Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08129g36936317360.0
Sklu_2251.835936310981e-150
Kwal_27.1148935736210811e-147
ADL206W37237010191e-138
CAGL0M10219g3973033598e-39
Scas_668.204252913336e-35
YKL008C (LAC1)4182953265e-34
CAGL0K02739g4313013143e-32
Kwal_26.78864223013134e-32
YHL003C (LAG1)4113023072e-31
Sklu_2243.44092952932e-29
Scas_717.234302782881e-28
ABR009W4132852633e-25
KLLA0B13497g4083842615e-25
KLLA0E18832g31636691.4
YER171W (RAD3)77836663.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08129g
         (363 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08129g complement(736008..737117) weakly similar to sp|P28...   673   0.0  
Sklu_2251.8 , Contig c2251 7738-8817 reverse complement               427   e-150
Kwal_27.11489                                                         421   e-147
ADL206W [1535] [Homologous to ScYHL003C (LAG1) - NSH] complement...   397   e-138
CAGL0M10219g complement(1020895..1022088) similar to sp|P28496 S...   142   8e-39
Scas_668.20                                                           132   6e-35
YKL008C (LAC1) [3248] chr11 complement(426938..428194) Protein r...   130   5e-34
CAGL0K02739g complement(246652..247947) highly similar to sp|P38...   125   3e-32
Kwal_26.7886                                                          125   4e-32
YHL003C (LAG1) [2282] chr8 complement(100643..101878) Protein re...   122   2e-31
Sklu_2243.4 YHL003C, Contig c2243 7329-8558                           117   2e-29
Scas_717.23                                                           115   1e-28
ABR009W [600] [Homologous to ScYHL003C (LAG1) - SH; ScYKL008C (L...   105   3e-25
KLLA0B13497g 1181036..1182262 similar to sp|P28496 Saccharomyces...   105   5e-25
KLLA0E18832g complement(1664971..1665921) similar to sp|P38356 S...    31   1.4  
YER171W (RAD3) [1599] chr5 (527077..529413) DNA helicase compone...    30   3.8  

>KLLA0E08129g complement(736008..737117) weakly similar to sp|P28496
           Saccharomyces cerevisiae YKL008c LAC1 protein required
           with LAG1P for ER-to-Golgi transport of GPI-anchored
           proteins P2.313.f2.1, hypothetical start
          Length = 369

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/363 (93%), Positives = 338/363 (93%)

Query: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRYXXXXXXXX 60
           MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRY        
Sbjct: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRYSVLLSSIL 60

Query: 61  XXXXFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV 120
               FVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV
Sbjct: 61  LSLLFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV 120

Query: 121 LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD 180
           LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD
Sbjct: 121 LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD 180

Query: 181 QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN 240
           QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN
Sbjct: 181 QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN 240

Query: 241 XXXXXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN 300
                        SFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN
Sbjct: 241 VILILMDIVDVLLSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN 300

Query: 301 LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR 360
           LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR
Sbjct: 301 LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR 360

Query: 361 SDE 363
           SDE
Sbjct: 361 SDE 363

>Sklu_2251.8 , Contig c2251 7738-8817 reverse complement
          Length = 359

 Score =  427 bits (1098), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 214/363 (58%), Positives = 252/363 (69%), Gaps = 8/363 (2%)

Query: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRYXXXXXXXX 60
           MS ELRQR  S  A P               + +  S      K  SKVD+Y        
Sbjct: 1   MSGELRQR-PSAQAQPK-------HVSSHEHKEKHHSHHTMQRKVASKVDQYSVALSILM 52

Query: 61  XXXXFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV 120
               ++ + F P+Y+ KF +LQY+Y   PG+YDIGIDD Y+++TFIV   LVRSFLLE+V
Sbjct: 53  LSFLYLLHCFKPQYSYKFTHLQYQYASAPGRYDIGIDDTYMVMTFIVALVLVRSFLLEYV 112

Query: 121 LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD 180
           LKP+   +F + S KS QR+ EQGWS+ YY FSW FGFYLYY+SPY+ N DHIY GWPHD
Sbjct: 113 LKPIAFYKFKIHSNKSQQRYAEQGWSLAYYSFSWCFGFYLYYNSPYFLNCDHIYLGWPHD 172

