Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08107g1829180193170.0
Sklu_2124.11830179875610.0
Kwal_27.119511869179872240.0
YBR208C (DUR1,2)1835180268950.0
Scas_721.401834179965570.0
CAGL0M05533g1834179962680.0
ADR051C1819179859110.0
Kwal_14.180311744466981e-74
CAGL0K06787g11754466972e-74
YBR218C (PYC2)11804596962e-74
KLLA0C05764g11734596944e-74
Scas_686.1711764466846e-73
CAGL0F06941g11804486766e-72
YGL062W (PYC1)11784596695e-71
Scas_563.1212164336482e-68
AAR162C11714596445e-68
Sklu_1458.111324386321e-66
YMR207C (HFA1)21234815872e-60
KLLA0F06072g22315085828e-60
Scas_720.7422315085747e-59
AAR071W22315085748e-59
CAGL0L10780g22335085712e-58
YNR016C (ACC1)22335085659e-58
Kwal_23.615722305105641e-57
Kwal_23.42494652462651e-23
KLLA0A09845g4692342519e-22
CAGL0M13585g4672592482e-21
Scas_684.254822052455e-21
ABR140C4632062366e-20
YMR293C4644462233e-18
Kwal_56.222955831682048e-16
Sklu_2417.115911672021e-15
Sklu_2417.105911672021e-15
Scas_721.665731501744e-12
Sklu_1884.25461831556e-10
YDR242W (AMD2)5491481476e-09
Sklu_2072.34502061449e-09
Kwal_34.157245561261394e-08
Sklu_2136.36171271333e-07
KLLA0B08800g5701441315e-07
CAGL0L05676g22113001316e-07
KLLA0E15444g22283001291e-06
YJL130C (URA2)22143001291e-06
ACR263C22403001281e-06
Kwal_27.104385691411233e-06
Scas_582.4*21933001201e-05
Kwal_33.1406122213011155e-05
Sklu_2331.122203001121e-04
KLLA0D12628g5781381092e-04
Kwal_14.783128043800.54
Sklu_2413.41122195790.65
ABR157W1113195790.74
Scas_691.191117195780.92
Kwal_55.197831121168781.0
Kwal_27.1148547161771.1
KLLA0F03190g1117195761.6
Sklu_2372.4128043752.1
KLLA0A02365g42246723.9
CAGL0C04917g1113195725.2
KLLA0C18975g128643715.4
YJR109C (CPA2)1118195707.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08107g
         (1801 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  3593   0.0  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         2917   0.0  
Kwal_27.11951                                                        2787   0.0  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  2660   0.0  
Scas_721.40                                                          2530   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  2419   0.0  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  2281   0.0  
Kwal_14.1803                                                          273   1e-74
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   273   2e-74
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   272   2e-74
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   271   4e-74
Scas_686.17                                                           268   6e-73
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   265   6e-72
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   262   5e-71
Scas_563.12                                                           254   2e-68
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   252   5e-68
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         248   1e-66
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   230   2e-60
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   228   8e-60
Scas_720.74                                                           225   7e-59
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   225   8e-59
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   224   2e-58
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   222   9e-58
Kwal_23.6157                                                          221   1e-57
Kwal_23.4249                                                          106   1e-23
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...   101   9e-22
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...   100   2e-21
Scas_684.25                                                            99   5e-21
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...    96   6e-20
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...    91   3e-18
Kwal_56.22295                                                          83   8e-16
Sklu_2417.11 , Contig c2417 20071-21846                                82   1e-15
Sklu_2417.10 , Contig c2417 20071-21846                                82   1e-15
Scas_721.66                                                            72   4e-12
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         64   6e-10
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    61   6e-09
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                60   9e-09
Kwal_34.15724                                                          58   4e-08
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                56   3e-07
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    55   5e-07
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    55   6e-07
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    54   1e-06
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    54   1e-06
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    54   1e-06
Kwal_27.10438                                                          52   3e-06
Scas_582.4*                                                            51   1e-05
Kwal_33.14061                                                          49   5e-05
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            48   1e-04
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    47   2e-04
Kwal_14.783                                                            35   0.54 
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          35   0.65 
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    35   0.74 
Scas_691.19                                                            35   0.92 
Kwal_55.19783                                                          35   1.0  
Kwal_27.11485                                                          34   1.1  
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    34   1.6  
Sklu_2372.4 YKL215C, Contig c2372 8103-11945                           33   2.1  
KLLA0A02365g 211300..212568 similar to sgd|S0005681 Saccharomyce...    32   3.9  
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    32   5.2  
KLLA0C18975g complement(1684573..1688433) similar to sp|P28273 S...    32   5.4  
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    32   7.8  

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 3593 bits (9317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1749/1801 (97%), Positives = 1749/1801 (97%)

Query: 1    MESTLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNIL 60
            MESTLGWSVQDWLSFHSKSTPT            QKPAPEDPAWISLIPVEDLHHQWNIL
Sbjct: 1    MESTLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNIL 60

Query: 61   QSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGK 120
            QSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGK
Sbjct: 61   QSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGK 120

Query: 121  TNLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRV 180
            TNLDQFATGLVGTRSPYGKTPCVFNDKY                IVPLSLGTDTAGSGRV
Sbjct: 121  TNLDQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRV 180

Query: 181  PAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYS 240
            PAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYS
Sbjct: 181  PAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYS 240

Query: 241  REFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLEL 300
            REFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLEL
Sbjct: 241  REFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLEL 300

Query: 301  ARCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGIL 360
            ARCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAV          EYKRQGIL
Sbjct: 301  ARCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGIL 360

Query: 361  QKVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFR 420
            QKVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFR
Sbjct: 361  QKVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFR 420

Query: 421  SDGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDT 480
            SDGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDT
Sbjct: 421  SDGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDT 480

Query: 481  LNGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVND 540
            LNGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVND
Sbjct: 481  LNGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVND 540

Query: 541  GTGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDI 600
            GTGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDI
Sbjct: 541  GTGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDI 600

Query: 601  TKFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKY 660
            TKFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKY
Sbjct: 601  TKFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKY 660

Query: 661  SQHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQE 720
            SQHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQE
Sbjct: 661  SQHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQE 720

Query: 721  NIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKS 780
            NIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLI              YPVMVKS
Sbjct: 721  NIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKS 780

Query: 781  TAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFG 840
            TAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFG
Sbjct: 781  TAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFG 840

Query: 841  KAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYD 900
            KAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYD
Sbjct: 841  KAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYD 900

Query: 901  EQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEAR 960
            EQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEAR
Sbjct: 901  EQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEAR 960

Query: 961  LYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAI 1020
            LYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAI
Sbjct: 961  LYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAI 1020

Query: 1021 MKLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANT 1080
            MKLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANT
Sbjct: 1021 MKLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANT 1080

Query: 1081 SVQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVI 1140
            SVQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVI
Sbjct: 1081 SVQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVI 1140

Query: 1141 AVSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRST 1200
            AVSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRST
Sbjct: 1141 AVSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRST 1200

Query: 1201 FAMGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGV 1260
            FAMGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGV
Sbjct: 1201 FAMGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGV 1260

Query: 1261 TCGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAH 1320
            TCGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAH
Sbjct: 1261 TCGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAH 1320

Query: 1321 DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYG 1380
            DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYG
Sbjct: 1321 DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYG 1380

Query: 1381 VARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRY 1440
            VARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRY
Sbjct: 1381 VARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRY 1440

Query: 1441 ILVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKC 1500
            ILVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKC
Sbjct: 1441 ILVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKC 1500

Query: 1501 LIAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADV 1560
            LIAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADV
Sbjct: 1501 LIAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADV 1560

Query: 1561 NDIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGI 1620
            NDIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGI
Sbjct: 1561 NDIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGI 1620

Query: 1621 GGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELE 1680
            GGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELE
Sbjct: 1621 GGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELE 1680

Query: 1681 VIIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANA 1740
            VIIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANA
Sbjct: 1681 VIIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANA 1740

Query: 1741 ELKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800
            ELKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV
Sbjct: 1741 ELKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800

Query: 1801 G 1801
            G
Sbjct: 1801 G 1801

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 2917 bits (7561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1387/1798 (77%), Positives = 1557/1798 (86%), Gaps = 2/1798 (0%)

Query: 4    TLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNILQSK 63
            TLGWS QDW+ FH KSTP             QK APEDPAWISLI   +L HQW +LQSK
Sbjct: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64

Query: 64   SNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTNL 123
            +NK++LPLYGVPIAVKDNID KG PTTAACP++ Y P+ DS VV LL+DAGA+VIGKTNL
Sbjct: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124

Query: 124  DQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAA 183
            DQFATGLVGTRSPYGKTPCVF+DK+                IVP++LGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGRVPAA 184

Query: 184  LNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSREF 243
            LNNLIGLKPTKG FSC GVVPACKSLDCVSVFA+NLSDAE  FKVM KPDL  DEYSR  
Sbjct: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244

Query: 244  PKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELARC 303
            P NP+ +YPK++TIAIPKEVPW+GETENPKLY KA+ +LK  GA IV +DFEPLL LARC
Sbjct: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304

Query: 304  LYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGILQKV 363
            LYEGAWVAERY AT+DF ATNPPESSLD TV +IIK A           EY+RQGILQKV
Sbjct: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364

Query: 364  NLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSDG 423
            +  LKDIDVLCVPTCPLNP  EEVA EPVLVNSRQGTWTNFVNLAD+AALAVP+GFR DG
Sbjct: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424

Query: 424  LPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITV-EDELDGPSKDTLN 482
            LP G+TLIGKKF+D+ALL+LA R+F VAFP  SRT+GKF+DR++T  +DEL GP     +
Sbjct: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484

Query: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542
             VKLAVVGAHLKGLPL+WQL+K NATYL SPKTS NYKLYALPK GP+LKPGLRRV + T
Sbjct: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544

Query: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602
            GSQIQLEVYSVP + FG+FI+MVPEPLGIGSVELESGEWVKSFICEEFGYTQ+GTVDITK
Sbjct: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604

Query: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662
            +GGFK YI+ ++  EA+ KKPFETVLIANRGEIAVRI+KTLK++ I+SVAVYSDPDKYSQ
Sbjct: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664

Query: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722
            HV DAD  VAL+GRTAAETYLDIDKII AAK T AQAIIPGYGFLSENA+F+D+C +E I
Sbjct: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724

Query: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKSTA 782
            VFVGPSG+AIRKLGLKHSAREIAE+A VPLVPGSGL+              YPVMVKSTA
Sbjct: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784

Query: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842
            GGGGIGLQKVDSE++IERVFETVQHQGK+YFGD+GVF+ERFV NARHVEIQMMGDG+GKA
Sbjct: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844

Query: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902
            IAIGERDCSLQRRNQK+IEETPAPNL E TR KMR A+E LGSLLKYKCAGTVEFIYDE+
Sbjct: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904

Query: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962
            RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAA+D+PDF++  I V+GASIEARLY
Sbjct: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964

Query: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022
            AENP KDFRPSPG LT V FP WARVDTWV KGT VSAEYDPTLAKIIVHGKDRNDAIMK
Sbjct: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024

Query: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082
            +N+ALNET VYGCITNIDYLRSIASS+MFK AKVATK+LDS+DYKPCAFEV +PGA T+V
Sbjct: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084

Query: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142
            QDYPGR GYWRIGVPPSGPMD+YSFRLANR+VGN+ K+PA+E+TLNGPK+LFHTET+IA+
Sbjct: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETIIAI 1144

Query: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202
            SGG  +C+LND  I QN+PI+V RGD L++GK++VGCRAYL+IRGGIDVPEYLGSRSTFA
Sbjct: 1145 SGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204

Query: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262
            +GNMGGYNGR+LKLGDVLFLNQPEL+ SSLP P +EPQA P +LLP +S +K+W IGVTC
Sbjct: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264

Query: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322
            GPHGS D FK E +E+FF++KWKVHYNSNRFGVRLIGPKPKWAR DGGE GLHPSNAHDY
Sbjct: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324

Query: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382
            VYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV EAELWKVGQ+ PGD+IQFVP+SY VA
Sbjct: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384

Query: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442
            RQLKESQD +I+  E+G L  L+ D ILP YE+P+L  LPKKS+LSPKVTYRQAGDRYIL
Sbjct: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444

Query: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502
            VEYGE + DLNI YRIN+LI+ V +H+TVGIVEMSQGVRSVLIE+DG KI+Q ALL  L+
Sbjct: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504

Query: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562
            AYESEIQFDKNW++KSKIFKLP+AFEDSKTL+CVTRY+ETIRS+APWLPNNVDF+A+VND
Sbjct: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564

Query: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622
            I   DV+NMLYSA+F+VLGLGDVFLG+PCAVPLDPRHR+LG+KYNPSRTYT  GVVGIGG
Sbjct: 1565 ITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624

Query: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682
            MYMCIY A  SPGGYQLVGRTI  WDKL +G H  +HPWLLTPFDQVEFYPV+EEEL+  
Sbjct: 1625 MYMCIY-AMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRF 1683

Query: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742
             ED +NGKF + VEES+FDHK YL WINENI+SI  FQ++QGG KADEFARLIQVAN EL
Sbjct: 1684 TEDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQEL 1743

Query: 1743 KKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800
            + S  +K    EEYP+DAE++YSEY+GRFWKP+ + GD V  GDG++I+EAMKTEMVV
Sbjct: 1744 ESSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVV 1801

>Kwal_27.11951
          Length = 1869

 Score = 2787 bits (7224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1335/1798 (74%), Positives = 1519/1798 (84%), Gaps = 1/1798 (0%)

Query: 3    STLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNILQS 62
            +TLGWSVQDWL FH+++TP             QK APEDPAWISL+  E L HQW ILQS
Sbjct: 44   NTLGWSVQDWLGFHAEATPEASLAALSALIGAQKSAPEDPAWISLVSQEHLEHQWRILQS 103

Query: 63   KSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTN 122
            K +K+ELPLYGVPIAVKDNID  G  TTAACP + Y P+ DS VV LLRDAGA+VIGKTN
Sbjct: 104  KGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTN 163

Query: 123  LDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPA 182
            LDQFATGLVGTRSPYGKTPCVF++++                IVPL+LGTDTAGSGRVPA
Sbjct: 164  LDQFATGLVGTRSPYGKTPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDTAGSGRVPA 223

