNYKLSDDELQKIWS----LINDSYTTDVHLLYSPHVI 227
           HPYR L      I+  L  +   NY      + +I++     I ++  TDV   Y+P  I
Sbjct: 223 HPYRPLHGFFLDIQYILHGKVDLNY------MGQIYTNCKRRITETLLTDVVYHYTPPQI 276

Query: 228 AISCLF 233
            ++CL 
Sbjct: 277 TLACLL 282

>Kwal_27.10641
          Length = 376

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 99/243 (40%), Gaps = 34/243 (13%)

Query: 75  YCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEECPQ 134
           Y   +++    ++N+      TA  +  +F L  SV E++   +  T ++ ACK E    
Sbjct: 100 YFARMLLSFANKMNLPTEVAATAISFFRKFYLSNSVAELSPKEIFHTALFFACKSENYFI 159

Query: 135 HIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLE----QIEKALS 190
            + +   +AR+            V + EF L+E L   ++ HHPY++L      I+  L+
Sbjct: 160 GVESFAKKARTT--------TEAVLKHEFRLLESLNFTIMNHHPYKALHGFFLDIQTVLA 211

Query: 191 SEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAISCLFAVSCIIHK--------- 241
             K + K            I D+  TD    Y+P  I ++ L      +           
Sbjct: 212 G-KVDMKYMGQVYTDCKKFITDALLTDAVYFYTPPQITLATLLMADETLTMRYLQLKFDI 270

Query: 242 -PEDSTKRANINMFIAETQ--------VNLEQVMFILQ---ELISLYDHWDKYNELRIRA 289
            P+DS   A+ +    E +        ++ ++++ +L+   E+IS      K   +++ A
Sbjct: 271 VPDDSVGAASTDEVAKENENPKGTSLSIDGKKLLKVLKECREVISKKPSSAKEEAVKVTA 330

Query: 290 LLH 292
            +H
Sbjct: 331 KIH 333

>AGL273C [4039] [Homologous to ScYPR025C (CCL1) - SH]
           (194015..195214) [1200 bp, 399 aa]
          Length = 399

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 24/174 (13%)

Query: 69  DYNLRIYCYFL--IMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLA 126
           D  L++  ++   +   G  L +      TA  +  +F L  SV E++   ++ T I+LA
Sbjct: 99  DEELKLVNFYAKKVRHFGNSLELPTEVTATAISFFRKFFLTNSVMELHPKNILWTTIFLA 158

Query: 127 CKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLE--- 183
           CK E     I +      +   E I        ++E+ L+E L+  L+ HHPY++L    
Sbjct: 159 CKSENYFLGIDSFSKA--TTRKELI-------LKYEYTLLESLKFTLMNHHPYKALHGFF 209

Query: 184 -QIEKALSSEKYNYKLSDDELQKIWS----LINDSYTTDVHLLYSPHVIAISCL 232
             I+  L       K+  D +  I++     I D+  TD   +Y+P  I ++ L
Sbjct: 210 LDIQSVLKG-----KVDLDYMGLIYTSAKKKITDALLTDAVYMYTPPQITLAVL 258

>YPR119W (CLB2) [5540] chr16 (771649..773124) G2/M-phase-specific
           cyclin [1476 bp, 491 aa]
          Length = 491

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 12/128 (9%)

Query: 62  RDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITT 121
           R++H +RD    I   +L+ K+  +  +    L  A   + RFL +  V+   L L+ T+
Sbjct: 255 RNIHQNRD----ILVNWLV-KIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGTS 309

Query: 122 CIYLACKVEEC-PQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYR 180
           C+++A K EE     I+   +E      E       ++ E E ++++ L+  L   +P  
Sbjct: 310 CLFIASKYEEVYSPSIKHFASETDGACTE------DEIKEGEKFILKTLKFNLNYPNPMN 363

Query: 181 SLEQIEKA 188
            L +I KA
Sbjct: 364 FLRRISKA 371

>YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyclin
           appearing late in G1, involved in initiation of DNA
           synthesis [1143 bp, 380 aa]
          Length = 380

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 101 LSRFLLRASVREVNLYLLITTCIYLACKVEE 131
           L RFL +  V+   L LL  TC+++ACK EE
Sbjct: 184 LDRFLSQNVVKLNKLQLLCITCLFIACKFEE 214