Query: 181 QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN 240
           +LSG FK YYL QIASW  QIIVLNVEERRKD WQMFAHHIIT  LTTGSYYYYFTRIG+
Sbjct: 173 KLSGTFKVYYLLQIASWLQQIIVLNVEERRKDHWQMFAHHIITCLLTTGSYYYYFTRIGH 232

Query: 241 XXXXXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN 300
                        S AKMLKYCG+ST CDYMFV+FL +WV LRH +YNY+ Y  W +A++
Sbjct: 233 VILILMDIVDVLLSSAKMLKYCGFSTACDYMFVIFLVFWVALRHGIYNYVFYHAWAKARD 292

Query: 301 LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR 360
           LMA G C     QKRCWTP V+++FL LLGGLQVIT IWM+LI+KVL+KVIKG GAEDVR
Sbjct: 293 LMAMGRCGLTPDQKRCWTPFVIDVFLGLLGGLQVITIIWMFLIVKVLIKVIKGAGAEDVR 352

Query: 361 SDE 363
           SDE
Sbjct: 353 SDE 355

>Kwal_27.11489
          Length = 357

 Score =  421 bits (1081), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 246/362 (67%), Gaps = 10/362 (2%)

Query: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFKPVSKVDRYXXXXXXXX 60
           MSSEL+ R +          H   E K  R  +    + +   K  S+VD+Y        
Sbjct: 1   MSSELKHRKN----------HEAHEPKIPRDPAVPKPAVRRQKKVASRVDQYSCLLSAAF 50

Query: 61  XXXXFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFV 120
               ++     PE T KF  LQY+Y D P  YDIGIDD Y+++T IV   LVRSFLLE+V
Sbjct: 51  LAILYLVGQVKPELTHKFTTLQYQYVDAPDAYDIGIDDAYIVVTCIVALVLVRSFLLEYV 110

Query: 121 LKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHIYSGWPHD 180
           LKP+  ++FH+RS KS QR+ EQGWS++YY FSW+ GFYLYY+SPY+ N DHIY GWPHD
Sbjct: 111 LKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYLYYNSPYFLNCDHIYLGWPHD 170

Query: 181 QLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGN 240
           + S  FK YYL QIASW  QI+VLNVEERRKD+WQMFAHHIIT  LT GSYYYYF RIG+
Sbjct: 171 RFSATFKIYYLLQIASWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYYFNRIGH 230

Query: 241 XXXXXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKN 300
                        S AKMLKYCG++T CDYMF VFL +WV+LRH+ YNY+ Y    +A  
Sbjct: 231 LILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPG 290

Query: 301 LMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR 360
           LM+ G+C+A   QKRCWTP ++++FL LLGGLQVIT IWM LI+KVL+K++KG  AEDVR
Sbjct: 291 LMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWMALIIKVLIKILKGGSAEDVR 350

Query: 361 SD 362
           SD
Sbjct: 351 SD 352

>ADL206W [1535] [Homologous to ScYHL003C (LAG1) - NSH]
           complement(340558..341676) [1119 bp, 372 aa]
          Length = 372

 Score =  397 bits (1019), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 244/370 (65%), Gaps = 7/370 (1%)

Query: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFK-------PVSKVDRYX 53
           MS ++RQR +    A S  E  +  K  A    ++    +            VSKVD Y 
Sbjct: 1   MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVELEEREELLPIRGQLAVSKVDLYT 60

Query: 54  XXXXXXXXXXXFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVR 113
                       VG      +  KF+ LQY   ++PGKYDIGIDD Y++ TF+VV CLVR
Sbjct: 61  VYASGALLVALAVGFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFVVVLCLVR 120

Query: 114 SFLLEFVLKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHI 173
           S LLEFVLKP+   +F + S K  QR+GEQ WSM+YY  SW+ GFYLYYHSPY+ N DHI
Sbjct: 121 SSLLEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFLNCDHI 180

Query: 174 YSGWPHDQLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYY 233
           Y  WPHD+++G+FK YYL QIASW  QIIVLNVEE+RKD+WQMFAHHIITVALTTGSYYY
Sbjct: 181 YLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVALTTGSYYY 240

Query: 234 YFTRIGNXXXXXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQ 293
           YF RIG+             S AK+LKYCG+S  CDYMFVVFL +WV+LRH VYNY+ + 
Sbjct: 241 YFNRIGHVILIIMDVVDILLSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHH 300

