Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08085g65664632760.0
Sklu_2380.362263316850.0
ACR172W61265716680.0
Kwal_14.86362863115680.0
Scas_685.764564014620.0
CAGL0L09889g71771611991e-156
YKL025C (PAN3)67946310201e-129
ADR313W5781451104e-05
YOL100W (PKH2)108192950.003
YHR102W (KIC1)1080146920.007
Scas_580.61015146890.014
CAGL0L11550g107257870.025
Kwal_55.21545865115840.048
ACL104C947150820.10
ABL143C72578810.13
YLR096W (KIN2)114790800.15
CAGL0J04972g33996780.19
YDL025C620125790.19
CAGL0M11396g1192108790.23
KLLA0B06501g81745770.37
Scas_660.2095781770.40
Scas_655.280069760.54
CAGL0K12562g168283760.55
Kwal_33.14434759153750.55
YNL183C (NPR1)79069750.60
Sklu_1722.280957750.63
Scas_649.2129437730.71
KLLA0A02717g43244740.72
YDR151C (CTH1)32527730.74
Scas_502.2111688750.75
CAGL0K01661g48291740.81
YFL033C (RIM15)177081740.94
CAGL0G04609g96587731.00
AFR372W77448731.0
KLLA0D08415g774159731.1
KLLA0D03190g372161721.2
Kwal_33.1368171551721.3
CAGL0J11308g72892721.4
Sklu_2437.16107190721.5
YJR059W (PTK2)81847721.5
Sklu_2092.239130711.8
KLLA0F19536g110490711.9
YHR082C (KSP1)1029101702.3
ACL071C29825683.6
Sklu_2396.328527673.7
KLLA0F23507g487161684.0
ACR281C125966675.1
Sklu_2199.2374146665.5
AGR058W107190667.0
Kwal_47.186502159115667.5
Scas_634.579047668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08085g
         (646 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...  1266   0.0  
Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement        653   0.0  
ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...   647   0.0  
Kwal_14.863                                                           608   0.0  
Scas_685.7                                                            567   0.0  
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...   466   e-156
YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...   397   e-129
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    47   4e-05
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    41   0.003
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    40   0.007
Scas_580.6                                                             39   0.014
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    38   0.025
Kwal_55.21545                                                          37   0.048
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    36   0.10 
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    36   0.13 
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    35   0.15 
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    35   0.19 
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    35   0.19 
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    35   0.23 
KLLA0B06501g complement(576636..579089) some similarities with s...    34   0.37 
Scas_660.20                                                            34   0.40 
Scas_655.2                                                             34   0.54 
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    34   0.55 
Kwal_33.14434                                                          33   0.55 
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    33   0.60 
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         33   0.63 
Scas_649.21                                                            33   0.71 
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    33   0.72 
YDR151C (CTH1) [995] chr4 complement(764172..765149) Protein con...    33   0.74 
Scas_502.2                                                             33   0.75 
CAGL0K01661g complement(146952..148400) some similarities with t...    33   0.81 
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    33   0.94 
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    33   1.00 
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    33   1.0  
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    33   1.1  
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    32   1.2  
Kwal_33.13681                                                          32   1.3  
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    32   1.4  
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      32   1.5  
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    32   1.5  
Sklu_2092.2 YMR133W, Contig c2092 1528-2703 reverse complement         32   1.8  
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    32   1.9  
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    32   2.3  
ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C (R...    31   3.6  
Sklu_2396.3 YLR136C, Contig c2396 8035-8892 reverse complement         30   3.7  
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    31   4.0  
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    30   5.1  
Sklu_2199.2 YGL025C, Contig c2199 1811-2935 reverse complement         30   5.5  
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    30   7.0  
Kwal_47.18650                                                          30   7.5  
Scas_634.5                                                             30   8.2  

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score = 1266 bits (3276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/646 (94%), Positives = 613/646 (94%)

Query: 1   MISSASGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRS 60
           MISSASGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRS
Sbjct: 1   MISSASGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRS 60