Query: 183  ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSRE 242
            ALNNLIGLKP+KG FSC GVVPACKSLDCVS+FALNL DAE  FKVM +PD  +DEYSR 
Sbjct: 224  ALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRA 283

Query: 243  FPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELAR 302
             P NP+ +Y KD TIA+P ++PW+ ETEN   Y  A+ +LK TGAK+V VDFEPLLELAR
Sbjct: 284  MPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELAR 343

Query: 303  CLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGILQK 362
            CLYEGAWVAERY ATRDF A NP ESSLD TV  IIKG            EYKRQGILQK
Sbjct: 344  CLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQK 403

Query: 363  VNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSD 422
            V+ LL+ IDVLCVPTCP NP   ++   PV +NSRQGTWTNFVNLADLAALAVP GFRSD
Sbjct: 404  VSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSD 463

Query: 423  GLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDTLN 482
            GLP GITLIGK F+DYALL+LA R+F +AFPNNSRTYGKF++  IT +D L GP   T +
Sbjct: 464  GLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTED 523

Query: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542
             +KLAVVGAHLKGLPLHWQL+K NA Y+ SPKTS NY+LYALPK GPVLKPGLRRV+   
Sbjct: 524  SIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEG 583

Query: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602
            G+QIQLEVYSVP D+FG FI+MVPEPLGIGSVELESGEWVKSFICEEFGYTQ GT DIT+
Sbjct: 584  GAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITE 643

Query: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662
             G FK Y++ +   E++KKKPFETVL+ANRGEIAVRI+KTLK++ IKSVAVYSDPDKYSQ
Sbjct: 644  LGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQ 703

Query: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722
            HVTDAD +VAL GRTAAETYLDIDKII AAK+TG +AIIPGYGFLSENADFSDRC+ E I
Sbjct: 704  HVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGI 763

Query: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKSTA 782
            VFVGP+GDAIRKLGLKHSAREIAE+A VPLVPGSGL+              YPVMVKSTA
Sbjct: 764  VFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTA 823

Query: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842
            GGGGIGLQKVDSE+DIERVFETVQHQGK+YFGD+GVF+ERFV NARHVEIQMMGDG GKA
Sbjct: 824  GGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKA 883

Query: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902
            IAIGERDCSLQRRNQKVIEETPAPNL E TRA+MR ASE LGSLLKY+CAGTVEFIYDE+
Sbjct: 884  IAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDER 943

Query: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962
            RDEFYFLEVNARLQVEHPITEMVTGLDLVEWML IAA   PDFD TKI V+GASIEARLY
Sbjct: 944  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLY 1003

Query: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022
            AENPVKDFRPSPGQLT VSFP WARVDTWV KGT +SAEYDPTLAKIIVHGKDR++AI K
Sbjct: 1004 AENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063

Query: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082
            LNQALNET++YGCITNIDYLRSIASS+MFK AKVATKVLDS+DY+P AFE+ +PGA T+V
Sbjct: 1064 LNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTV 1123

Query: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142
            QDYPGR  +WRIGVPPSGPMDSYSFRLANR+VGN+ K+PA+EITLNGPKLLFHT+ VIA+
Sbjct: 1124 QDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAI 1183

Query: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202
            +G    CT+N + ++QN+P+ VK+GD L+VGK++ GCRAYL+IRGGIDVPEYLGSRSTFA
Sbjct: 1184 TGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFA 1243

Query: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262
            +GNMGGYNGR+LKLGDVLFLNQPEL  S +PAP ++P   P SLLP +S +K+WKIGVTC
Sbjct: 1244 LGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTC 1303

Query: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322
            GPHGS D FK E +E+FF+++WKVHYNSNRFGVRLIGPKPKWAR DGGE GLHPSNAHDY
Sbjct: 1304 GPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1363

Query: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382
            VYSLGAINFTGDEPVIIT DGPSLGGFVCQAVV E ELWKVGQ+ PGD IQFVP+SY  A
Sbjct: 1364 VYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETA 1423

Query: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442
            R LKESQD++I+ FE GSL  L+ + +LP  ENP+LA LP+ S+ SPKVTYRQAGDRY+L
Sbjct: 1424 RVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVL 1483

Query: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502
            VEYGE E DLNI YR+NRLI+ VE+++T+GIVEMSQGVRSVL+EFDG KI+QKALL+ LI
Sbjct: 1484 VEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLI 1543

Query: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562
            AYE EI+FD+NW++KSK+FKLP+AFEDS+TL+CV RY+ETIRS+APWLPNNVDFIADVN 
Sbjct: 1544 AYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNG 1603

Query: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622
            I  +DV++MLY A+F+VLGLGDVFLG+PCAVPL+P HR+LG+KYNPSRTYT  G VGIGG
Sbjct: 1604 ISHSDVEDMLYQARFLVLGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGG 1663

Query: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682
            MYMCIY A  SPGGYQLVGRTI  WDKL +G H   HPWLLTPFDQVE+Y VTE+EL   
Sbjct: 1664 MYMCIY-AMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKF 1722

Query: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742
             E+ +NG+F + VEES FDH EYL WI+ N + I  FQ  Q GEKA+EFA+LIQ +NAEL
Sbjct: 1723 TEECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAEL 1782

Query: 1743 KKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800
            +K+ D +    EE+P+DAE++YSEY+GRFWKP+ +VGD V+AGDG+I++EAMKTEM+V
Sbjct: 1783 EKAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMV 1840

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 2660 bits (6895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1267/1802 (70%), Positives = 1488/1802 (82%), Gaps = 11/1802 (0%)

Query: 2    ESTLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNILQ 61
            E +LGWS+QDW+ FH  S+              Q  AP D AWISLI  E+L HQ+ IL+
Sbjct: 10   EISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILK 69

Query: 62   SKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKT 121
            S+ NKE LPLYGVPIAVKDNID +GLPTTAACPS+ Y+P++DS VVELLR+AGA+++GKT
Sbjct: 70   SRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKT 129

Query: 122  NLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVP 181
            NLDQFATGLVGTRSPYGKTPC F+ ++                IVP++LGTDTAGSGRVP
Sbjct: 130  NLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVP 189

Query: 182  AALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSR 241
            AALNNLIGLKPTKG FSC+GVVPACKSLDCVS+FALNLSDAE  F++M +PD   DEYSR
Sbjct: 190  AALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSR 249

Query: 242  EFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELA 301
             +  NP+ ++  ++TIAIPK +PW+GET+NP L++ AV +L  TGA ++ +DFEPLLELA
Sbjct: 250  PYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELA 309

Query: 302  RCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGILQ 361
            RCLYEG WVAERY A + FL + PP+ SLD TV++II+GA           EYKRQGILQ
Sbjct: 310  RCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQ 369

Query: 362  KVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRS 421
            KV  LL+ +DVLCVPTCPLNP +++VA EPVLVNSRQGTWTNFVNLADLAALAVP+GFR 
Sbjct: 370  KVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRD 429

Query: 422  DGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRIT-VEDELDGPSKDT 480
            DGLPNGITLIGKKF+DYALL+LA R+F   FPN SRTYG F    +    D+L GP  D 
Sbjct: 430  DGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDP 489

Query: 481  LNGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVND 540
               +KLAVVGAHLKGLPLHWQL+K NATYL + KTS  Y+L+ALPK GPVLKPGLRRV D
Sbjct: 490  STSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQD 549

Query: 541  GTGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDI 600
              GSQI+LEVYSVP + FG FI+MVPEPLGIGSVELESGEW+KSFICEE GY  +GTVDI
Sbjct: 550  SNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDI 609

Query: 601  TKFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKY 660
            TK+GGF+ Y E ++  E+QKKK F+TVLIANRGEIAVRI+KTLK++GI+SVAVYSDPDKY
Sbjct: 610  TKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKY 669

Query: 661  SQHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQE 720
            SQHVTDAD SV LHG TAA+TYLD++KII+AAK+T AQAIIPGYGFLSENADFSD C+  
Sbjct: 670  SQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSA 729

Query: 721  NIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKS 780
             I FVGPSGD IR LGLKHSAR+IA++A VPLVPGS LI              YPVMVKS
Sbjct: 730  GITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAELEYPVMVKS 789

Query: 781  TAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFG 840
            TAGGGGIGLQKVDSE+DIE +FETV+HQG+++FGDAGVF+ERF+ NARHVE+Q+MGDGFG
Sbjct: 790  TAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFG 849

Query: 841  KAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYD 900
            KAIA+GERDCSLQRRNQKVIEETPAPNLPE TR  +R A+E LGSLL YKCAGTVEFIYD
Sbjct: 850  KAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYD 909

Query: 901  EQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEAR 960
            E++DEFYFLEVN RLQVEHPITEMVTGLDLVEWM+RIAAND+PDFD+TK+EV+G S+EAR
Sbjct: 910  EKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEAR 969

Query: 961  LYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAI 1020
            LYAENP+K+FRPSPG L  V FP WARVDTWVKKGTN+S EYDPTLAKIIVHGKDR+DAI
Sbjct: 970  LYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAI 1029

Query: 1021 MKLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANT 1080
             KLNQAL ET VYGCITNIDYL+SI +S  F +AKV+T +L+S+ Y+P A E+  PGA+T
Sbjct: 1030 SKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHT 1089

Query: 1081 SVQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVI 1140
            S+QDYPGR GYWRIGVPPSGPMD+YSFRLANR+VGN+ ++PA+E+TL GP ++FH ETVI
Sbjct: 1090 SIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVI 1149

Query: 1141 AVSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRST 1200
            A++GGT  CTL+  +I Q++P+EVKRG  LS+GK+T GCRAYL IRGGIDVP+YLGS ST
Sbjct: 1150 AITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYST 1209

Query: 1201 FAMGNMGGYNGRILKLGDVLFL--NQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKI 1258
            F +GN+GGYNGR+LKLGDVLFL  N+   SV  L      PQ  P+SL+P +S  K+W+I
Sbjct: 1210 FTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECL------PQNIPQSLIPQISETKEWRI 1263

Query: 1259 GVTCGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSN 1318
            GVTCGPHGS D FK E IE+FF++KWKVHYNSNRFGVRLIGPKPKWARS+GGE G+HPSN
Sbjct: 1264 GVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSN 1323

Query: 1319 AHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLS 1378
             HDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVV EAELWKVGQ+ PGD+IQFVPLS
Sbjct: 1324 THDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLS 1383

Query: 1379 YGVARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGD 1438
            Y  +R LKESQD +I + +   L  L    ILP +E PILA + K ++LSPKV YRQAGD
Sbjct: 1384 YESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGD 1443

Query: 1439 RYILVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALL 1498
            RY+LVEYG+ E + NI YRI  LI  V++++T+GIVEMSQGVRSVLIEFDG K+ QK LL
Sbjct: 1444 RYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELL 1503

Query: 1499 KCLIAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIA 1558
            K L+AYE+EIQFD+NW + S I +LPMAFEDSKTL CV RY+ETIRS APWLPNNVDFIA
Sbjct: 1504 KVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIA 1563

Query: 1559 DVNDIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVV 1618
            +VN I RN+V +MLYSA+FMVLGLGDVFLGSPCAVPLDPRHR+LG+KYNPSRTYT RG V
Sbjct: 1564 NVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAV 1623

Query: 1619 GIGGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEE 1678
            GIGGMYMCIY A  SPGGYQLVGRTI  WDKL +     + PWL+ PFDQVEFYPV+EE+
Sbjct: 1624 GIGGMYMCIY-AANSPGGYQLVGRTIPIWDKLCLAASS-EVPWLMNPFDQVEFYPVSEED 1681

Query: 1679 LEVIIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVA 1738
            L+ + ED DNG +K+++E+S+FDH+EYL WIN N DSI AFQE Q GE+A+EFA+LIQ A
Sbjct: 1682 LDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNA 1741

Query: 1739 NAELKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEM 1798
            N+ELK+S   KP + E++P+ AE++YSEY+GRFWK +A+VGD +EAG G++IIEAMK EM
Sbjct: 1742 NSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEM 1801

Query: 1799 VV 1800
            ++
Sbjct: 1802 II 1803

>Scas_721.40
          Length = 1834

 Score = 2530 bits (6557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1190/1799 (66%), Positives = 1448/1799 (80%), Gaps = 4/1799 (0%)

Query: 2    ESTLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNILQ 61
            + TLGWS++DW+ FH   T              Q+ AP DPAW+SL   + L  QW ILQ
Sbjct: 7    KKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKKQWQILQ 66

Query: 62   SKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKT 121
             +S KE LPLYGVP+A+KDNID +G PTTAACPS+LY+P +DS VV+LLR+AGA++IGKT
Sbjct: 67   HRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGAIIIGKT 126

Query: 122  NLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVP 181
            NLDQFATGLVGTRSPYGKTPCVF+DK+                IVP++LGTDTAGSGRVP
Sbjct: 127  NLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVP 186

Query: 182  AALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSR 241
            AALNNLIGLKPTKG FSC+GVVPACKSLDCVSVF+LNLSDAE  FK++ + DL  DEYSR
Sbjct: 187  AALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLENDEYSR 246

Query: 242  EFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELA 301
             +P++P+ ++   +TI IPK++ W+GE ENP LY  A+  L+ +GA I  +DFEPLLELA
Sbjct: 247  TYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFEPLLELA 306

Query: 302  RCLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGILQ 361
            RCLYEG WVAERY A +DFL  NP     D  V +II  A           EYKRQG+LQ
Sbjct: 307  RCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQGLLQ 366

Query: 362  KVNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRS 421
            K++ LL++ID LCVPTCPLNP  E+V+ EP+LVNSRQGTWTNFVNLAD+AALA+PSGFRS
Sbjct: 367  KIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAIPSGFRS 426

Query: 422  DGLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDTL 481
            DGLP GITLIGKKF+D+ALLDLA+ +F +A+PNNSRT+G F +     +D++ GP   + 
Sbjct: 427  DGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSGPVISSS 486

Query: 482  NGVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDG 541
            + +KLAVVGAHLKGLPLHWQL+K NAT++SS KTS NY+LYALP+ GP+LKPGLRRVN+ 
Sbjct: 487  DSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGLRRVNE- 545

Query: 542  TGSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDIT 601
             G  IQ+E YS+P + FG FI+MVPEPLGIGSVELE+GEWVKSFICEE GYT +G+V+IT
Sbjct: 546  EGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAKGSVNIT 605