Query: 294 TWLRAKNLMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKG 353
            W +++ LM +  C       RCWTP V++IF+ LL GLQ+IT IW +LI+KV +KVI+G
Sbjct: 301 AWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRG 360

Query: 354 IGAEDVRSDE 363
            GAEDVRSD+
Sbjct: 361 SGAEDVRSDD 370

>CAGL0M10219g complement(1020895..1022088) similar to sp|P28496
           Saccharomyces cerevisiae YKL008c protein required with
           LAG1 or sp|P38703 Saccharomyces cerevisiae YHL003c LAG1,
           hypothetical start
          Length = 397

 Score =  142 bits (359), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 154/303 (50%), Gaps = 12/303 (3%)

Query: 66  VGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVG 125
           + N     +   FV + YE   NP  Y  GI D   +   ++ F  +R FL++ +++ + 
Sbjct: 90  ISNKRVKGFLHMFVAISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRIT 149

Query: 126 RNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSP-YYFNIDHIYSGWPHDQLSG 184
           +   ++ S   ++R  EQ +S+ YY FS  FG Y+ YHS  +YF  + +Y+ +P   +  
Sbjct: 150 Q-WLNITSKYKIKRMMEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPK 208

Query: 185 LFKTYYLFQIASWFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXX 242
           LFK +YL Q A W  Q  ++VL +E+ RKD  ++  HH++T+ L   SY ++F ++G   
Sbjct: 209 LFKAFYLIQAAFWAQQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAV 268

Query: 243 XXXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLM 302
                      + +K L Y   S L + +F +F+  W+ LRHV+   +    W       
Sbjct: 269 YITMDVSDFFLALSKTLNYID-SPLTEVVFGMFVLVWIYLRHVINGKIL---WSVLTEFR 324

Query: 303 ADGECIAGLA--QKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVR 360
            +G  I   A  Q +CW    + I   L+  LQV+   W++LI KVL K++     EDVR
Sbjct: 325 TEGPYILNFATQQYKCWIS--LPIVFVLIFALQVLNIYWLFLIFKVLYKIVWQGVTEDVR 382

Query: 361 SDE 363
           SDE
Sbjct: 383 SDE 385

>Scas_668.20
          Length = 425

 Score =  132 bits (333), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 149/291 (51%), Gaps = 15/291 (5%)

Query: 78  FVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGRNRFHMRSVKSL 137
           FV + Y+  D+  +Y  GI D   +  +++ F  +R FLL+ VL+P+  +  H  S    
Sbjct: 124 FVAVSYQV-DDTDEYAKGIKDLCFVFYYMIFFTFLREFLLDVVLRPIP-DILHANSKHKS 181

Query: 138 QRFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGLFKTYYLFQIAS 196
           +R  EQ + ++YY FS  FG Y+ YHS  + F    +Y  +P      LFK +YL Q A 
Sbjct: 182 KRIIEQMFYIVYYGFSAPFGLYVMYHSNLWLFKTAPMYETYPDLTNPFLFKVFYLGQAAF 241

Query: 197 WFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXXXXXXXXXXXXS 254
           W  Q  ++VL +E+ RKD  +M  HHI+T+ L   SY ++FTRIG              S
Sbjct: 242 WAQQACVLVLQLEKPRKDHQEMIFHHIVTLLLVWSSYVFHFTRIGLAIYITMDISDFLLS 301

Query: 255 FAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMADGECIAGLA-- 312
            +K+  Y   S     +F +F+  W+ LRH +   + +      + +   G+ +   A  
Sbjct: 302 LSKIFNYLD-SPFTPPVFFIFVTTWIYLRHYINIKILWSVLTEFRTV---GDYVLDFATQ 357

Query: 313 QKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI-KGIGAEDVRSD 362
           Q +CW    + I   L+  LQ++   W++LI ++L +++ KGI  ED RSD
Sbjct: 358 QYKCWIS--LPIVFTLIAALQLVNLYWLFLIFRILYRMVWKGI-VEDTRSD 405

>YKL008C (LAC1) [3248] chr11 complement(426938..428194) Protein
           required with Lag1p for ceramide synthesis and
           ER-to-Golgi transport of GPI-anchored proteins [1257 bp,
           418 aa]
          Length = 418