Query: 61  MTPLNVKFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPS 120
           MTPLNVKFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPS
Sbjct: 61  MTPLNVKFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPS 120

Query: 121 LMNSNATAFAPSFNPYASESFTPSVSAGGIPSSQELAGTLHGXXXXXXXXXXXXXXXXXA 180
           LMNSNATAFAPSFNPYASESFTPSVSAGGIPSSQELAGTLHG                 A
Sbjct: 121 LMNSNATAFAPSFNPYASESFTPSVSAGGIPSSQELAGTLHGSNPSIPSPVPSNPYVNSA 180

Query: 181 GLPSGGMLGVGHPMQGLXXXXXXGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKI 240
           GLPSGGMLGVGHPMQGL      GALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKI
Sbjct: 181 GLPSGGMLGVGHPMQGLPPPPPPGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKI 240

Query: 241 PLKPNERTPETLFINNHLRDRLVKNNQTALQVFPRGSLPDIVGDYFGLVPMDFHNRTSDK 300
           PLKPNERTPETLFINNHLRDRLVKNNQTALQVFPRGSLPDIVGDYFGLVPMDFHNRTSDK
Sbjct: 241 PLKPNERTPETLFINNHLRDRLVKNNQTALQVFPRGSLPDIVGDYFGLVPMDFHNRTSDK 300

Query: 301 KRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSF 360
           KRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSF
Sbjct: 301 KRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSF 360

Query: 361 VTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGL 420
           VTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGL
Sbjct: 361 VTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGL 420

Query: 421 ALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYXXXXXXXXXXVQR 480
           ALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNY          VQR
Sbjct: 421 ALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYLSLAELLLNLVQR 480

Query: 481 LCGASGPLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSE 540
           LCGASGPLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSE
Sbjct: 481 LCGASGPLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSE 540

Query: 541 YLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDT 600
           YLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDT
Sbjct: 541 YLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDT 600

Query: 601 GKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDL 646
           GKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDL
Sbjct: 601 GKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDL 646

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/633 (54%), Positives = 425/633 (67%), Gaps = 33/633 (5%)

Query: 17  KGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTPLNVKFNAKTSSSF 76
           K   C+NI IHG+CKFEN+GC FNHG+S    G     V T   +     KFNAKT+SSF
Sbjct: 10  KDIPCKNITIHGFCKFENDGCIFNHGSSGTKTG-----VNTPTGIMNSASKFNAKTASSF 64

Query: 77  TPGKSPAVRSPDFSSLPAF--QPGAPVNDQPMLADGPQISGTMSPSLMNSNATAFAPSFN 134
           TP K   + S DF+ +  F     A V   P+ A           S++NS    FA +FN
Sbjct: 65  TPSK---ITSSDFNGVSGFTSDKSATVTTAPVAA-----------SVVNS--PTFATNFN 108

Query: 135 PYASESFTPSVSAGGIPSSQELAGTLHGXXXXXXXXXXXXXXXXXAGLPSGGMLGVGHPM 194
           PY ++SFTPS SAG    S        G                     +G       P 
Sbjct: 109 PYVADSFTPSGSAGVSSPSFNPYSAPSGIGGASSTATHTQTAPV-----TGFTQRPPDPR 163

Query: 195 QGLXXXXXXGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTPETLFI 254
             L       +  V+    FPT+YPP HS+LQYHLYAPDPPPHLK+PLKPNERTPETLFI
Sbjct: 164 SSLTSAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFI 223

Query: 255 NNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDKKRYNGHKNSLYKV 313
            N LR+ LVK NQ+ALQVFP G SLP+IVGDYFGLVP++FH+R S K+RY GH+NSLYKV
Sbjct: 224 PNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKV 283

Query: 314 FSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSLCMV 373
           FSN DGKIY MRRIHDV IT++ QVS+PFQ W  +  AN+  +KD+F+T AFNDSSLC+V
Sbjct: 284 FSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVV 343

Query: 374 FDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVT 433
            +Y+PQS SLYET+ +  ++  + Q+YLWA+LVQLT AL+EVHS  L++N L W KVIVT
Sbjct: 344 HEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVT 403