Query: 602  KFGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYS 661
            K+GGFK Y++ ++ T  + KKPF TVL+ANRGEIAVRI+KTLK+M I+SVA++S PD+YS
Sbjct: 606  KYGGFKTYLKFLE-TNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYS 664

Query: 662  QHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQEN 721
            QHV DAD +V L G +AA+TYL+I+KII+AAKKTGAQAIIPGYGFLSENADFS+RC  E 
Sbjct: 665  QHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEG 724

Query: 722  IVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKST 781
            I FVGPSGD +R LGLKHSAREIA++A VPLVPGS LI              YP+MVKST
Sbjct: 725  ITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPIMVKST 784

Query: 782  AGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGK 841
            AGGGGIGLQKV+SEDDIER+FETV+HQG +YFGD+GVFMERF+ NARHVE+Q+MGDG G 
Sbjct: 785  AGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGN 844

Query: 842  AIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDE 901
            A+AIGERDCSLQRRNQK+IEETPAPNLPE TR K+R A++RLGSLLKYKCAGTVEFIYDE
Sbjct: 845  ALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDE 904

Query: 902  QRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARL 961
             RDEFYFLEVN RLQVEHPITEMVTG+DLVEWML IAA+ +PDF+  KI+V+G ++EARL
Sbjct: 905  IRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVAMEARL 964

Query: 962  YAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIM 1021
            YAENPV DF+PSPGQL  V FP WAR+DTWV KGT V+ EYDPTLAKIIVHGKDR+DA+ 
Sbjct: 965  YAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDRHDALE 1024

Query: 1022 KLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTS 1081
            KLN+AL ET V GCITNIDYLRSI+SS+MF++AKV+T +L+S+DYKP A E++ PG++TS
Sbjct: 1025 KLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILPGSHTS 1084

Query: 1082 VQDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIA 1141
            +QDYPGR G WRIGVPPSGPMD++SFRLAN++VGNN K+PA EITLNGP +LFH + +I 
Sbjct: 1085 IQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHIDAIIG 1144

Query: 1142 VSGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTF 1201
            ++GG   C LN+ QI Q +PI V  GD LS+GK+  GCRAYL+IRGG+DVPEYLGS+STF
Sbjct: 1145 ITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLGSKSTF 1204

Query: 1202 AMGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVT 1261
             +GN GGY+GR LK+GD LF++Q +L+   LP  ++  Q    SLLP + T+K WKIGV 
Sbjct: 1205 TLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQWKIGVL 1264

Query: 1262 CGPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHD 1321
            CGPHGS D FK EY++ FF++KWKVHYNSNRFGVRL GPKP WAR DGGE GLHPSNAHD
Sbjct: 1265 CGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHPSNAHD 1324

Query: 1322 YVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGV 1381
            YVYSLGAINFTGDEPVI+TCDGPSLGGFVC AVVAE+ELWKVGQ+ PGD IQFVP+S+  
Sbjct: 1325 YVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVPISFES 1384

Query: 1382 ARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYI 1441
            AR+L +SQD +I+  E  SL  L D   LP  E+P+L +LP++  +SP++TYRQAGDRYI
Sbjct: 1385 ARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQAGDRYI 1444

Query: 1442 LVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCL 1501
            LVEYGE   DLNICYRI+ LI  V+ + T GIVEMSQGVRSVLIEFD   I+Q  LL  L
Sbjct: 1445 LVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQLLTLL 1504

Query: 1502 IAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVN 1561
            +AYE E+ + +NW V SK+ +LPMAFEDSKT+ CV RY+ETIRS APWLPNN DF+A++N
Sbjct: 1505 LAYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADFVANIN 1564

Query: 1562 DIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIG 1621
             I   DV +++YSA+FMVLGLGDVFLGSPCAVPLDPRHR LG+KYNPSRT+T RG VG+G
Sbjct: 1565 GITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERGAVGLG 1624

Query: 1622 GMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEV 1681
            GM+MCIY A  SPGGYQL+GRTI  WDKL++     + PWLL PFDQ+EFYPV+E+EL+ 
Sbjct: 1625 GMFMCIY-AASSPGGYQLMGRTIPIWDKLLLLSSS-EQPWLLNPFDQIEFYPVSEKELDR 1682

Query: 1682 IIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAE 1741
            + +D D GK+ +D  +  F+H +YL W++EN  SI  FQ  Q GE A++FA+LI+++NAE
Sbjct: 1683 LTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIELSNAE 1742

Query: 1742 LKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800
            L ++ + +   V +YP+++ ++YSEY+GRFWKP+   G+ V++G G+IIIEAMKTEM+V
Sbjct: 1743 LDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTEMLV 1801

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 2419 bits (6268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1147/1799 (63%), Positives = 1415/1799 (78%), Gaps = 6/1799 (0%)

Query: 4    TLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNILQSK 63
            ++GWS+QDW+ FH KSTP             Q+ APEDPAWIS+     L  QW +LQS+
Sbjct: 9    SIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQQWQLLQSR 68

Query: 64   SNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTNL 123
              KE+LPLYGVPIAVKDNID KG PTTAACPS+ Y PTRDS VVELL+ AGA++IGKTNL
Sbjct: 69   HEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIIIGKTNL 128

Query: 124  DQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAA 183
            DQFATGLVGTRSPYG+TPCVF+DK+                IVP++LGTDTAGSGRVPAA
Sbjct: 129  DQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 188

Query: 184  LNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSREF 243
            LNN+IGLKPT+G FSC GVVPACKSLDCVSVF++NLSDAE   K+M K D+  DEYSR F
Sbjct: 189  LNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDEYSRSF 248

Query: 244  PKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELARC 303
            P NP+  + K+LT+AIPK V W+GE ENP LY +A+ + K  GA+I ++DFEPLLELARC
Sbjct: 249  PANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLLELARC 308

Query: 304  LYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGILQKV 363
            LYEG WVAERY ATR FL T+P +S+LD  V  IIK A           EYKRQGIL+KV
Sbjct: 309  LYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQGILRKV 368

Query: 364  NLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSDG 423
             +LL+DIDVLCVPTCPLNP  EEV +EP+LVNSRQGTWTNFVNLADL+ALA+P GFRSDG
Sbjct: 369  EVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDG 428

Query: 424  LPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDE-LDGPSKDTLN 482
            LPNG+TLI KKF DYALL LAKRF +  +P+ +R YG F+DR + ++D+ L+GP   + +
Sbjct: 429  LPNGVTLIAKKFEDYALLQLAKRFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDD 488

Query: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542
             + LAVVGAHL+GLPLHWQL+K NAT++ S KT+  Y+LYALPK GPVLKPGLRR+  GT
Sbjct: 489  SIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGT 548

Query: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602
            GSQI+LE+YSVP ++FG+FI+ VPEPLGIGSVELE+G+WVKSFICEE GY   G++DI+ 
Sbjct: 549  GSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISH 608

Query: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662
            +GGF+ YIE I  +   KK  F+TVL+ANRGEIAVRI+KTLK M IKS+A+YS  DKYSQ
Sbjct: 609  YGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQ 668

Query: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722
            HV D D + AL G T  ETYL ++KII+ AKK    AIIPGYGFLSENA F+DRC QE I
Sbjct: 669  HVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGI 728

Query: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKSTA 782
             F+GP G+ IRKLGLKHSARE+A+ A VPLVPGS L+              YPVMVKSTA
Sbjct: 729  QFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTA 788

Query: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842
            GGGGIGLQKVD+E D+ + FETV+HQG SYFGD+GVFME+F++NARHVE+Q+MGDG GK 
Sbjct: 789  GGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKT 848

Query: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902
            +A+GERDCSLQRRNQKVIEETPAPNLP  TR KM  A+ERLG+ L Y+ AGTVEFIYDEQ
Sbjct: 849  LALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQ 908

Query: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962
            RD+FYFLEVN RLQVEHPITEMVTGLDLVEWM++I+A   P  D   I  +GASIE R+Y
Sbjct: 909  RDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVY 968

Query: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022
            AENP+KDFRPSPG+L  V FP+  RVDTWVKKGT +S E+DPTLAKIIVHGKDRN+AI+K
Sbjct: 969  AENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILK 1028

Query: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082
            + +ALNET +YGC+TN+DYL+S+ SS+MF+ A+++T  L++++Y P A E++ PGA T++
Sbjct: 1029 MKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI 1088

Query: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142
            QDYPGR  YWRIGVPP GPMD+YSFRLANR+VGN+ ++P +EITL GP + F++++++++
Sbjct: 1089 QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSI 1148

Query: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202
            +GG V C L++ +I   EPI VK G +LS+GK+  G RAYL+IRGGIDVP+Y+GS STF 
Sbjct: 1149 AGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFT 1208

Query: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262
            MGN+GG+NGR LK GDVL L Q   S   +P+P F P+ AP  + P +  +  W IGV  
Sbjct: 1209 MGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLA 1268

Query: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322
            GPHG+ D+F+ E + +FF  +WKVHYNSNRFGVRLIGPKPKW+R+DGGE GLHPSN HDY
Sbjct: 1269 GPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDY 1328

Query: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382
            VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVV+EAE+WKVGQL PGDTI F P+ +  A
Sbjct: 1329 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSA 1388

Query: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442
            R LKE+QD  I++    +L +LSD  +L   E+PIL     +   SPKV YRQAGDRYIL
Sbjct: 1389 RNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYIL 1448

Query: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502
            +EYG+  F+LN+CYRI  LI  + +  T GI EMSQGVRSVL+E+DG +I+QK LLK LI
Sbjct: 1449 IEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLI 1508

Query: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562
            AYE ++  +KNW+VKS+IF+LPMAFED +TL CV RY+ETIRS+APWLPNNVDF+A+VN+
Sbjct: 1509 AYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNN 1568

Query: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622
            +  +D++ ++Y+ ++MVLG+GDVFLGSPCA+PLDPR+R LG+KYNPSRT+T RGVVGIGG
Sbjct: 1569 LTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGG 1628

Query: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682
             YMCIY A+ SPGGYQLVGRTI  WD+L++     D PWLL+PFDQ+EFYPV+EE+++  
Sbjct: 1629 SYMCIYAAD-SPGGYQLVGRTIPIWDRLMLQSKK-DEPWLLSPFDQIEFYPVSEEQIDEY 1686

Query: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742
             ++ DNG +KIDV++ +FDH  YL W+ +NI++I   Q AQ G+   +FA+ IQ ANA+L
Sbjct: 1687 TDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADL 1746

Query: 1743 KKSGDDK-PQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800
            K++  +   Q++ E  DD E ++SEY GRFWKP+  +G  +E   GV +IEAMKTEM+V
Sbjct: 1747 KQTTTEVIEQNILE--DDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIV 1803

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 2281 bits (5911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1101/1798 (61%), Positives = 1359/1798 (75%), Gaps = 15/1798 (0%)

Query: 3    STLGWSVQDWLSFHSKSTPTXXXXXXXXXXXXQKPAPEDPAWISLIPVEDLHHQWNILQS 62
            ST+GW+ Q W  FH +++              ++ A    AWIS+   E + HQW +LQS
Sbjct: 6    STVGWTSQQWREFHRRASADASLARLLALAHAERDA--GAAWISVASDEHIEHQWRVLQS 63

Query: 63   KSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTN 122
            + +++ LPLYGVP+AVKDNID +GL TTAACPS+ Y   +D+  V LLRDAGAV++GKTN
Sbjct: 64   RGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTN 123

Query: 123  LDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPA 182
            +DQFATGLVGTRSPYG     F+  +                 VPL+LGTDTAGSGRVPA
Sbjct: 124  MDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTAGSGRVPA 183

Query: 183  ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSRE 242
            ALNNL+G+KPT+G  SC GVVPAC+SLDCVSVFA +++DA    +++ +PD   D YSR 
Sbjct: 184  ALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDG-SDPYSRP 242

Query: 243  FPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELAR 302
             P +   +      + +P+E  WFGE++N KL+  A   ++ TGA++V VD +PLL+L R
Sbjct: 243  SPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGR 302

Query: 303  CLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVXXXXXXXXXXEYKRQGILQK 362
             LYEG WVAERY A R F +  PP  +LD TV  II  A             +RQ ++  
Sbjct: 303  SLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAA 362

Query: 363  VNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSD 422
            +   L  +D L VPTCPLNP L  +A EP+LVN+RQG WTNFVNLADLAA+A+P+GFR D
Sbjct: 363  IEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRD 422

Query: 423  GLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDTLN 482
            GLP G+TL+G+KFSD ALL+L  R   V      R  G     +   EDE+   S++  +
Sbjct: 423  GLPQGVTLVGRKFSDLALLELGSRLLRVE-DAEPRRCGALPAGQALCEDEVVSGSEERDS 481

Query: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542
             V LAVVGAHL+GL LHWQL +  A ++   +T+ +Y+LYALPK GPVLKP LRRV  G 
Sbjct: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541

Query: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602
            G+ I+LE YSVP   FG F+AMVP PL IGSVELESGE++KSF+CEE GY Q GTVDIT 
Sbjct: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601

Query: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662
             GGF+ Y+EH++  +    KPF+TVL+ANRGEIAVRI++TLKR+GI+SVAVYSDPD++SQ
Sbjct: 602  LGGFRRYVEHLR-RQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660

Query: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722
            HV DAD +VAL G +AAETYLDIDKI+ AAKKT  QAIIPGYGFLSENA F++RC  E I
Sbjct: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720

Query: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIXXXXXXXXXXXXXXYPVMVKSTA 782
            VFVGPSGD+IRKLGLKH ARE+A  A VPL  G+GL+              YP+MVKSTA
Sbjct: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780

Query: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842
            GGGGIGLQ+VDS  ++   FE VQ QG+ YF D+GVF+E F+  ARHVE+Q+MGDG G+ 
Sbjct: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840

Query: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902
            +A+GERDCSLQRRNQK+IEETPAPNLP  TR KMR A++RL S +KYKCAGTVEF+YDEQ
Sbjct: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900

Query: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWMLRIAAN  PDFD   +E+ G S+EAR+Y
Sbjct: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFD-AGVEIEGVSMEARVY 959

Query: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022
             ENPVK F PSPG LT V FPSWARVDTW+ KGT V+AEYDPTLAKIIVHGKDR DA+ K
Sbjct: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019

Query: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082
            L  AL+ET + GC+TN+DYL+SIASS+ F++A V T++L+ F+Y P AFEV  PGA T++
Sbjct: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079