 Score =  130 bits (326), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 149/295 (50%), Gaps = 16/295 (5%)

Query: 67  GNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGR 126
           GN+       +FV + Y+  D    Y  GI+D   +  +++ F  +R FL++ V++P   
Sbjct: 102 GNTTKTNVLHRFVAVSYQIGDT-NAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFAI 160

Query: 127 NRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSP-YYFNIDHIYSGWPHDQLSGL 185
            R H+ S   ++R  EQ +++ Y   S  FG Y  YHS  ++FN   +Y  +P      L
Sbjct: 161 -RLHVTSKHRIKRIMEQMYAIFYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFL 219

Query: 186 FKTYYLFQIASWFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXX 243
           FK +YL Q A W  Q  I+VL +E+ RKD  ++  HHI+T+ L   SY ++FT++G    
Sbjct: 220 FKVFYLGQAAFWAQQACILVLQLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIY 279

Query: 244 XXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQT-WLRAKNLM 302
                     SF+K L Y   S L  + F +F+  W+ LRH    Y+  +  W       
Sbjct: 280 ITMDVSDFLLSFSKTLNYLD-SGLAFFSFAIFVVAWIYLRH----YINLKILWSVLTQFR 334

Query: 303 ADGECIAGLA--QKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI-KGI 354
            +G  +   A  Q +CW    + I   L+G LQ++   W++LI +VL +++ +GI
Sbjct: 335 TEGNYVLNFATQQYKCWIS--LPIVFVLIGALQLVNLYWLFLIFRVLYRILWRGI 387

>CAGL0K02739g complement(246652..247947) highly similar to sp|P38703
           Saccharomyces cerevisiae YHL003c longevity-assurance
           protein, hypothetical start
          Length = 431

 Score =  125 bits (314), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 147/301 (48%), Gaps = 13/301 (4%)

Query: 67  GNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGR 126
           GN         FV + Y   D   +Y  GI D   I   ++ F  +R FL++ V++P+ R
Sbjct: 109 GNRTETNPLHMFVAISYRIGDT-DRYGKGIKDLAFIFYHMIFFTFLREFLMDVVIRPITR 167

Query: 127 NRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGL 185
              ++ S   ++R  EQ +++ Y   S  FG Y+ YHS  + F    +Y+ +P      L
Sbjct: 168 -ILNITSRHKVKRMMEQMYALFYCGCSGPFGLYIMYHSDLWLFKTKEMYNSYPDFTNPFL 226

Query: 186 FKTYYLFQIASWFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXX 243
           +K +YL Q A W  Q  ++VL +E  RKD+ ++  HHI+T+ L   SY ++FT++G    
Sbjct: 227 YKVFYLGQAAFWSQQACVLVLQLERPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLSIY 286

Query: 244 XXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMA 303
                     S +K+L Y   S     +F+VF+  W+ LRHVV   +    W        
Sbjct: 287 ITMDISDFFLSLSKILNYLD-SIFTPPVFLVFVGSWIYLRHVVNIRI---LWSVLTEFKT 342

Query: 304 DGECIAGLA--QKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKGIGAEDVRS 361
           +G  +   A  Q +CW      I   L+  LQ++   W++LI K+L+++I     +D RS
Sbjct: 343 EGNYVLNFATSQYKCWISQ--PIVFVLIFALQLVNLYWLFLIFKILLRLIFKGEQKDERS 400

Query: 362 D 362
           D
Sbjct: 401 D 401

>Kwal_26.7886
          Length = 422

 Score =  125 bits (313), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 146/301 (48%), Gaps = 10/301 (3%)

Query: 67  GNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGR 126
           GN         FV + Y+  D+   Y  GI D   ++ +++ F  +R FL+E  L+P+  
Sbjct: 96  GNRTASNPLHPFVAVSYQIGDS-NLYGKGIKDLLFVIFYMIFFTFLREFLMEVALRPLA- 153

Query: 127 NRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGL 185
           +   + S     R  EQ +S+IYY  S  FG Y+ YHS  + F    +Y+ +P      +
Sbjct: 154 SALGVVSQHKTNRIMEQTYSIIYYGISGPFGLYIMYHSDLWLFKTAPMYATYPDLTNQFM 213