Query: 434 GEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYXXXXXXXXXXVQRLCGASGPLDDVKS 493
           GEPGRIKV+D GVYD L +  E R +  EQQ+++          V ++  AS      + 
Sbjct: 404 GEPGRIKVSDCGVYDIL-HSLESRDIEEEQQKDFEELGKLLNGLVTKI--ASSKDTSTQD 460

Query: 494 YHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQLSRELENA 553
             +D  FK  + YL   +++ KN+ +   LF+ ++LSVV+SLQ + E  E  LSRELEN 
Sbjct: 461 LKVDSDFKIVLDYLL-LNDHKKNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENG 519

Query: 554 RLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVMDLTHVLRC 613
           RLFRLMCKLN I+GR ESR+DINW+ESGEKFPIILF+DYVFHQ D+ GK++MDLTHVLRC
Sbjct: 520 RLFRLMCKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRC 579

Query: 614 LNKLDAGVSERLMLVTPDEMNCIIISYKELKDL 646
           LNKLDAGV+E++MLVTPDEMNCIIISYKELKDL
Sbjct: 580 LNKLDAGVTEKIMLVTPDEMNCIIISYKELKDL 612

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/657 (52%), Positives = 430/657 (65%), Gaps = 68/657 (10%)

Query: 1   MISSASGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHG----NSKETEGQTTDEVP 56
           M+ + S T+W      K T C+NI I+GYCK+EN+GC FNHG     S  T G       
Sbjct: 1   MMMNKSKTDWA-----KDTPCKNITIYGYCKYENDGCIFNHGKPLSTSSNTGGAAAGSAE 55

Query: 57  TQRSMTPLNV------KFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADG 110
              +   + V       FNAKT++SFTP    +V  PDF+++P+F P   V+        
Sbjct: 56  DSAASGGVTVGNTGKSTFNAKTATSFTP----SVAIPDFNNIPSFTPERIVS-------- 103

Query: 111 PQISGTMSPSLMNSNATAFAPSFNPYASESFTPSVSAGGIPSSQELAGTLHGXXXXXXXX 170
                  SP+     ATAF PSFNPY S+SF PS +  G P S                 
Sbjct: 104 -------SPA--GDGATAFTPSFNPYGSDSFNPSANVSG-PGS----AVFAAASGNAGAS 149

Query: 171 XXXXXXXXXAGLPSGGMLGVGHPMQGLXXXXXXGALPVNPITQFPTVYPPTHSVLQYHLY 230
                      + +GG L    P+ G               T FPTVYPP+HS+LQYHLY
Sbjct: 150 ATAAPRSQSVHVGTGGYL----PLAG---------------TAFPTVYPPSHSILQYHLY 190

Query: 231 APDPPPHLKIPLKPNERTPETLFINNHLRDRLVKNNQTALQVFPR-GSLPDIVGDYFGLV 289
           APDPPPHL++PLK NERTPETLFI N+LR+ L+K N +ALQVFP  G+LPDIVGDYFGLV
Sbjct: 191 APDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSALQVFPSDGNLPDIVGDYFGLV 250

Query: 290 PMDFHNRTSDKKRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLR 349
           P++FHNR + K RY GH+NSLYKVFSN DGK+Y +RRIHDVK TD  Q+S PF+ W  + 
Sbjct: 251 PLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKVS 310

Query: 350 SANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLT 409
             N+  +KD+F T AF DSSLC+V DYYPQS SLYET+    +V  + Q+YLW++LVQL+
Sbjct: 311 CPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYETHVANYTVVPVTQKYLWSYLVQLS 370

Query: 410 IALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYXX 469
            AL EVH +GL++N++   KVIVTG+PGRIKV D  V+D L +  EGR +  EQQ +Y  
Sbjct: 371 NALNEVHRHGLSMNNISLDKVIVTGDPGRIKVGDSAVHDILAF-DEGRDIAKEQQADYSA 429