Query: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142
            QDYPGR GYWRIGVPPSGPMDSYSFRLANRVVGN+SK+ ALEITLNGP+L FH++ VIAV
Sbjct: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139

Query: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202
            +GG V  TLN   + Q  P+ +++GD+L +GK+  G RAYL++RGGIDVPE+LGSRSTFA
Sbjct: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199

Query: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262
            MG +GG+NGR+L  GDVLF+N+     SS+   D      P  L P +   + WKIG+ C
Sbjct: 1200 MGGIGGHNGRVLAPGDVLFINKD----SSVAVGD--TVTIPSGLQPVIP-RESWKIGLVC 1252

Query: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322
            GPHGS D FK E +E+FF+  WKVHYNSNRFG+RLIGPKPKWARSDGGEAGLHPSN HDY
Sbjct: 1253 GPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDY 1312

Query: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382
            VYS+GAINFTGDEPVII  +GPSLGGFVC AVV EAELWKVGQL PGDTI+FVP+S   A
Sbjct: 1313 VYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTA 1372

Query: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442
            R LK SQD ++D  +  S ++L D  +LP Y++P+L  L K+S L PKVT+RQ+GDRYIL
Sbjct: 1373 RALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYIL 1432

Query: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502
            +EYGE E D+NI YRI +L   V +++  GIVEMSQG+RS+L+E++G  I+Q+ LL  L 
Sbjct: 1433 IEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLS 1492

Query: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562
            AYE EI FD +W VK+K+F+LPMAFEDSKTL+ V RY+ETIRS+APWLP+N DF+A+VN 
Sbjct: 1493 AYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG 1552

Query: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622
            I R DV+++LYSA FMVLGLGDVFLG+PCAVPLDPR R LGTKYNPSRTYT  GVVGIGG
Sbjct: 1553 ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGG 1612

Query: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682
            MYMCIY  + SPGGYQL+GRTI  W++L +G+   DHPWLLTPFDQVEFYPV+EE +  +
Sbjct: 1613 MYMCIYCTD-SPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINEL 1671

Query: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742
             E+ +NG F+++V+E++FD+  Y  W+ +N +SI AF+E Q GE+A EFARLI+VAN++L
Sbjct: 1672 TEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDL 1731

Query: 1743 KKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEMVV 1800
            + +   + + V EYP+DA ++YSEY GRFWK V +VGD V+ GD ++IIEAMKTEMVV
Sbjct: 1732 ETAVRKEAEPV-EYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEMVV 1788

>Kwal_14.1803
          Length = 1174

 Score =  273 bits (698), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 165/446 (36%), Positives = 257/446 (57%), Gaps = 11/446 (2%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            +L+ANRGEI +RI ++   + +K+VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             ID+I+  AK+     I PGYGFLSEN++F+ +  +  I ++GPS + I  +G K SAR 
Sbjct: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +A +A VP+VPG+ G I              YPV++K+  GGGG G++ V   DDI   F
Sbjct: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIADAF 199

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +    + K+ FG+   F+ERF+N  +H+E+Q++ DG+G  + + ERDCS+QRR+QKV+E 
Sbjct: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA  LP+  R  +   + +L S+  YK AGT EF+ D+Q +  YF+E+N R+QVEH IT
Sbjct: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQ-NRHYFIEINPRIQVEHTIT 318

Query: 923  EMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+D+V   ++IAA  S         +I   G +I+ R+  E+P K+F+P  G++  
Sbjct: 319  EEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRIEV 378

Query: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      G+ +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 379  YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 438

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLD 1062
            TNI +L ++ ++ +F +    T  +D
Sbjct: 439  TNIPFLLTLLTNPVFIDGTYWTTFID 464

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  273 bits (697), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 166/446 (37%), Positives = 249/446 (55%), Gaps = 11/446 (2%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            +L+ANRGEI +RI ++   + +++VA+YS  D+ S H   AD  + +   G  T    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYL 82

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             ID+II+ AKK G   I PGYGFLSENA+F+D+  +  I ++GP  + I  +G K SAR 
Sbjct: 83   AIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARN 142

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +A +A VP VPG+ G I              YPV++K+  GGGG G++ V   DD+   F
Sbjct: 143  LAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVADAF 202

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +  + +  + FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 203  QRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA  LP   R  +   + RL     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 321

Query: 923  EMVTGLDLVEWMLRIAANDS-PDFD--NTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+DLV   ++IAA  S P       +I   G +I+ R+  E+P K+F+P  G+L  
Sbjct: 322  EEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 381

Query: 979  -SVSFPSWARVDTWVK-KGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 382  YRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 441

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLD 1062
            TNI +L ++ +  +F      T  +D
Sbjct: 442  TNIPFLLTLLTHPVFISGDYWTTFID 467

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  272 bits (696), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/459 (35%), Positives = 256/459 (55%), Gaps = 14/459 (3%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            +L+ANRGEI +RI ++   + ++++A+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 23   ILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYL 82

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             +D+II  AKK     I PGYGFLSEN++F+D+  +  I ++GP  + I  +G K SAR 
Sbjct: 83   AMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARH 142

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +A RA VP VPG+ G I              YPV++K+  GGGG G++ V   DD+   F
Sbjct: 143  LAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAF 202

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +    + ++ FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 203  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 262

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA  LP   R  +   + +L  +  Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 263  APAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 321

Query: 923  EMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+D+V   ++IAA  +         KI   G SI+ R+  E+P K+F+P  G+L  
Sbjct: 322  EEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQPDTGRLEV 381

Query: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 382  YRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 441

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075
            TNI +L ++ ++ +F E    T  +D     P  F++++
Sbjct: 442  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 477

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  271 bits (694), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 169/459 (36%), Positives = 261/459 (56%), Gaps = 14/459 (3%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            +L+ANRGEI +RI +T   + +K+VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 21   LLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYL 80

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             ID+IIN AK  G   I PGYGFLSEN++F+++ +   I +VGP    I  +G K SAR 
Sbjct: 81   AIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARN 140

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +AE+A VP+VPG+ G I              +PV++K+  GGGG G++ V   DDI   F
Sbjct: 141  LAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGGGRGMRVVREGDDISDAF 200

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +  + +  + FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QKV+E 
Sbjct: 201  QRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV 260

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA  LPE  R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 261  APAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 319

Query: 923  EMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+D+V   ++IAA  + +       KI   G +I+ R+  E+P K+F+P  G++  
Sbjct: 320  EEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTGRIDV 379

Query: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      G+ +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 380  YRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 439

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075
            TNI +L ++ +  +FK  +  T  +D     P  FE+++
Sbjct: 440  TNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEMVS 475

>Scas_686.17
          Length = 1176

 Score =  268 bits (684), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 166/446 (37%), Positives = 252/446 (56%), Gaps = 11/446 (2%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            +L+ANRGEI +RI ++   + +++VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 22   ILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGAYL 81

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             ID+IIN AKK     I PGYGFLSEN++F+D+ ++  I ++GP  + I  +G K SAR 
Sbjct: 82   AIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSARY 141

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +A RA VP VPG+ G I              YPV++K+  GGGG G++ V   +DI   F
Sbjct: 142  LAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGGRGMRVVREGEDINDAF 201

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +    +  + FGD   F+ERF+++ +H+E+Q++GD +G  + + ERDCS+QRR+QKV+E 
Sbjct: 202  QRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVVEV 261

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA N+P   R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 262  APAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 320

Query: 923  EMVTGLDLVEWMLRIAANDS---PDFDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+DLV   ++IAA  S         +I   G +I+ R+  E+P K+F+P  G+L  
Sbjct: 321  EEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEV 380

Query: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 381  YRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLD 1062
            TNI +L ++ +  +F      T  +D
Sbjct: 441  TNIPFLLTLLTHPVFISGDYWTTFID 466

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  265 bits (676), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 165/448 (36%), Positives = 252/448 (56%), Gaps = 11/448 (2%)

Query: 625  ETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAET 681
            + +L+ANRGEI +RI +T   + +++VA+YS  D+ S H   AD  + +   G+ T    
Sbjct: 24   DKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGA 83

Query: 682  YLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSA 741
            YL ID+II+ AKK G   I PGYGFLSEN++F+D+  +  I ++GP  + I  +G K SA
Sbjct: 84   YLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSA 143

Query: 742  REIAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIER 800
            R +A +AKVP VPG+ G I              YPV++K+  GGGG G++ V   +DI  
Sbjct: 144  RNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGGGRGMRVVREGEDIGD 203

Query: 801  VFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVI 860
             F+    + K+ FG+   F+ERF++  +H+E+Q++ D  G  I + ERDCS+QRR+QKV+
Sbjct: 204  AFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVV 263

Query: 861  EETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHP 920
            E  PA  LP   R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 264  EVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 322

Query: 921  ITEMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQL 977
            ITE +TG+D+V   ++IAA  S         +I   G +I+ R+  E+P K+F+P  G++
Sbjct: 323  ITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 382

Query: 978  T--SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYG 1034
                 +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G
Sbjct: 383  EVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRG 442

Query: 1035 CITNIDYLRSIASSKMFKEAKVATKVLD 1062
              TNI +L ++ +  +F   +  T  +D
Sbjct: 443  VKTNIPFLLTLLTHPVFISGQYWTTFID 470

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  262 bits (669), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 166/459 (36%), Positives = 258/459 (56%), Gaps = 14/459 (3%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            +L+ANRGEI +RI +T   + +++VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 22   ILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYL 81

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             ID+II+ A+K     I PGYGFLSEN++F+D+  +  I ++GP  + I  +G K SAR 
Sbjct: 82   AIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARN 141

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +A +A VP VPG+ G I              YPV++K+  GGGG G++ V   DD+   F
Sbjct: 142  LAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAF 201

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +    + ++ FG+   F+ERF++  +H+E+Q++ D  G  + + ERDCS+QRR+QKV+E 
Sbjct: 202  QRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEV 261

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA  LP   R  +   + +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH IT
Sbjct: 262  APAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHTIT 320

Query: 923  EMVTGLDLVEWMLRIAANDS-PDFD--NTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+D+V   ++IAA  S P       KI   G +I+ R+  E+P K+F+P  G++  
Sbjct: 321  EEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRIEV 380

Query: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      GT +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 381  YRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVK 440

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075
            TNI +L ++ ++ +F E    T  +D     P  F++++
Sbjct: 441  TNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQMVS 476

>Scas_563.12
          Length = 1216

 Score =  254 bits (648), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 158/433 (36%), Positives = 238/433 (54%), Gaps = 11/433 (2%)

Query: 640  MKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVAL---HGRTAAETYLDIDKIINAAKKTG 696
             ++   + +++VA+YS  D+ S H   AD S  +   H  T    YL ID+IIN AK+ G
Sbjct: 76   FRSAHELSMQTVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHG 135

Query: 697  AQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGS 756
               I PGYGFLSEN++F+D+ ++  I ++GP    I  +G K SAR +A +A VP VPG+
Sbjct: 136  VDYIHPGYGFLSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGT 195

Query: 757  -GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
             G I              YPV++K+  GGGG G++ V+  DD+   F+    +  + FGD
Sbjct: 196  PGPIRTVQDAQDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGD 255

Query: 816  AGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAK 875
               F+ERF+N  +H+E+Q++ D  G  I + ERDCS+QRR+QKV+E  PA  LP   R  
Sbjct: 256  GTCFVERFLNKPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDA 315

Query: 876  MRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWML 935
            +   + +L     Y+ AGT EF+ D+Q +  YF+E+N R+QVEH ITE +TG+D+V   +
Sbjct: 316  ILTDAVKLAKECGYQNAGTAEFLVDDQ-NRHYFIEINPRIQVEHTITEEITGIDIVAAQI 374

Query: 936  RIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT--SVSFPSWARVDT 990
            +IAA  S +       KI   G +I+ R+  E+P K+F+P  G+L     +  +  R+D 
Sbjct: 375  QIAAGASLEQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDG 434

Query: 991  W-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCITNIDYLRSIASSK 1049
                 G  +S  YD  L K    G        K+ +AL E  + G  TNI +L ++ +  
Sbjct: 435  GNAYAGAIISPHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHP 494

Query: 1050 MFKEAKVATKVLD 1062
            +F      T  +D
Sbjct: 495  VFIAGDYWTTFID 507

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  252 bits (644), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 165/459 (35%), Positives = 251/459 (54%), Gaps = 14/459 (3%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683
            VL+ANRGEI +RI +T   + + +VAVYS  D+ S H   AD  + +   G+ T    YL
Sbjct: 21   VLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYL 80

Query: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743
             ID+I+  A+      I PGYGFLSENA+F+ +     I ++GP    I  +G K SAR 
Sbjct: 81   AIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARN 140

Query: 744  IAERAKVPLVPGS-GLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802
            +A  A VP VPG+ G I              YPV++K+  GGGG G++ V   DDI   F
Sbjct: 141  LAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGGGGRGMRVVREGDDIRDAF 200

Query: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862
            +  + + ++ FG+   F+ERF++  +H+E+Q++ D +G  + + ERDCS+QRR+QKV+E 
Sbjct: 201  QRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEV 260

Query: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922
             PA  L +  R  +   + +L     Y+ AGT EF+ D+Q +  YF+E+N R+QVEH IT
Sbjct: 261  APAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQ-NRHYFIEINPRIQVEHTIT 319

Query: 923  EMVTGLDLVEWMLRIAANDSPD---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT- 978
            E +TG+D+V   ++IAA  S +       +I   G +I+ R+  E+P K+F+P  G+L  
Sbjct: 320  EEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRITTEDPSKNFQPDTGRLDV 379

Query: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036
               +  +  R+D      G  +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 380  YRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 439

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLA 1075
            TNI +L ++ +  +F      T  +D     P  FE++A
Sbjct: 440  TNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFEMVA 475

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  248 bits (632), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 161/438 (36%), Positives = 245/438 (55%), Gaps = 14/438 (3%)

Query: 648  IKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYLDIDKIINAAKKTGAQAIIPGY 704
            +K+VA+YS+ D+ S H   AD  + +   G+ T    YL ID+II+ AK+ G   I PGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 705  GFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGS-GLIXXXX 763
            GFLSENA+F+ +     I ++GP  + I  +G K SAR++A +A VP VPG+ G I    
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 764  XXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERF 823
                      YPV++K+  GGGG G++ V   DDI   F+    + K+ FG+   F+ERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 824  VNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERL 883
            ++  +H+E+Q++ D +G  I + ERDCS+QRR+QKV+E  PA  LP+  R  +   + +L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 884  GSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSP 943
                KY+ AGT EF+ D Q +  YF+E+N R+QVEH ITE +TG+D+V   ++IAA  S 
Sbjct: 241  AKEAKYRNAGTAEFLVDAQ-NRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASL 299