>Kwal_0.155
          Length = 587

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 214 YTTDVHLLYSPHVIAISCLFAVSCIIHKPEDSTKRA----NINMFIAETQVNLEQVMFIL 269
           +  D  LLYSP  +A+   F V+  + + E+  +RA     +     + ++ LEQ +F L
Sbjct: 501 FKQDSSLLYSPAAVAMRDAFEVNNALQRNEEDKRRAPHGDTLGQLQEDEEMTLEQDLFQL 560

Query: 270 Q 270
           +
Sbjct: 561 R 561

>CAGL0D04620g 453500..454930 highly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2, start by
           similarity
          Length = 476

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 7/110 (6%)

Query: 80  IMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEEC-PQHIRT 138
           ++K+  +  +    L  A   + RFL +  V+   L L+ T+C+++A K EE     I+ 
Sbjct: 253 LVKIHNKFGLLPETLYLAVNLMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKH 312

Query: 139 LVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLEQIEKA 188
             +E      E       ++ E E ++++ L+  L   +P   L +I KA
Sbjct: 313 FASETDGACTE------DEIKEGEKFILKTLEFNLNYPNPMNFLRRISKA 356

>YGR108W (CLB1) [2067] chr7 (703638..705053) G2/M-phase-specific
           cyclin [1416 bp, 471 aa]
          Length = 471

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 7/110 (6%)

Query: 80  IMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEEC-PQHIRT 138
           I+K+  +  +    L  A   + RFL    V+   L L+ T+C+++A K EE     I+ 
Sbjct: 248 IIKIHNKFGLLPETLYLAINIMDRFLCEEVVQLNRLQLVGTSCLFIASKYEEIYSPSIKH 307

Query: 139 LVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLEQIEKA 188
              E            V  + E E +++E+L   +   +P   L +I KA
Sbjct: 308 FAYETDGACS------VEDIKEGERFILEKLDFQISFANPMNFLRRISKA 351

>CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2 cyclin,
           G2/M-specific, hypothetical start
          Length = 379

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 80  IMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEEC-PQHIRT 138
           ++K+ + L +    L      + +FL++  +      LL  TC+Y+A K EE  P  I  
Sbjct: 164 VIKIHQNLKLENETLYMTIDLIDKFLIKKKLPIEKFQLLGLTCLYIASKYEEVLPPSIFQ 223

Query: 139 LVNEARSLWPEFIPPDVTKVTEFEFYLIEELQ 170
              E+  ++      D  ++ E EF ++E L 
Sbjct: 224 FALESNGIF------DSEEIKESEFNILETLN 249

>Scas_684.18
          Length = 330

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%)

Query: 82  KLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVN 141
           +L  RLN  +  L TA  Y  R+ L  S      Y L T+C+ L+CK  E  + I  + N
Sbjct: 51  ELCTRLNFPRKTLETALYYYQRYHLFNSFETELCYTLATSCLVLSCKQVETMKKINEICN 110

>Scas_705.15
          Length = 479

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 101 LSRFLLRASVREVNLYLLITTCIYLACKVEEC-PQHIRTLVNEARSLWPEFIPPDVTKVT 159
           + RFL +  V+   L L+ T+C+++A K EE     I+   +E      E       ++ 
Sbjct: 276 MDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHYASETDGACTE------EEIK 329

Query: 160 EFEFYLIEELQSYLIVHHPYRSLEQIEKA 188
           E E ++++ L+  L   +P   L +I KA
Sbjct: 330 EGEKFILKTLEFTLNYPNPMNFLRRISKA 358

>YOR124C (UBP2) [4926] chr15 complement(554824..558642)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), cleaves at the C-terminus of ubiquitin [3819
           bp, 1272 aa]
          Length = 1272

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 68/160 (42%), Gaps = 20/160 (12%)

Query: 73  RIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIY-LACKVEE 131
           R   Y LI   G++  I Q AL  A +         ++ E+N   L++   Y  + K + 
Sbjct: 490 RKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYKYETSNKSQV 549

Query: 132 CPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLEQIEKALSS 191
              H+  L N  R L         TK  + +FY         + H PYR+L Q    LS 
Sbjct: 550 TSNHLTNLKNALRLLAK------YTKSDKLKFY---------VDHEPYRALSQAYDTLSI 594

Query: 192 EKYNYKLSDDELQKIWSL-INDSYTTDVHLLYSPHVIAIS 230
           ++    + +D ++  +S+ INDS    +    + + IAIS
Sbjct: 595 DE---SVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAIS 631

>Kwal_23.2880
          Length = 324

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 62/151 (41%), Gaps = 11/151 (7%)