Query: 186 FKTYYLFQIASWFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXX 243
            K +YL Q A W  Q  I+ L +E+ RKDF ++  HHI+T+AL   SY ++FT +G    
Sbjct: 214 TKVFYLGQAAFWTQQACILTLQLEKPRKDFKELVFHHIVTLALIWLSYVFHFTNMGLAVY 273

Query: 244 XXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMA 303
                     S +K L Y   S L    F++F+  WV LRH + N     + L     + 
Sbjct: 274 ITMDVSDFFLSLSKTLNYLD-SALAAPFFMLFVCSWVYLRHYI-NIKILWSVLTEFRTIG 331

Query: 304 DGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI-KGIGAEDVRSD 362
           D        Q +CW    + I   L+  LQ++   W++LI++VL +++ +GI  +D    
Sbjct: 332 DYTLNFATQQYKCWIS--LPIVFTLISALQLVNLYWLFLIVRVLYRILFQGIQKDDRSES 389

Query: 363 E 363
           E
Sbjct: 390 E 390

>YHL003C (LAG1) [2282] chr8 complement(100643..101878) Protein
           required with Lac1p for ceramide synthesis and
           ER-to-Golgi transport of GPI-anchored proteins,
           indirectly affects cell longevity [1236 bp, 411 aa]
          Length = 411

 Score =  122 bits (307), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 150/302 (49%), Gaps = 15/302 (4%)

Query: 67  GNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGR 126
           GN         FV + Y+  D    Y  GI D   +  +++ F  +R FL++ V++P   
Sbjct: 102 GNRTESNPLHMFVAISYQV-DGTDSYAKGIKDLSFVFFYMIFFTFLREFLMDVVIRPFTV 160

Query: 127 NRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGL 185
              ++ S    +R  EQ +++ Y   S  FG Y+ YHS  + F    +Y  +P      L
Sbjct: 161 -YLNVTSEHRQKRMLEQMYAIFYCGVSGPFGLYIMYHSDLWLFKTKPMYRTYPVITNPFL 219

Query: 186 FKTYYLFQIASWFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXX 243
           FK +YL Q A W  Q  ++VL +E+ RKD+ ++  HHI+T+ L   SY ++FT++G    
Sbjct: 220 FKIFYLGQAAFWAQQACVLVLQLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLAIY 279

Query: 244 XXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMA 303
                     S +K L Y   S    ++F +F+F+W+ LRHVV   +    W        
Sbjct: 280 ITMDVSDFFLSLSKTLNYLN-SVFTPFVFGLFVFFWIYLRHVVNIRI---LWSVLTEFRH 335

Query: 304 DGECIAGLA--QKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI-KGIGAEDVR 360
           +G  +   A  Q +CW    + I   L+  LQ++   W++LIL++L ++I +GI  +D R
Sbjct: 336 EGNYVLNFATQQYKCWIS--LPIVFVLIAALQLVNLYWLFLILRILYRLIWQGI-QKDER 392

Query: 361 SD 362
           SD
Sbjct: 393 SD 394

>Sklu_2243.4 YHL003C, Contig c2243 7329-8558
          Length = 409

 Score =  117 bits (293), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 143/295 (48%), Gaps = 10/295 (3%)

Query: 67  GNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGR 126
           GN         FV + Y+  D    Y  G+ D   +  +++ F  +R FL+E +L+P+  
Sbjct: 97  GNRTASNPLHMFVAISYQVGDT-RMYGKGVKDLCFVFFYMIFFTFLREFLMELLLRPLS- 154

Query: 127 NRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGL 185
            +  +     ++R  EQ +S+IYY  S  FG Y+ Y +  + F    +Y  +P      L
Sbjct: 155 IKLGITKEHKIRRMMEQAYSIIYYGISGPFGLYIMYQTDLWLFATAPMYKTYPDMTNEYL 214

Query: 186 FKTYYLFQIASWFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXX 243
           +K +YL Q + W  Q  ++VL +E+ RKDF ++  HHIIT+AL   SY ++FT++G    
Sbjct: 215 YKIFYLGQASFWTQQACVLVLQLEKPRKDFKELVFHHIITLALIWLSYVFHFTKMGLAVY 274

Query: 244 XXXXXXXXXXSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMA 303
                     + +K   Y   STL    F +F+  W+ LRH V N     + L     + 
Sbjct: 275 ITMDVSDFFLALSKTFNYLD-STLTAPFFFLFVVSWIYLRHYV-NIKILWSVLTEFRTVG 332