Query: 944  D---FDNTKIEVSGASIEARLYAENPVKDFRPSPGQLT--SVSFPSWARVDTW-VKKGTN 997
                    KI   G +I+ R+  E+P K+F+P  G++     +  +  R+D      G  
Sbjct: 300  QQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAV 359

Query: 998  VSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCITNIDYLRSIASSKMFKEAKVA 1057
            +S  YD  L K    G        K+ +AL E  + G  TNI +L ++ +  +FK  +  
Sbjct: 360  ISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYW 419

Query: 1058 TKVLDSFDYKPCAFEVLA 1075
            T  +D     P  FE+++
Sbjct: 420  TTFIDD---TPQLFEMVS 434

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  230 bits (587), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 155/481 (32%), Positives = 238/481 (49%), Gaps = 58/481 (12%)

Query: 641  KTLKRMGIKSVAVYSDPDKY---SQHVTDADFSVALHGRTAAETYLDIDKIINAAKKTGA 697
            +T     I    V + PD     S+++  AD  V + G T    Y +ID I++ A++T  
Sbjct: 10   ETFNDEKIIQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDV 69

Query: 698  QAIIPGYGFLSENADFSD--RCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             A+  G+G  SEN    +    SQ  I+F+GP G A+R LG K S+  +A+ AK+P +P 
Sbjct: 70   DAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPW 129

Query: 756  SG-------------------------LIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQ 790
            SG                                         +PVM+K++ GGGG G++
Sbjct: 130  SGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIR 189

Query: 791  KVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDC 850
            +VD+EDD    F  +  Q  +    + +F+ + V +ARH+E+Q++ D +G  I +  RDC
Sbjct: 190  RVDNEDD----FIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDC 245

Query: 851  SLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLE 910
            S+QRR+QK+IEE P       T  +M  A+ RLG L+ Y  AGTVE++Y  + D+FYFLE
Sbjct: 246  SIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLE 305

Query: 911  VNARLQVEHPITEMVTGLDLVEWMLRIA--------------------ANDSPDFDNTKI 950
            +N RLQVEHP TEM++G++L    L+IA                         DF N K 
Sbjct: 306  LNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKR 365

Query: 951  -EVSGASIEARLYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTN--VSAEYDPTLA 1007
                G  I  R+ +E+P + F+PS G++  ++F S + V  +   G N  + +  D    
Sbjct: 366  PSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFG 425

Query: 1008 KIIVHGKDRNDAIMKLNQALNETAVYGCI-TNIDYLRSIASSKMFKEAKVATKVLDSFDY 1066
             I   G DR DA   +  AL + ++ G   T I+YL  +  ++ F+   ++T  LD    
Sbjct: 426  HIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLDDLIL 485

Query: 1067 K 1067
            K
Sbjct: 486  K 486

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  228 bits (582), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 250/508 (49%), Gaps = 74/508 (14%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKS-----------VAVYSDPDKYSQHVTDADFSVALHG 675
            VLIAN G  AV+ ++++++   ++           +A   D +  ++++  AD  + + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEVPG 122

Query: 676  RTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDR--CSQENIVFVGPSGDAIR 733
             T    Y ++D I+  A++    A+  G+G  SEN    +R   S   I+F+GP G+A+R
Sbjct: 123  GTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNAMR 182

Query: 734  KLGLKHSAREIAERAKVPLVPGSG-------------------------LIXXXXXXXXX 768
             LG K S+  +A+ AKVP +P SG                                    
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGLKK 242

Query: 769  XXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNAR 828
                 +P+MVK++ GGGG G++KV++ED+    F ++  Q  +    + +F+ +    AR
Sbjct: 243  AKEIGFPIMVKASEGGGGKGIRKVENEDE----FLSLYQQAANEIPGSPIFIMKLAGKAR 298

Query: 829  HVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLK 888
            H+E+Q++ D +G  I++  RDCS+QRR+QK+IEE P       T  +M  A+ RLG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVG 358

Query: 889  YKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 938
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 359  YVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRD 418

Query: 939  ----------ANDSPDFDNTKIEVS---------GASIEARLYAENPVKDFRPSPGQLTS 979
                      +    DF+ +  E +         G     R+ +E+P + F+PS G L  
Sbjct: 419  IRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHE 478

Query: 980  VSFPSWARVDTWVKKGTN--VSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI- 1036
            ++F S + V  +   G N  + +  D     I   G++R  +   +  AL E ++ G   
Sbjct: 479  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 538

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSF 1064
            T ++YL  +  ++ F++  + T  LD  
Sbjct: 539  TTVEYLIKLLETEDFEDNTITTGWLDDL 566

>Scas_720.74
          Length = 2231

 Score =  225 bits (574), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 250/508 (49%), Gaps = 74/508 (14%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKS-----------VAVYSDPDKYSQHVTDADFSVALHG 675
            +LIAN G  AV+ ++++++   ++           +A   D +  ++++  AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 676  RTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRC--SQENIVFVGPSGDAIR 733
             T  + Y ++D I++ A++    A+  G+G  SEN    ++   S+  +VF+GP G A+R
Sbjct: 122  GTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGSAMR 181

Query: 734  KLGLKHSAREIAERAKVPLVPGSG-------------LIXXXXXXXXX------------ 768
             LG K S+  +A+ A VP +P SG             L+                     
Sbjct: 182  SLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDGLEK 241

Query: 769  XXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNAR 828
                 +PVM+K++ GGGG G+++V+ E+D    F  + HQ  +    + +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLAGKAR 297

Query: 829  HVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLK 888
            H+E+Q++ D +G  I++  RDCS+QRR+QK+IEE P       T A M  ++ RLG L+ 
Sbjct: 298  HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGKLVG 357

Query: 889  YKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAAN-------- 940
            Y  AGTVE++Y  +  +FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHRISD 417

Query: 941  ------------DSPDFDNTKIEV---------SGASIEARLYAENPVKDFRPSPGQLTS 979
                           DFD +  E           G     R+ +E+P + F+PS G L  
Sbjct: 418  IRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGSLHE 477

Query: 980  VSFPSWARVDTWVKKGTN--VSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI- 1036
            ++F S + V  +   G N  + +  D     I   G++R  +   +  AL E ++ G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSF 1064
            T ++YL  +  ++ F++  + T  LD  
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLDDL 565

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  225 bits (574), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 251/508 (49%), Gaps = 74/508 (14%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKS-----------VAVYSDPDKYSQHVTDADFSVALHG 675
            +LIAN G  AV+ ++++++   ++           +A   D +  ++++  AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVPG 121

Query: 676  RTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRC--SQENIVFVGPSGDAIR 733
             T    Y ++D I++ A++    A+  G+G  SEN    ++   S+  +VF+GP G A+R
Sbjct: 122  GTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGSAMR 181

Query: 734  KLGLKHSAREIAERAKVPLVPGSG-------------LIXXXXXXXXX------------ 768
             LG K S+  +A+ AKVP +P SG             L+                     
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDGLNK 241

Query: 769  XXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNAR 828
                 +PVMVK++ GGGG G++KV  E+D    F ++  Q  +    + +F+ +    AR
Sbjct: 242  AKQIGFPVMVKASEGGGGKGIRKVVREED----FISLYQQAANEIPGSPIFIMKLAGKAR 297

Query: 829  HVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLK 888
            H+E+Q++ D +G  I++  RDCS+QRR+QK+IEE P       T A+M  A+ RLG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGKLVG 357

Query: 889  YKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAAN-------- 940
            Y  AGTVE++Y  + D+FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRD 417

Query: 941  ------------DSPDFDNTKIEV---------SGASIEARLYAENPVKDFRPSPGQLTS 979
                           DF+ +  +           G     R+ +E+P + F+PS G L  
Sbjct: 418  IRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGSLHE 477

Query: 980  VSFPSWARVDTWVKKGTN--VSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI- 1036
            ++F S + V  +   G N  + +  D     I   G++R  +   +  AL E ++ G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSF 1064
            T ++YL  +  ++ F++  + T  LD  
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLDDL 565

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  224 bits (571), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 249/508 (49%), Gaps = 74/508 (14%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKS-----------VAVYSDPDKYSQHVTDADFSVALHG 675
            VLIAN G  AV+ ++++++   ++           +A   D +  ++++  AD  V + G
Sbjct: 62   VLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 676  RTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRC--SQENIVFVGPSGDAIR 733
             T    Y ++D I++ A++    A+  G+G  SEN    ++   S+  I+F+GP G+A+R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAMR 181

Query: 734  KLGLKHSAREIAERAKVPLVPGSG-------------------------LIXXXXXXXXX 768
             LG K S+  +A+ AKVP +P SG                                    
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLEK 241

Query: 769  XXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNAR 828
                 +PVM+K++ GGGG G+++V  E+D    F  + HQ  +    + +F+ +    AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVTREED----FINLYHQAANEIPGSPIFIMKLAGKAR 297

Query: 829  HVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLK 888
            H+E+Q++ D +G  I++  RDCS+QRR+QK+IEE P       T  +M  A+ RLG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVG 357

Query: 889  YKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 938
            Y  AGTVE++Y    ++FYFLE+N RLQVEHP TEMVTG++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISD 417

Query: 939  ----------ANDSPDF-----DNTKIEV----SGASIEARLYAENPVKDFRPSPGQLTS 979
                       +   DF     D+ K +      G     R+ +E+P   F+PS G L  
Sbjct: 418  IRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNE 477

Query: 980  VSFPSWARVDTWVKKGTN--VSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI- 1036
            ++F S + V  +   G N  + +  D     I   G++R  +   +  AL E ++ G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSF 1064
            T ++YL  +  ++ F+E  + T  LD  
Sbjct: 538  TTVEYLIKLLETEDFEENTITTGWLDDL 565

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  222 bits (565), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 249/508 (49%), Gaps = 74/508 (14%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKS-----------VAVYSDPDKYSQHVTDADFSVALHG 675
            +LIAN G  AV+ ++++++   ++           +A   D +  ++++  AD  + + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPG 121

Query: 676  RTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQ--ENIVFVGPSGDAIR 733
             T    Y ++D I++ A++    A+  G+G  SEN    ++ SQ    ++F+GP G+A+R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMR 181

Query: 734  KLGLKHSAREIAERAKVPLVPGSG-------------------------LIXXXXXXXXX 768
             LG K S+  +A+ AKVP +P SG                                    
Sbjct: 182  SLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQK 241

Query: 769  XXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNAR 828
                 +PVM+K++ GGGG G+++V+ E+D    F  + HQ  +    + +F+ +    AR
Sbjct: 242  AKRIGFPVMIKASEGGGGKGIRQVEREED----FIALYHQAANEIPGSPIFIMKLAGRAR 297

Query: 829  HVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLK 888
            H+E+Q++ D +G  I++  RDCS+QRR+QK+IEE P       T  +M  A+ RLG L+ 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVG 357

Query: 889  YKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIA---------- 938
            Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMV+G++L    L+IA          
Sbjct: 358  YVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISD 417

Query: 939  ----------ANDSPDF-----DNTKIEV----SGASIEARLYAENPVKDFRPSPGQLTS 979
                      +    DF     D TK +      G     R+ +E+P   F+PS G L  
Sbjct: 418  IRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHE 477

Query: 980  VSFPSWARVDTWVKKGT--NVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI- 1036
            ++F S + V  +   G   N+ +  D     I   G++R  +   +  AL E ++ G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1037 TNIDYLRSIASSKMFKEAKVATKVLDSF 1064
            T ++YL  +  ++ F++  + T  LD  
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLDDL 565

>Kwal_23.6157
          Length = 2230

 Score =  221 bits (564), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 155/510 (30%), Positives = 248/510 (48%), Gaps = 78/510 (15%)

Query: 627  VLIANRGEIAVRIMKTLKRMGIKS-----------VAVYSDPDKYSQHVTDADFSVALHG 675
            VLIAN G  AV+ ++++++   ++           +A   D +  ++++  AD  V + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEVPG 122

Query: 676  RTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDR--CSQENIVFVGPSGDAIR 733
             T    Y ++D I+  A++    A+  G+G  SEN    +R   S   ++F+GP G+A+R
Sbjct: 123  GTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPGNAMR 182

Query: 734  KLGLKHSAREIAERAKVPLVPGSG-------------LIXXX------------XXXXXX 768
             LG K S+  +A+ AKVP +P SG             L+                     
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPEDGLAK 242

Query: 769  XXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNAR 828
                 +PVMVK++ GGGG G++KV+ E D    F  +  Q  +    + +F+ +   NAR
Sbjct: 243  AKKIGFPVMVKASEGGGGKGIRKVEREQD----FIPLYKQAANEIPGSPIFIMKLAGNAR 298

Query: 829  HVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLK 888
            H+E+Q++ D +G  I++  RDCS+QRR+QK+IEE P       T  +M  ++ RLG L+ 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLGKLVG 358

Query: 889  YKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAAN-------- 940
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    L+IA          
Sbjct: 359  YVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIKD 418

Query: 941  -----------------DSPDFDNTKIEV----SGASIEARLYAENPVKDFRPSPGQLTS 979
                             D    D+TKI+      G     R+ +E+P + F+PS G L  
Sbjct: 419  IRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGGSLHE 478

Query: 980  VSFPSWARVDTW----VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGC 1035
            ++F S + V  W    V     + +  D     I   G++R  +   +  AL E ++ G 
Sbjct: 479  LNFRSSSNV--WGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGD 536

Query: 1036 I-TNIDYLRSIASSKMFKEAKVATKVLDSF 1064
              T ++YL  +  ++ F+   + T  LD  
Sbjct: 537  FRTTVEYLIKLLETEDFEGNSITTGWLDDL 566

>Kwal_23.4249
          Length = 465

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 125/246 (50%), Gaps = 21/246 (8%)

Query: 61  QSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYL---YQPTRDSYVVELLRDAGAVV 117
           Q  S  +E PL  +   +KDNI  K LPT+  C S +   +Q   ++ VV+LL  AGAV 
Sbjct: 36  QGSSADDEKPLKNILCGIKDNIATKELPTS--CGSKILKDFQSPFNATVVDLLEGAGAVT 93