Query: 93  ALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLW----- 147
            L TA  +  RF L         Y + T+C++L+CK  E  + +  LV  +  L      
Sbjct: 59  TLETAMYFYQRFYLFNKFETEMCYDVATSCLFLSCKQVETMKKVADLVAVSLRLRSVVKA 118

Query: 148 -PEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKI 206
            PE       ++ + E  ++E       V++       I+  L     + KLS +     
Sbjct: 119 SPEMQDNCKKRIFQLELRILETCSFDYRVNNTI----HIDDILVKIGKDLKLSHEVCYLA 174

Query: 207 WSLINDSYTTDVHLLYSPHVIAISCLFAVSC 237
           W +  D+   ++ L+   H IAI+ L  ++C
Sbjct: 175 WLIAFDALKLEILLMVPQHTIAIAVL-KIAC 204

>AAR099W [285] [Homologous to ScYPR119W (CLB2) - SH; ScYGR108W
           (CLB1) - SH] complement(520484..522151) [1668 bp, 555
           aa]
          Length = 555

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 7/89 (7%)

Query: 101 LSRFLLRASVREVNLYLLITTCIYLACKVEEC-PQHIRTLVNEARSLWPEFIPPDVTKVT 159
           + RFL +  V+   L L+ T C+++A K EE     ++    E           D  ++ 
Sbjct: 348 MDRFLGKELVQLEKLQLVGTACLFIASKYEEVYSPSVKHFAYETDGAC------DEEEIK 401

Query: 160 EFEFYLIEELQSYLIVHHPYRSLEQIEKA 188
           E E ++++ LQ  L   +P   L +I KA
Sbjct: 402 EGEKFILKTLQFNLNYPNPMNFLRRISKA 430

>KLLA0D15543g 1313760..1315379 similar to sp|P24869 Saccharomyces
           cerevisiae YPR119w CLB2 cyclin, G2/M-specific,
           hypothetical start
          Length = 539

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 49/110 (44%), Gaps = 7/110 (6%)

Query: 80  IMKLGRRLNIRQCALVTAHVYLSRFLLRASVREVNLYLLITTCIYLACKVEEC-PQHIRT 138
           ++K+  +  +    L  A   + RFL +  V+   L L+ T C+++A K EE     ++ 
Sbjct: 314 MVKIHNKFGLLPETLYLALNIMDRFLCKELVQLEKLQLVGTACLFIASKYEEVYSPSVKH 373

Query: 139 LVNEARSLWPEFIPPDVTKVTEFEFYLIEELQSYLIVHHPYRSLEQIEKA 188
              E           D  ++ E E ++++ L+  L   +P   L +I KA
Sbjct: 374 FAYETDGAC------DEEEIKEGEKFILKTLEFNLNYPNPMNFLRRISKA 417

>CAGL0D02992g 311423..312364 similar to sp|P46962 Saccharomyces
           cerevisiae YJL006c CTK2 carboxy-terminal domain kinase,
           hypothetical start
          Length = 313

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 76/175 (43%), Gaps = 14/175 (8%)

Query: 116 YLLITTCIYLACKVEECPQHIRTLVNEARSLWPEF-IPPDVTKVTEFEFYLIEELQSYLI 174
           Y++ T+C+ L+CK  E  + +  +   + SL     +  +V +  +   +++E L+    
Sbjct: 83  YIIATSCLVLSCKEVETIKKVNDICTVSLSLRNTGKVSGEVLENFKKRVFVME-LKVLES 141

Query: 175 VHHPYRSLEQIEKALSSEKYNYKLSDD-----ELQKI-WSLINDSYTTDVHLLYSPHVIA 228
               YR    I  A+  ++Y  K         EL  I W +  D   T++ LL   HVI+
Sbjct: 142 CSFDYR----INDAVHVDEYIIKFGKTLGLSYELCHIAWCIAFDVLKTELLLLVPQHVIS 197

Query: 229 ISCLFAVSCIIHKPEDSTKRANINMFIAETQVNLEQVMFILQELISLYDHWDKYN 283
           ++C+   S I+  P    K  +I  F  +  +  E    +L   I+ +D  D  N
Sbjct: 198 LACIKLASGILDVPVAIEK--SIQQFEMDNPMFSEAYFELLNFYINSFDSCDLKN 250

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,615,370
Number of extensions: 391919
Number of successful extensions: 1665
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1667
Number of HSP's successfully gapped: 41
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)