Query: 304 DGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI-KGIGAE 357
           D        Q +CW      I  AL+  LQ++   W +LIL++L +++ KGI  +
Sbjct: 333 DYTLNFATQQYKCWISQ--PIVFALIFALQLVNLYWFFLILRILYRLVFKGIQKD 385

>Scas_717.23
          Length = 430

 Score =  115 bits (288), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 138/278 (49%), Gaps = 15/278 (5%)

Query: 79  VNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGRNRFHMRSVKSLQ 138
           V+ Q E  D  GK   GI D   +  +++ F  +R F+++ V++P+   + ++ S   ++
Sbjct: 122 VSYQIEETDQYGK---GIKDLCFVFFYMIFFTFLREFMMDMVIRPITI-KLNVTSGHKMK 177

Query: 139 RFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGLFKTYYLFQIASW 197
           R  EQ + +IYY  S  FG Y+ Y++  + F    +Y  +P    + L+K +YL Q A W
Sbjct: 178 RIMEQAFYIIYYGISGPFGLYIMYNTDLWLFETKTMYQTYPDFNNTFLYKLFYLGQAAFW 237

Query: 198 FHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXXXXXXXXXXXXSF 255
             Q  ++VL +E+ RKDF ++  HHI+T+ L   SY ++FTR+G              + 
Sbjct: 238 AQQACVLVLQLEKPRKDFKELVFHHIVTLLLIWSSYTFHFTRMGLAIYITMDVSDFFLAL 297

Query: 256 AKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMADGECIAGLA--Q 313
            K + Y   S     +F  F+  W+ LRH V   +    W        +G  +   A  Q
Sbjct: 298 TKTVNYLD-SKFTPPIFFTFIVVWIYLRHYVNIKI---LWSVLTEFRTEGNYVLNFATQQ 353

Query: 314 KRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI 351
            +CW    + I   L+  LQV+   W++LI ++L ++I
Sbjct: 354 YKCWIS--LPIVFTLIFALQVVNLYWLFLIFRILYRLI 389

>ABR009W [600] [Homologous to ScYHL003C (LAG1) - SH; ScYKL008C
           (LAC1) - SH] complement(408462..409703) [1242 bp, 413
           aa]
          Length = 413

 Score =  105 bits (263), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 138/285 (48%), Gaps = 10/285 (3%)

Query: 78  FVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVRSFLLEFVLKPVGRNRFHMRSVKSL 137
           FV + Y    N   Y  G+ D   +  ++V F  +R F++E VL+P+   R  +     +
Sbjct: 109 FVAISYRV-GNTNMYGKGVKDMCFVFYYMVFFTFLREFMMEMVLRPLT-FRLGVTKPHKV 166

Query: 138 QRFGEQGWSMIYYLFSWIFGFYLYYHSPYY-FNIDHIYSGWPHDQLSGLFKTYYLFQIAS 196
           +R  EQ +S  YY  S  FG ++ Y +  + F    +Y  +P       +K +YL Q A 
Sbjct: 167 KRMMEQAYSTFYYGLSGPFGLFVMYRTDLWLFKTAEMYKTYPDLTNEYYYKIFYLGQAAF 226

Query: 197 WFHQ--IIVLNVEERRKDFWQMFAHHIITVALTTGSYYYYFTRIGNXXXXXXXXXXXXXS 254
           W  Q  I+VL +E+ RKDF ++  HHI+T+AL + SY ++FT++G              +
Sbjct: 227 WAQQACILVLQLEKPRKDFRELVFHHIVTLALISLSYVFHFTKMGLAVYITMDVSDFFLA 286

Query: 255 FAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQTWLRAKNLMADGECIAGLAQK 314
            +K+  Y   S+    +F++F+  WV LRH V N     + L     + D        Q 
Sbjct: 287 LSKIFNYME-SSFTAPLFLLFVSSWVYLRHYV-NIKILWSVLTEFRTVGDYTLNFATEQY 344

Query: 315 RCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVI-KGIGAED 358
           + W    + I   L+  L ++   W+ LI ++L +++ +G+  ++
Sbjct: 345 KSW--IALPIVFGLIFALHLVNLYWLALIFRILYRMLFQGVQKDE 387