Query: 118 IGKTNLDQFATGLVGTRSPYGKT--PCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTA 175
           +GKTN+D+F  G  GT S +G T  P   +D                  +V  ++GTDT 
Sbjct: 94  VGKTNMDEFGMGSGGTHSHFGPTRNPQFPSDNVIAGGSSSGSAAAVAADVVDFAIGTDTG 153

Query: 176 GSGRVPAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLL 235
           GS R+PAA  +++G KP+ G  S  GVV   +SLD V + A ++   +  FKV++K D  
Sbjct: 154 GSVRLPAAYTSVMGFKPSYGRISRHGVVAYAQSLDTVGILAKDIDIVQQVFKVLDKYDWK 213

Query: 236 E----DEYSRE-FPKNPISQYPKDLTIAIPKEVPWFGETENP----KLYTKAVASLKNTG 286
           +    DE SRE   K   S+    L + IP+E   F + E P    +   +A+  L++ G
Sbjct: 214 DPTSLDETSREKLAKFHCSK--TKLKVGIPQE---FLQAEIPADLQEALLRAITKLESKG 268

Query: 287 AKIVVV 292
             I  V
Sbjct: 269 HDIYPV 274

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score =  101 bits (251), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 113/234 (48%), Gaps = 24/234 (10%)

Query: 63  KSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYL---YQPTRDSYVVELLRDAGAVVIG 119
           K+   + PL     A+KDNI  K +P+T  C S +   Y    D+ VV LL +AG V+ G
Sbjct: 39  KNTTADKPLNYTLAAIKDNIATKNMPST--CASKILDGYMSPFDATVVSLLLEAGTVIAG 96

Query: 120 KTNLDQFATGLVGTRSPYGKTPCVFN------DKYXXXXXXXXXXXXXXXXIVPLSLGTD 173
           K N+D+F  G  G  S +G T   FN      D+                 +V  +LGTD
Sbjct: 97  KANMDEFGMGSAGIHSHFGPT---FNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTD 153

Query: 174 TAGSGRVPAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNK-- 231
           T GS R+PA+  +  G KP+ G  S  GV+   +SLD V VFA +LS  +  F +++K  
Sbjct: 154 TGGSVRLPASYTSTFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHD 213

Query: 232 ---PDLLEDEYSREFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASL 282
              P  L +E   +F    ++   K L I IP+E   F +   P  +  A+ ++
Sbjct: 214 KKDPTSLSEELRHKF--TSLTTKRKTLRIGIPEE---FSQESVPAEFRAAMTAI 262

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 121/259 (46%), Gaps = 38/259 (14%)

Query: 52  DLHHQWNILQS----------KSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYL---Y 98
           +L  Q+NI             KS K+ + L G+   +KDNI  K +PTT  C S +   Y
Sbjct: 11  ELQKQYNIFTHIDVEGVKNSYKSLKDGI-LSGLLCGIKDNIVTKDMPTT--CGSEILRGY 67

Query: 99  QPTRDSYVVELLRDAGAVVIGKTNLDQFATGLVGTRSPYGKTPCVFN------DKYXXXX 152
           Q   D+ VV+LL+  G++V+GKTNLD+F  G  G  S +G T   FN      DK     
Sbjct: 68  QSPYDATVVKLLKQEGSIVLGKTNLDEFGMGSRGIHSCFGPT---FNPLYPAADKVIMGG 124

Query: 153 XXXXXXXXXXXXIVPLSLGTDTAGSGRVPAALNNLIGLKPTKGAFSCRGVVPACKSLDCV 212
                        V  SLGTDT GS R+PA   ++ G KP+ G  S  GV+   +SLD V
Sbjct: 125 SSSGSAAAVVSEAVDFSLGTDTGGSVRLPATYGSIYGFKPSYGRISRYGVIAYAQSLDTV 184

Query: 213 SVFALNLSDAEIAFKVMNK-----PDLLEDEYSREF----PKNPISQYPKDLTIAIPKEV 263
            +   N+S     + V++K     P  LE+ Y  +      +N I +  K   I I KE 
Sbjct: 185 GILTKNISTLRKVYHVLDKYDDKDPTSLENSYRDQILGIHERNTIKER-KKYRIGIAKE- 242

Query: 264 PWFGETENPKLYTKAVASL 282
             F +   P+   +A+ + 
Sbjct: 243 --FSQDSIPETIMEALLAF 259

>Scas_684.25
          Length = 482

 Score = 99.0 bits (245), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 98/205 (47%), Gaps = 15/205 (7%)

Query: 70  PLYGVPIAVKDNIDYKGLPTTAACPSYL---YQPTRDSYVVELLRDAGAVVIGKTNLDQF 126
           PL     AVKDNI    +PTT  C S +   YQ   D+ VV+LLR++G  ++GKTN+D+F
Sbjct: 48  PLSNTLCAVKDNIATNDMPTT--CSSSMLSNYQSPFDATVVKLLRESGTTIVGKTNMDEF 105

Query: 127 ATGLVGTRSPYGK--TPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAAL 184
           A G +G  S YG    P   +                   +V  +LGTDT GS R+PA  
Sbjct: 106 AMGSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVRLPACY 165

Query: 185 NNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSREFP 244
            +++G K + G  S  GVV   +SLD V + A NL   +  F  ++K D  +     E  
Sbjct: 166 CSVLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFDKKDPTSLSEDL 225

Query: 245 KNPISQYPK--------DLTIAIPK 261
           +N I+   K           I IPK
Sbjct: 226 RNEINSISKLREKRGRAKFRIGIPK 250

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score = 95.5 bits (236), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 102/206 (49%), Gaps = 14/206 (6%)

Query: 68  ELPLYGVPIAVKDNIDYKGLPTTAACPSYL---YQPTRDSYVVELLRDAGAVVIGKTNLD 124
           E PL  + + +KDNI  K LPTT  C S +   Y    D+ VVELL +AGAV  GKTN+D
Sbjct: 36  EKPLGNLVVGIKDNIVTKKLPTT--CSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMD 93

Query: 125 QFATGLVGTRSPYGKT--PCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPA 182
           +F  G  G  S +G T  P                       +V  +LGTDT GS R+PA
Sbjct: 94  EFGMGSGGIHSFFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPA 153

Query: 183 ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNK-----PDLLED 237
           A  + +G KP+ G  S  GV+   +SLD V + A ++      F+V+++     P  L D
Sbjct: 154 AYTSTVGFKPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPD 213

Query: 238 EYSREFPKNPISQYPKDLTIAIPKEV 263
           E  ++     + +  K L I IP E+
Sbjct: 214 ELRQQ--AAALRREKKHLKIGIPAEL 237

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 122/446 (27%), Positives = 179/446 (40%), Gaps = 73/446 (16%)

Query: 57  WNILQSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYL---YQPTRDSYVVELLRDA 113
           ++I   K  KE L   G   ++KDNI  K  PTT  C S++   ++   D+ VV+LL+ A
Sbjct: 32  YSITNKKGTKETLT--GCVASIKDNIVTKDFPTT--CASHILENFKSPFDATVVKLLKQA 87

Query: 114 GAVVIGKTNLDQFATGLVGTRSPYGKTPCV-----FNDKYXXXXXXXXXXXXXXXXIVPL 168
           G  ++GKTNLD+F  G  G  S  G  P +       DK                 +V  
Sbjct: 88  GVHILGKTNLDEFGMGSGGVHSIRG--PVINPLYPHEDKKIMGGSSSGAAASVACDLVDF 145

Query: 169 SLGTDTAGSGRVPAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKV 228
           +LGTDT GS R+PA   +++G KP+ G  S  GV+   +SLD V + +  ++     F  
Sbjct: 146 ALGTDTGGSVRLPACYGSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHT 205

Query: 229 MNKPDL-----LEDEYSREFPKNPISQYPKDLTIAIPKEVPWFGETENP----KLYTKAV 279
           ++K D+     L  E       N   + P  L + I KE   F     P    +LY   +
Sbjct: 206 LDKYDMKDPTSLSVELRELIEGNKKVRRP--LKVGIVKE---FSHESMPIGFHRLYLSLL 260

Query: 280 ASLKNTGAKIVVVDFEPLLELARCLY-----EGAWVAERYCATR-----------DFLAT 323
             L N G +I  V    +       Y     E A    RY   R           D +  
Sbjct: 261 EKLINLGLEIYPVSIPSVKNCLPIYYTLSPAEAASNLSRYDGIRYGYRDSELDIKDGILF 320

Query: 324 NPPESSLDETVVN-IIKGAVXXXXXXXXXXEYKRQ-----------GILQKVNLLLKD-- 369
            P  S     V N II G              K +           GI +  N+L     
Sbjct: 321 APTRSKFGTEVKNRIILGNYNLCSDAFKNNFIKAEKLRVNLIDEFDGIFRFPNVLTNSKG 380

Query: 370 ----IDVLCVPTCPLNPKL-----EEVAQEPVLVNSR-QGTWTNFVNLADLAALAVPSGF 419
               +D+L VPT    P       EE A+ P   NS     +T  ++LA L +L++P   
Sbjct: 381 NPDGLDLLIVPTSSKLPGSIRDFEEEEAKSP--ANSYINDVFTVPMSLAGLPSLSMP--- 435

Query: 420 RSDGLPNGITLIGKKFSDYALLDLAK 445
             +  P G+ ++G+   D  +LD  +
Sbjct: 436 LKEKTPIGLQVVGQYGDDSTVLDFVE 461

>Kwal_56.22295
          Length = 583

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 80/168 (47%), Gaps = 9/168 (5%)

Query: 70  PLYGVPIAVKDNIDYKGLPTTAACPSYLYQPT---RDSYVVELLRDAGAVVIGKTNLDQF 126
           PL+G+P  VKDN   K    T  C S+    +   RD++VV  LRDAGAV+ G   L ++
Sbjct: 131 PLHGIPFVVKDNYATKDKMDTT-CGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLSEW 189

Query: 127 A-----TGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVP 181
           A     +   G  +  G+  C FN                   ++P SLGT+T GS   P
Sbjct: 190 ADMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMIPFSLGTETDGSIIDP 249

Query: 182 AALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVM 229
           A  N ++G KPT G  S  GVVP  +  D     A ++ DA  AF+ M
Sbjct: 250 AMRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYM 297

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 79/167 (47%), Gaps = 7/167 (4%)

Query: 70  PLYGVPIAVKDNIDYKG-LPTTAACPSYLYQPT-RDSYVVELLRDAGAVVIGKTNLDQFA 127
           PL+G+P  VKDN   K  + TTA   S +     RD+YVVE LRDAGAV+ G   + ++A
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEWA 199

Query: 128 -----TGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPA 182
                +   G  +  G+  C FN                   ++  SLGT+T GS   PA
Sbjct: 200 DMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDPA 259

Query: 183 ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVM 229
             N ++G KPT G  S  GV+P  +  D     A  + DA   F+ M
Sbjct: 260 MRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSM 306

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 79/167 (47%), Gaps = 7/167 (4%)

Query: 70  PLYGVPIAVKDNIDYKG-LPTTAACPSYLYQPT-RDSYVVELLRDAGAVVIGKTNLDQFA 127
           PL+G+P  VKDN   K  + TTA   S +     RD+YVVE LRDAGAV+ G   + ++A
Sbjct: 140 PLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSEWA 199

Query: 128 -----TGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPA 182
                +   G  +  G+  C FN                   ++  SLGT+T GS   PA
Sbjct: 200 DMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIMFSLGTETDGSIIDPA 259

Query: 183 ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVM 229
             N ++G KPT G  S  GV+P  +  D     A  + DA   F+ M
Sbjct: 260 MRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSM 306

>Scas_721.66
          Length = 573

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 71/150 (47%), Gaps = 4/150 (2%)

Query: 50  VEDLHHQWNILQSKSNKEELP-LYGVPIAVKDNIDYKGLPTTAACPSYLYQPTR---DSY 105
            E L H   + Q+K     LP LYG+PI++KD  + +G+ TT    S  ++P +   +S 
Sbjct: 120 TEALEHSKILDQNKYEYSTLPPLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDESL 179

Query: 106 VVELLRDAGAVVIGKTNLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXI 165
           +V  LRD GA++  KT +         T + +G T   FN  +                 
Sbjct: 180 IVSFLRDLGAIIYVKTTVPPSMMATETTSNTFGYTYNSFNQHFSAGGSSGGEGSLIGCYG 239

Query: 166 VPLSLGTDTAGSGRVPAALNNLIGLKPTKG 195
             L LGTD  GS R+PA+ + + G KP+ G
Sbjct: 240 SVLGLGTDIGGSIRIPASYHGIFGFKPSTG 269

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 79/183 (43%), Gaps = 17/183 (9%)

Query: 59  ILQSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQP---TRDSYVVELLRDAGA 115
           +L  +   + LPLYG+PI++KD  +  G  TT       ++P     +S +V+ L+D GA
Sbjct: 108 LLDERKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFLKDLGA 167

Query: 116 VVIGKTNLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTA 175
           V+  KT +           + +G T    N  +                   L +GTD  
Sbjct: 168 VLYVKTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSILGIGTDIG 227

Query: 176 GSGRVPAALNNLIGLKPTKG---------AFSCRGVVPACKSLDCVSVFALNLSDAEIAF 226
           GS R+P++   L GL+PT G         +F  + ++P+      +   A NL D E   
Sbjct: 228 GSIRIPSSFQGLFGLRPTHGRLPYLKVDNSFEGQELIPS-----VIGPLARNLEDLEFFM 282

Query: 227 KVM 229
           +++
Sbjct: 283 ELI 285

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 65/148 (43%), Gaps = 12/148 (8%)

Query: 70  PLYGVPIAVKDNIDYKGLPTTAACPSYLYQP---TRDSYVVELLRDAGAVVIGKTNLDQF 126
           PLYG+PI++KD  + +G+ T+       ++P     +S +V  LRD GA++  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 127 ATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAALNN 186
                   + +G T    N  +                   L LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 187 LIGLKPTKG---------AFSCRGVVPA 205
           L GLKPT G         +F  R  +P+
Sbjct: 243 LFGLKPTFGRVPYLRVDNSFEGRETIPS 270

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 81/206 (39%), Gaps = 8/206 (3%)

Query: 62  SKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTR-DSYVVELLRDAGAVVIGK 120
           S++ K   P++G+P+++K++  YKG  T A   S +   T  D+   E+ R AGAV   +
Sbjct: 20  SETGKTVGPMHGLPLSLKEHYAYKGKTTNAGFSSMIDNLTEEDALTTEIFRKAGAVFYIR 79