Query: 470 XXXXXXXXVQRLCGASG-PLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKV 528
                    QR+ G    PLD   S  IDPLFK+ + YL   S+  K I +FT LFSHK+
Sbjct: 430 VGALLMDLAQRMLGTRDQPLD---SMDIDPLFKRVLAYL--LSDEKKTIAEFTALFSHKM 484

Query: 529 LSVVNSLQYNSEYLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIIL 588
           L +++S Q  SEY+EQ LSRELEN RLFRLMCKLN I+GR+ES +DI+W+E+G+KFPIIL
Sbjct: 485 LDIISSSQTYSEYIEQHLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPIIL 544

Query: 589 FFDYVFHQKDDTGKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKD 645
           F+DYVFHQ D+ GK+VMDLTHVLRCLNKLD GVSE+++LVTPDEMNCIIISYKELKD
Sbjct: 545 FYDYVFHQVDENGKSVMDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELKD 601

>Kwal_14.863
          Length = 628

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/631 (50%), Positives = 412/631 (65%), Gaps = 37/631 (5%)

Query: 17  KGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTPLNVKFNAKTSSSF 76
           K   C+NI I+G+CK+ENEGC FNHGN+ +                   +KFNAKT+SSF
Sbjct: 24  KDIPCKNITIYGFCKYENEGCIFNHGNANQNTNSA-------------GLKFNAKTASSF 70

Query: 77  TPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMNSNATAFAPSFNPY 136
           TP K+ + ++   +++ A +          LA   +   T SP  + + +  F  S+NPY
Sbjct: 71  TPSKALSTKNSTSTAIKAEKVAK------ALASAAEQPSTSSP--LAAKSAPFGSSYNPY 122

Query: 137 ASESFTPSVSAGGIPSSQELAGTLHGXXXXXXXXXXXXXXXXXAGLPSGGMLGVGHPMQG 196
           A+ +FTP  SAG   +S                          A L  G     G P   
Sbjct: 123 AA-NFTPVGSAG---TSTPPPAAASRTSFNPYSAPAGMTTPGEAPLQPGASFIPGSPAPY 178

Query: 197 LXXXXXXGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTPETLFINN 256
                          T FP++YPP+HS+LQYHLYAPDPP HLK+PLK NERTPETLFI N
Sbjct: 179 AQDAPGR-------YTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPN 231

Query: 257 HLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDKKRYNGHKNSLYKVFS 315
           ++R+ L+K N  ALQVFP G +LP+IVGDYFGLVP++FHNR S+K RY GH+NSLYKVFS
Sbjct: 232 NMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKVFS 291

Query: 316 NLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSLCMVFD 375
           N DGK+Y MRRIHDVK+ +S Q+ KPFQ W  + ++N+   KD+F+T AFND+SLC+V +
Sbjct: 292 NFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHE 351

Query: 376 YYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGE 435
           Y+PQS SLYET+ ++ S   + Q+ LW++LVQL  A+Q  H+  LA N++   KVIVTG 
Sbjct: 352 YFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIVTGN 411

Query: 436 PGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYXXXXXXXXXXVQRLCGASGPLDDVKSYH 495
           PGR+K+ D  V+D L Y Q+ R +  EQ+ ++            +L G+    + V S  
Sbjct: 412 PGRVKIGDSCVHDIL-YFQDERDVLKEQKHDFADLGGLLKDLAAKLVGSQD--NTVDSLA 468

Query: 496 IDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQLSRELENARL 555
           +D  FK+ + YL D   + K + +   LFSHK+L +++SLQ  +EY E  L+RELENARL
Sbjct: 469 VDDDFKQVLNYLLD-PKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARL 527

Query: 556 FRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVMDLTHVLRCLN 615
           FRLMCK+N I+GR+ESRIDINW+ESGEKFPIILF+DYVFHQ D+TGK VMDLTHVLRCLN
Sbjct: 528 FRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLRCLN 587

Query: 616 KLDAGVSERLMLVTPDEMNCIIISYKELKDL 646
           KLDAG+ E+LMLVTPDEMNCIIISYKELKDL
Sbjct: 588 KLDAGIGEKLMLVTPDEMNCIIISYKELKDL 618