>KLLA0B13497g 1181036..1182262 similar to sp|P28496 Saccharomyces
           cerevisiae YKL008c LAC1 protein required with LAG1P for
           ER-to-Golgi transport of GPI-anchored proteins,
           hypothetical start
          Length = 408

 Score =  105 bits (261), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 100/384 (26%), Positives = 169/384 (44%), Gaps = 34/384 (8%)

Query: 2   SSELRQRHSSG--------SAAPSLTEHRFDEKKQARSRSRT---GSSSKHHFKPVSKV- 49
           S ELR+R ++         ++ PSL+     E+ +  S +R     SSS+     + K+ 
Sbjct: 7   SPELRRRRTTSIGRINLGDTSVPSLSTMSVTEESKHASEARLKLLSSSSEKDIDVLRKLW 66

Query: 50  -------DRYXXXXXXXXXXXXFV-----GNSFYPEYTKKFVNLQYEYPDNPGKYDIGID 97
                   R+            ++     GN         FV + Y+  D    Y  G  
Sbjct: 67  LSYRELSYRHSWLTSLLIISVIYLFYICSGNRTASNPLHMFVAISYQIGDT-NMYGKGPK 125

Query: 98  DGYVILTFIVVFCLVRSFLLEFVLKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFG 157
           D   +  +++ F  +R F+++ +L+P+       R  K ++R  EQ +S+ YY  S  FG
Sbjct: 126 DLCFVFFYMIFFTFLREFIMQVILRPLSIKMGSTRENK-IRRMMEQMYSIFYYSISGPFG 184

Query: 158 FYLYYHSPYY-FNIDHIYSGWPHDQLSGLFKTYYLFQIASWFHQ--IIVLNVEERRKDFW 214
            Y+ YH+  + F  D +Y  +P      L+K +YL Q A W  Q  ++ L +E+ RKDF 
Sbjct: 185 LYIMYHTDLWLFRTDTMYKTYPDFNNEYLYKIFYLGQAAFWTQQSCVLTLQLEKPRKDFQ 244

Query: 215 QMFAHHIITVALTTGSYYYYFTRIGNXXXXXXXXXXXXXSFAKMLKYCGYSTLCDYMFVV 274
           ++  HHI+T+AL   SY ++FT++G              S +K   Y   S+L    F+ 
Sbjct: 245 ELIFHHIVTLALIWLSYVFHFTKMGLSVYVTMDVSDFFLSLSKTFNYLD-SSLTPPFFLF 303

Query: 275 FLFWWVMLRHVVYNYLTYQTWLRAKNLMADGECIAGLAQKRCWTPTVVNIFLALLGGLQV 334
           F+  WV LRH + N     + L     + +        Q +CW      I   LL  L +
Sbjct: 304 FIVSWVYLRHYI-NLKILWSLLTEFTTVGNYTLNFATQQYKCWISQ--PIIFVLLFALHL 360

Query: 335 ITCIWMYLILKVLVK-VIKGIGAE 357
           +   W++ I ++L + V+ GI  +
Sbjct: 361 LNLFWLFFIARILYRLVVHGIQKD 384

>KLLA0E18832g complement(1664971..1665921) similar to sp|P38356
           Saccharomyces cerevisiae YBR290w BSD2 metal homeostasis
           protein singleton, hypothetical start
          Length = 316

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 310 GLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILK 345
           G+ +K   TP +  IF+ LLGG  +I  IW Y+ +K
Sbjct: 266 GVMEKTRHTPALA-IFVILLGGFIIIKSIWDYIKVK 300

>YER171W (RAD3) [1599] chr5 (527077..529413) DNA helicase component
           of RNA polymerase II transcription initiation factor
           TFIIH (factor b), also a component of the nucleotide
           excision repairosome [2337 bp, 778 aa]
          Length = 778

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 254 SFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNY 289
           SF K+LKYC   TLC Y  V  +     +  ++Y+Y
Sbjct: 177 SFEKLLKYCEEKTLCPYFIVRRMISLCNI--IIYSY 210

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.142    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,263,912
Number of extensions: 455391
Number of successful extensions: 1494
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1468
Number of HSP's successfully gapped: 20
Length of query: 363
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 260
Effective length of database: 13,030,455
Effective search space: 3387918300
Effective search space used: 3387918300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)