Query: 121 TNLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRV 180
           T   Q    L    +  G+     N                     PL  G+D  GS R 
Sbjct: 80  TTQPQSLMHLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRA 139

Query: 181 PAALNNLIGLKPTKGAFSCRGVVPACKSLD------CVSVFALNLSDAEIAFKV-MNKPD 233
           PAA  N+ G KPT    S +G   + + +        V   A    D E+  K  ++   
Sbjct: 140 PAAFCNIWGFKPTNKRVSLQGAWASYRDMSNDMVLCSVGPMANTPEDLELYMKTFLDSEP 199

Query: 234 LLEDEYSREFPKNPISQYPKDLTIAI 259
            L D Y    P   +      L IAI
Sbjct: 200 WLRDNYVIRLPWREVDLSLDKLKIAI 225

>Kwal_34.15724
          Length = 556

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 1/126 (0%)

Query: 71  LYGVPIAVKDNIDYKGLPTTAACPSYL-YQPTRDSYVVELLRDAGAVVIGKTNLDQFATG 129
           L+GVPI++KD ++  G+ TT    S +  +  + S +  +L+D GA+   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 130 LVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAALNNLIG 189
                S +G+T    N  +                  PL +GTD  GS R+PAA   L G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 190 LKPTKG 195
           L+P+ G
Sbjct: 244 LRPSHG 249

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query: 70  PLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYV-VELLRDAGAVVIGKTNLDQFAT 128
           PL+GVP+++K+ +++KG PT A+  SY+    ++S V +++L   GA+   +T+  Q   
Sbjct: 188 PLHGVPVSLKEQMNFKGKPTHASYVSYITNIPKNSAVSIDILDKLGAIFHTRTSQPQAIM 247

Query: 129 GLVGTRSPYGKT--PCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAALNN 186
            L    +  G+T  PC                      ++    G+D  GS RVPAA  +
Sbjct: 248 HLDTWNNITGRTRNPCSTRLSPGGSSGGESAMVGMHGSVI--GHGSDIGGSIRVPAAFVD 305

Query: 187 LIGLKPT 193
           L G++PT
Sbjct: 306 LFGIRPT 312

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 65/144 (45%), Gaps = 1/144 (0%)

Query: 70  PLYGVPIAVKDNIDYKGLPTTAACPSYL-YQPTRDSYVVELLRDAGAVVIGKTNLDQFAT 128
           PL+GVP+++K+ + YKG  T A+  SY+ + P + +  V++L   GAV   +T+  Q   
Sbjct: 141 PLHGVPVSIKEQMCYKGKVTNASYVSYVDFVPEQSAVSVDILIKLGAVCHVRTSQPQTIM 200

Query: 129 GLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAALNNLI 188
            L    +  G+T    + K                    +  G+D  GS R PAA  NL 
Sbjct: 201 HLDTWNNYIGRTRNPRSTKLSPGGSSGGESACVGMHGSVIGHGSDIGGSIRAPAAFANLF 260

Query: 189 GLKPTKGAFSCRGVVPACKSLDCV 212
           GL+PT    S    +   K  + V
Sbjct: 261 GLRPTTKRVSLLNGISGGKGQESV 284

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 128/300 (42%), Gaps = 21/300 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETYLDIDKIINAAKKT 695
            AV  ++TL+   IK++ +  +P+  S    +AD       R   ET ++++++++  +  
Sbjct: 1000 AVTAVRTLRANNIKTIMINYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEAE 1051

Query: 696  GAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             +  ++   G  + N + +    +EN+  +G S D I     ++    + ++  V   P 
Sbjct: 1052 ASNGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1109

Query: 756  SGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
               +              YPV+V+ +    G  +  V S++D+E       +Q      D
Sbjct: 1110 WKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1165

Query: 816  AGVFMERFVNNARHVEIQMM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEAT 872
              V + +++ NA+ +E+  +   G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1166 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1223

Query: 873  RAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVE 932
              ++  A+ ++G  LK      ++FI  +  +E   +E N R     P    V G++L+E
Sbjct: 1224 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1281

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 97/258 (37%), Gaps = 37/258 (14%)

Query: 774  YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
            +PV+V++    GG+G    ++E       E +     ++     V +ER +   + VE +
Sbjct: 591  FPVIVRAAYALGGLGSGFANNEQ------ELIDLCNVAFASSPQVLVERSMKGWKEVEYE 644

Query: 834  MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
            ++ D F   I +    C+++            I   P+  L +     +R  +  +   L
Sbjct: 645  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 700

Query: 888  KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDN 947
                   +++  +    E+  +EVNARL     +    TG  L     ++  N   +   
Sbjct: 701  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLN--- 757

Query: 948  TKIEVSGASIEARLYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTL- 1006
               EV  +  ++      P  D+         V  P W      +KK T VS E   ++ 
Sbjct: 758  ---EVKNSVTKSTCACFEPSLDY-------CVVKMPRWD-----LKKFTRVSTELSSSMK 802

Query: 1007 --AKIIVHGKDRNDAIMK 1022
               +++  G+   +AI K
Sbjct: 803  SVGEVMSIGRTFEEAIQK 820

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/300 (19%), Positives = 127/300 (42%), Gaps = 21/300 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETYLDIDKIINAAKKT 695
            AV  ++TL++   K++ V  +P+  S    +AD       R   ET +++++I++  +  
Sbjct: 1000 AVTAVRTLRKNNFKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERIMDIYELE 1051

Query: 696  GAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             +  ++   G  + N + +    +EN+  +G S + I     ++    + ++  V   P 
Sbjct: 1052 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDVDQ-PA 1109

Query: 756  SGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
               +              YPV+V+ +    G  +  V S+DD+E          + Y   
Sbjct: 1110 WKELTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY--- 1166

Query: 816  AGVFMERFVNNARHVE---IQMMGDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEAT 872
              V + +++ NA+ +E   + + G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1167 -PVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1223

Query: 873  RAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVE 932
              ++  A+ ++G  L+      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1224 VRRIVEATAKIGRALQITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVVGVNLIE 1281

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 67/173 (38%), Gaps = 16/173 (9%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           +PV+V++    GG+G     +E       E V     ++     V +ER +   + +E +
Sbjct: 591 FPVIVRAAYALGGLGSGFASNEK------ELVDLCNVAFASSPQVLVERSMKGWKEIEYE 644

Query: 834 MMGDGFGKAIAIGERDCSLQRRNQKVIEE------TPAPNLPEATRAKMRAASERLGSLL 887
           ++ D F   I +    C+++  +   I         P+  L +     +R  +  +   L
Sbjct: 645 VVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNVIRHL 700

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAAN 940
                  +++  +    E+  +EVNARL     +    TG  L     ++  N
Sbjct: 701 GVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN 753

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/300 (19%), Positives = 128/300 (42%), Gaps = 21/300 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETYLDIDKIINAAKKT 695
            AV  ++TL+   IK++ V  +P+  S    +AD       R   ET ++++++++  +  
Sbjct: 1002 AVTAVRTLRANNIKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEIE 1053

Query: 696  GAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             +  ++   G  + N + +    +EN+  +G S D I     ++    + ++  V   P 
Sbjct: 1054 NSSGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 756  SGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
               +              YPV+V+ +    G  +  V S++D+E       +Q      D
Sbjct: 1112 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYL----NQAVEVSRD 1167

Query: 816  AGVFMERFVNNARHVEIQMM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEAT 872
              V + +++ NA+ +E+  +   G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAPET 1225

Query: 873  RAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVE 932
              ++  A+ ++G  LK      ++FI  +  +E   +E N R     P    V G++L+E
Sbjct: 1226 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 53/273 (19%), Positives = 101/273 (36%), Gaps = 44/273 (16%)

Query: 774  YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
            +PV+V++    GG+G    ++E       E V     ++     V +E+ +   + VE +
Sbjct: 593  FPVIVRAAYALGGLGSGFANNEK------ELVDLCNVAFSSSPQVLVEKSMKGWKEVEYE 646

Query: 834  MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
            ++ D F   I +    C+++            I   P+  L +     +R  +  +   L
Sbjct: 647  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 702

Query: 888  KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDN 947
                   +++  +    ++  +EVNARL     +    TG  L     ++  N   +   
Sbjct: 703  GVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLN--- 759

Query: 948  TKIEVSGASIEARLYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTL- 1006
               EV  +  ++      P  D+         V  P W      +KK T VS E   ++ 
Sbjct: 760  ---EVKNSVTKSTCACFEPSLDY-------CVVKMPRWD-----LKKFTRVSTELSSSMK 804

Query: 1007 --AKIIVHGKDRNDAIMK-------LNQALNET 1030
               +++  G+   +AI K        N   NET
Sbjct: 805  SVGEVMSIGRTFEEAIQKAIRSTEYANLGFNET 837

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/300 (19%), Positives = 128/300 (42%), Gaps = 21/300 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETYLDIDKIINAAKKT 695
            AV  ++TL++  +K++ V  +P+  S    + D       R   ET +++++I++  +  
Sbjct: 1018 AVTAVRTLRQNNVKTIMVNYNPETVSTDYDEVD-------RLYFET-INMERILDIYEVE 1069

Query: 696  GAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             +  ++   G  + N + +    +EN+  +G S + I     ++    + ++ +V   P 
Sbjct: 1070 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEVDQ-PA 1127

Query: 756  SGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
               +              YPV+V+ +    G  +  V S+DD+E          + Y   
Sbjct: 1128 WKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY--- 1184

Query: 816  AGVFMERFVNNARHVEIQMM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEAT 872
              V + +++ NA+ +E+  +   G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1185 -PVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1241

Query: 873  RAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVE 932
              ++  A+ ++G  LK      ++FI   + +E   +E N R     P    V G++L+E
Sbjct: 1242 VRRIVDATAKIGRALKITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVIGVNLIE 1299

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 66/173 (38%), Gaps = 16/173 (9%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           +PV+V++    GG+G     +E       E V     ++     V +ER +   + VE +
Sbjct: 609 FPVIVRAAYALGGLGSGFASNEQ------ELVDLCNVAFASSPQVLVERSMKGWKEVEYE 662

Query: 834 MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
           ++ D F   I +    C+++            I   P+  L +     +R  +  +   L
Sbjct: 663 VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 718

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAAN 940
                  +++  +    E+  +EVNARL     +    TG  L     ++  N
Sbjct: 719 GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN 771

>Kwal_27.10438
          Length = 569

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (46%), Gaps = 2/141 (1%)

Query: 60  LQSKSNKEEL-PLYGVPIAVKDNIDYKGLPTTAACPSYLYQPT-RDSYVVELLRDAGAVV 117
           L  K NK+ + PL+GV +++K+ ++YKG  TTA+  +YL   T ++   + +LR  GAV 
Sbjct: 132 LYLKDNKKLIGPLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVF 191

Query: 118 IGKTNLDQFATGLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGS 177
             +T   Q    L    +  G+T    + +                    +  G+D  GS
Sbjct: 192 HVRTAQPQGIMHLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSVIGHGSDIGGS 251

Query: 178 GRVPAALNNLIGLKPTKGAFS 198
            R PAA  +L G++PT    S
Sbjct: 252 IRAPAAFADLFGIRPTTKRIS 272

>Scas_582.4*
          Length = 2193

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/300 (19%), Positives = 128/300 (42%), Gaps = 21/300 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETYLDIDKIINAAKKT 695
            AV  ++TL+   IK++ +  +P+  S    +AD       R   ET +++++I++  +  
Sbjct: 977  AVTAVRTLRANKIKTIMINYNPETVSTDYDEAD-------RLYFET-INLERILDIYEIE 1028

Query: 696  GAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             +  ++   G  + N + +    +EN+  +G S + I     ++    + ++  V   P 
Sbjct: 1029 NSSGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1086

Query: 756  SGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
               +              YPV+V+ +    G  +  V S++D+        +Q      D
Sbjct: 1087 WKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYL----NQAVEVSRD 1142

Query: 816  AGVFMERFVNNARHVEIQMM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEAT 872
              V + +++ NA+ +E+  +   G+     ++    +  +   +  +I   P  +L + T
Sbjct: 1143 YPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAKET 1200

Query: 873  RAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVE 932
              ++  A+ ++G  LK      ++FI  +  +E   +E N R     P    V G++L+E
Sbjct: 1201 VDRIVVATAKIGKALKITGPYNIQFIAKD--NEIKVIECNVRASRSFPFISKVVGVNLIE 1258

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 55/284 (19%), Positives = 106/284 (37%), Gaps = 47/284 (16%)

Query: 774  YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
            +PV+V++    GG+G    ++E       E +     ++     V +ER +   + +E +
Sbjct: 588  FPVIVRAAYALGGLGSGFANNEQ------ELIDLCNVAFASSPQVLVERSMKGWKEIEYE 641

Query: 834  MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
            ++ D F   + +    C+++            I   P+  L +     +R  +  +   L
Sbjct: 642  VVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHL 697

Query: 888  KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDN 947
                   +++  +    E+  +EVNARL     +    TG  L     ++  N   +   
Sbjct: 698  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLN--- 754

Query: 948  TKIEVSGASIEARLYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTL- 1006
               EV  +  ++      P  D+         V  P W      +KK T VS E   ++ 
Sbjct: 755  ---EVINSVTKSTCACFEPSLDY-------CVVKMPRWD-----LKKFTRVSTELSSSMK 799

Query: 1007 --AKIIVHGKDRNDAIMK-------LNQALNETAVYGCITNIDY 1041
               +++  G+   +AI K        N   NET +     +IDY
Sbjct: 800  SVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLE---IDIDY 840

>Kwal_33.14061
          Length = 2221

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 126/301 (41%), Gaps = 23/301 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAA-ETYLDIDKIINAAKK 694
            AV  ++TL++  IKS+ V  +P+  S   TD D +  L+  T   E  LDI +I     +
Sbjct: 1002 AVTAVRTLRKEKIKSIMVNYNPETVS---TDYDEADRLYFETICLERILDIYEI-----E 1053

Query: 695  TGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVP 754
            + A  ++   G  S N   S    +EN+  +G + + I     ++    + ++  V   P
Sbjct: 1054 SSAGVVVSMGGQTSNNIAMS--LHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQ-P 1110

Query: 755  GSGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFG 814
                +              +PV+V+ +    G  +  V S+DD+        +Q      
Sbjct: 1111 AWKELTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSR 1166

Query: 815  DAGVFMERFVNNARHVEIQMM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEA 871
            D  V + +++ NA+ +E+  +   G+     ++    +  +   +  +I   P  +L   
Sbjct: 1167 DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPE 1224

Query: 872  TRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLV 931
            T  ++  A+ ++G  LK      ++FI   + ++   +E N R     P    V  ++L+
Sbjct: 1225 TVERIVVATAKIGKALKITGPFNIQFI--AKNNDIKVIECNVRASRSFPFISKVVNVNLI 1282

Query: 932  E 932
            E
Sbjct: 1283 E 1283

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 66/173 (38%), Gaps = 16/173 (9%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           +PV+ ++    GG+G    ++E       E V     ++     V +ER +   + VE +
Sbjct: 593 FPVICRAAYALGGLGSGFANNEK------ELVDLCNIAFASSPQVLVERSMKGWKEVEYE 646

Query: 834 MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
           ++ D F   I +    C+++            I   P+  L +     +R  +  +   L
Sbjct: 647 VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 702

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAAN 940
                  +++  +    E+  +EVNARL     +    TG  L     ++  N
Sbjct: 703 GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLN 755

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/300 (18%), Positives = 126/300 (42%), Gaps = 21/300 (7%)

Query: 636  AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETYLDIDKIINAAKKT 695
            AV  ++TL+   +K++ V  +P+  S    +AD       R   ET +++++I++  +  
Sbjct: 1002 AVTAVRTLRANNVKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERILDIYEAE 1053

Query: 696  GAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVPG 755
             +  ++   G  + N + +    +E +  +G S + I     ++    + ++  V   P 
Sbjct: 1054 ASAGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQ-PA 1111

Query: 756  SGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGD 815
               +              YPV+V+ +    G  +  V S+DD+        +Q      D
Sbjct: 1112 WKELTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYL----NQAVEVSRD 1167

Query: 816  AGVFMERFVNNARHVEIQMM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEAT 872
              V + +++ NA+ +E+  +   G+     ++    +  +   +  +I   P  +L   T
Sbjct: 1168 YPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDPET 1225

Query: 873  RAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVE 932
              ++  A+ ++G  LK      ++FI   + ++   +E N R     P    V G++L+E
Sbjct: 1226 VNRIVVATAKIGKALKITGPYNIQFI--AKNNDIKVIECNVRASRSFPFISKVVGVNLIE 1283

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 50/258 (19%), Positives = 96/258 (37%), Gaps = 37/258 (14%)

Query: 774  YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
            +PV+V++    GG+G     +E       E V     ++     V +ER +   + VE +
Sbjct: 593  FPVIVRAAYALGGLGSGFASNET------ELVDLCNVAFASSPQVLVERSMKGWKEVEYE 646

Query: 834  MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
            ++ D F   I +    C+++            I   P+  L +     +R  +  +   L
Sbjct: 647  VVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHL 702

Query: 888  KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDN 947
                   +++  +    E+  +EVNARL     +    TG  L     ++  N   +   
Sbjct: 703  GVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLNIPLN--- 759

Query: 948  TKIEVSGASIEARLYAENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTL- 1006
               EV  +  ++      P  D+         V  P W      +KK T VS +   ++ 
Sbjct: 760  ---EVKNSVTKSTCACFEPSLDY-------CVVKMPRWD-----LKKFTRVSTQLSSSMK 804

Query: 1007 --AKIIVHGKDRNDAIMK 1022
               +++  G+   +AI K
Sbjct: 805  SVGEVMSVGRTFEEAIQK 822

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 1/138 (0%)

Query: 70  PLYGVPIAVKDNIDYKGLPTTAACPSYLYQPT-RDSYVVELLRDAGAVVIGKTNLDQFAT 128
           P++G+PI++K+++ +KG  T A+  S L   T + +  V++    GA+   +T   Q   
Sbjct: 143 PMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTVDIFDKQGALYHVRTAQPQTIM 202

Query: 129 GLVGTRSPYGKTPCVFNDKYXXXXXXXXXXXXXXXXIVPLSLGTDTAGSGRVPAALNNLI 188
            L       G+T    + K                    + +GTD  GS R PAA   + 
Sbjct: 203 HLDTWNIITGRTRNPRSTKLSPGGSSGGESAAIGMHGSVIGIGTDIGGSIRCPAAFAGIC 262

Query: 189 GLKPTKGAFSCRGVVPAC 206
           G++PT    S   V P+ 
Sbjct: 263 GMRPTVKRVSLLDVTPSS 280

>Kwal_14.783
          Length = 1280

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 1191 VPEYLGSRSTFAMGNMGGYNGRILKLGDVLFLNQPELSVSSLP 1233
            VP +LGS ST        + G+ LK GDVLF N PE+  + LP
Sbjct: 796  VPVHLGSMSTCIAAQAKLWKGK-LKPGDVLFTNHPEIGGTHLP 837

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 81/195 (41%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+V+S    GG+G    + E +++ +        +S      + +E+ +   + +E +
Sbjct: 188 YPVIVRSAYALGGLGSGFANDEQEMKEL------ASQSLSLAPQILVEKSLKGWKEIEYE 241

Query: 834 MMGDGFGKAIAIGERDCSLQRRNQKVIEE------TPAPNLPEATRAKMRAASERLGSLL 887
           ++ D  G  I +    C+++  +   I         P+  L +     +R+A+ ++   L
Sbjct: 242 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 297

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++       ++  +EVNARL     +    TG  L     +IA   + P+  
Sbjct: 298 GVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 357

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 358 NPVTKTTVANFEPSL 372

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 63/318 (19%), Positives = 125/318 (39%), Gaps = 27/318 (8%)

Query: 636 AVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAA-ETYLDIDKIINAAKK 694
           AV   + L+  G K++ +  +P+  S   TD D    L+    + E  +DI ++ N+   
Sbjct: 604 AVNTARALREEGKKTIMINYNPETVS---TDFDEVDRLYFEELSFERVMDIYELENSEG- 659

Query: 695 TGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSAREIAERAKVPLVP 754
                +I   G L +N     +   E    +G S + I K   +H    I +   V   P
Sbjct: 660 ----CVISVGGQLPQNIAL--KLFHEGAKILGTSPEDIDKAENRHKFSSILDSIGVDQ-P 712

Query: 755 GSGLIXXXXXXXXXXXXXXYPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFG 814
               +              YPV+++ +    G  +  V+SED++E               
Sbjct: 713 EWKELTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELEVKLTNASDVSP---- 768

Query: 815 DAGVFMERFVNNARHVEIQMMG-DGFGKAIAIGER--DCSLQRRNQKVIEETPAPNLPEA 871
           D  V + +F+  A+ +++  +  DG     AI E   +  +   +  +I   P  +L E 
Sbjct: 769 DHPVVISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLI--LPPQHLSEE 826

Query: 872 TRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDE---FYFLEVNARLQVEHPITEMVTGL 928
           T+ +++  ++++           ++ I D+ RD       +E N R     P    V G+
Sbjct: 827 TKQRLKDIADKVAKAWNICGPFNMQIIKDD-RDHGTSLKVIECNIRASRSFPFVSKVLGI 885

Query: 929 DLVEWMLR--IAANDSPD 944
           + ++  ++  +  N  P+
Sbjct: 886 NFIDVAVKAFLGGNKVPE 903

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 77/195 (39%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+V+S    GG+G    D  DD++      Q   +S      V +E+ +   + +E +
Sbjct: 185 YPVIVRSAYALGGLGSGFAD--DDLQ----LRQLCAQSLALSPQVLVEKSLKGWKEIEYE 238

Query: 834 MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
           ++ D  G  I +    C+++            I   P+  L +     +R A+  +   L
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHL 294

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++        F  +EVNARL     +    TG  L     +IA   + P+  
Sbjct: 295 GVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 354

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 355 NPVTKSTVANFEPSL 369

>Scas_691.19
          Length = 1117

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 80/195 (41%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+++S    GG+G    +++ +++++                + +ER +   + VE +
Sbjct: 185 YPVIIRSAYALGGLGSGFANNDQELKQLSSQSLSLSPQ------ILVERSMKGWKEVEYE 238

Query: 834 MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
           ++ D  G  I +    C+++            I   P+  L +     +R+A+ ++   L
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEYHMLRSAAIKIIRHL 294

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++       ++  +EVNARL     +    TG  L     +IA   + P+  
Sbjct: 295 GVIGECNVQYALQPDGLDYCVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 354

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 355 NPITKTTVANFEPSL 369

>Kwal_55.19783
          Length = 1121

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/168 (17%), Positives = 72/168 (42%), Gaps = 11/168 (6%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+++ +    G  +  V+SED++    ET          D  V + +F+  A+ +++ 
Sbjct: 732 YPVLIRPSYVLSGAAMSVVNSEDEL----ETKLTNASDVSPDHPVVISKFIEGAQEIDVD 787

Query: 834 MM---GDGFGKAIAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYK 890
            +   G+    AI+    +  +   +  +I   P  +L E+ + ++   ++++    K  
Sbjct: 788 AVAYNGEVLVHAISEHVENAGVHSGDATLI--LPPQSLSESIKERLYDIAKKVAHAWKIT 845

Query: 891 CAGTVEFIYDEQRD--EFYFLEVNARLQVEHPITEMVTGLDLVEWMLR 936
               ++ I D++ +      +E N R     P    V G + ++  ++
Sbjct: 846 GPFNMQIIKDDRHEGTSLKVIECNIRASRSFPFVSKVLGCNFIDVAVK 893

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 79/195 (40%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+V+S    GG+G    ++E +++ +        ++      + +E+ +   + VE +
Sbjct: 188 YPVIVRSAYALGGLGSGFAENEAEMKEL------AAQALSLSPQILVEKSLKGWKEVEYE 241

Query: 834 MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
           ++ D     I +    C+++            I   P+  L +     +R A+ ++   L
Sbjct: 242 VVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIRHL 297

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++       ++  +EVNARL     +    TG  L     +IA   + P+  
Sbjct: 298 GVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 357

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 358 NPVTKTTVANFEPSL 372

>Kwal_27.11485
          Length = 471

 Score = 34.3 bits (77), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 394 VNSRQGTWTNFVNLADL-------AALAVPSGFRSDGLPNGI--TLIGKKFSDYALLDLA 444
           +N+  GT T F +  +L         LA+P  FRSDG+  GI  TLI    S + L  LA
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 445 K 445
           K
Sbjct: 61  K 61

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 81/195 (41%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           +PV+V+S    GG+G    ++  +++      Q   +S      + +E+ +   + VE +
Sbjct: 186 FPVIVRSAYALGGLGSGFANNAQEMK------QLASQSLSLAPQILVEKSLKGWKEVEYE 239

Query: 834 MMGDGFGKAIAIGERDCSLQRRNQKVIEE------TPAPNLPEATRAKMRAASERLGSLL 887
           ++ D  G  I +    C+++  +   I         P+  L +     +R+A+ ++   L
Sbjct: 240 VVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 295

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++       ++  +EVNARL     +    TG  L     +IA   + P+  
Sbjct: 296 GVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 355

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 356 NPITKTTVANFEPSL 370

>Sklu_2372.4 YKL215C, Contig c2372 8103-11945
          Length = 1280

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1191 VPEYLGSRSTFAMGNMGGYNGRILKLGDVLFLNQPELSVSSLP 1233
            VP +LGS ST        + G+ LK GDVL  N PE+  + LP
Sbjct: 798  VPVHLGSMSTCISAQANLWKGK-LKSGDVLITNHPEIGGTHLP 839

>KLLA0A02365g 211300..212568 similar to sgd|S0005681 Saccharomyces
           cerevisiae YOR155c, hypothetical start
          Length = 422

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 629 IANRGEIAVRIMKTLKR---MGIKSVAVYSDPDKYSQHVTDADFSV 671
           I   G+I  RI+  LKR   +G+ + A Y DPDKY + +    F++
Sbjct: 158 IERGGKIVTRIITLLKRGINVGVVTAAGYDDPDKYKERLYGLCFAL 203

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 80/195 (41%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+++S    GG+G    ++ ++++ +        +S      V +E+ +   + VE +
Sbjct: 184 YPVIIRSAYALGGLGSGFANNPEELKEL------ASQSLSLAPQVLVEKSLRGWKEVEYE 237

Query: 834 MMGDGFGKAIAIGERDCSLQR------RNQKVIEETPAPNLPEATRAKMRAASERLGSLL 887
           ++ D     I +    C+++            I   P+  L +     +R+A+ ++   L
Sbjct: 238 VVRDRENNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHL 293

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++       ++  +EVNARL     +    TG  L     +IA   + P+  
Sbjct: 294 GVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIALGYTLPELP 353

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 354 NPITKTTVANFEPSL 368

>KLLA0C18975g complement(1684573..1688433) similar to sp|P28273
            Saccharomyces cerevisiae YKL215c singleton, start by
            similarity
          Length = 1286

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1191 VPEYLGSRSTFAMGNMGGYNGRILKLGDVLFLNQPELSVSSLP 1233
            VP +LGS ST        + G+ LK GDV+  N PE+  + LP
Sbjct: 804  VPVHLGSMSTCIAAQAKLWKGK-LKPGDVIITNHPEIGGTHLP 845

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 80/195 (41%), Gaps = 17/195 (8%)

Query: 774 YPVMVKSTAGGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQ 833
           YPV+V+S    GG+G    ++  +++ +        +S      + +E+ +   + VE +
Sbjct: 185 YPVIVRSAYALGGLGSGFANNASEMKEL------AAQSLSLAPQILVEKSLKGWKEVEYE 238

Query: 834 MMGDGFGKAIAIGERDCSLQRRNQKVIEE------TPAPNLPEATRAKMRAASERLGSLL 887
           ++ D  G  I +    C+++  +   +         P+  L +     +R+A+ ++   L
Sbjct: 239 VVRDRVGNCITV----CNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHL 294

Query: 888 KYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDS-PDFD 946
                  V++       ++  +EVNARL     +    TG  L     +I    + P+  
Sbjct: 295 GVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPELP 354

Query: 947 NTKIEVSGASIEARL 961
           N   + + A+ E  L
Sbjct: 355 NPITKTTVANFEPSL 369

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 59,848,726
Number of extensions: 2725784
Number of successful extensions: 6453
Number of sequences better than 10.0: 63
Number of HSP's gapped: 6458
Number of HSP's successfully gapped: 83
Length of query: 1801
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1685
Effective length of database: 12,580,421
Effective search space: 21198009385
Effective search space used: 21198009385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)