>Scas_685.7
          Length = 645

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/640 (47%), Positives = 412/640 (64%), Gaps = 24/640 (3%)

Query: 17  KGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRS----MTPLNVKFNAKT 72
           K   CRN+ I+GYCK   +GC F H  + E   +  + VP Q+S    +   + KFN K+
Sbjct: 10  KDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEPVPVQQSPVAPVPSFSRKFNPKS 69

Query: 73  SSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMNSNATAFAPS 132
           S+SFTP  S   ++P+ +++ +F+  +  +     A  P+    M+  L + ++ A   S
Sbjct: 70  SASFTPMSS---KTPELAAVSSFERSSNPSSPAPPASIPK---PMNSPLASQSSNA---S 120

Query: 133 FNPYASESFTPSVSAGGIPSSQELAG--TLHGXXXXXXXXXXXXXXXXXAGLPSGG--ML 188
           F P    S+  S S G + ++  L    +LH                    LPS    + 
Sbjct: 121 FPPQPFYSYPASSSNGTLLNNTILPDGISLHDPAFPLTQIDKTMLAND-PNLPSANVPLQ 179

Query: 189 GVGHPMQGLXXXXXXGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERT 248
               P   +           N  +++P++YPP HS+LQYHLYAPDPPP L++PLKPNERT
Sbjct: 180 FSSSPASNIHQQMLNENNINNNNSRYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERT 239

Query: 249 PETLFINNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDKKRYNGHK 307
           PETLFI N LR++LVK N  +LQ+FP G ++PDIV DYFGLVP+DFH +   K RY GHK
Sbjct: 240 PETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVTKDRYQGHK 299

Query: 308 NSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFND 367
           NSLYKVFSNLDGK+Y +RRIHDV+I D  Q++KPFQ W++L    I  L+D F+T+ F D
Sbjct: 300 NSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGD 359

Query: 368 SSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDW 427
           SSLC+V+D+YPQ+ SLYE +     +  + Q+YLW +LVQLT A+  VHS G  +  +DW
Sbjct: 360 SSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIGLIDW 419

Query: 428 KKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYXXXXXXXXXXVQRLC-GASG 486
            K+IVTG+PGRIK++  G  D L  ++E   LH++QQ ++            ++   A+ 
Sbjct: 420 DKIIVTGDPGRIKLSGCGAIDVLGANEELD-LHSKQQMDFENLGQLLFKLASKIGNNANA 478

Query: 487 PLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQL 546
            +D++    +D  FK  +QYL + +N+ K I + ++LF  K+LS V S Q  +EY E  L
Sbjct: 479 KIDELS---VDDQFKTVLQYLLNDTNDRKTINELSQLFIDKILSNVESSQGYAEYTEGIL 535

Query: 547 SRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVMD 606
           SRELEN RLFRL+CKLN I+G++ESR+DINW+ESGEKFPIILF+D+VFHQ D+TGK+VMD
Sbjct: 536 SRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMD 595

Query: 607 LTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDL 646
           LTHVLRCLNKLDAG  E+L+L TPDEMNCIIISYKELKDL
Sbjct: 596 LTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDL 635

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score =  466 bits (1199), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 288/716 (40%), Positives = 394/716 (55%), Gaps = 96/716 (13%)

Query: 13  PDSFKGTQCRNIIIHGYCKFENEGCQFNHGN----SKETEGQTTDEVP------------ 56
           PD  +   CRN+II+G+CK + EGC F H +    +  +  +  D VP            
Sbjct: 6   PDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQQPSKI 65

Query: 57  TQRSMTPLNV------------------------KFNAKTSSSFTPGKSPA-----VRSP 87
           +  S+  LN                         KFNAK S+SFTP    A      ++P
Sbjct: 66  SVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFNAKASASFTPMSKAADGTQETQAP 125

Query: 88  DFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMN-----SNATAFAPSFNPYASESFT 142
              S  A  PG      P+L  G  +S  M P++ +     S A+   P+     ++  +
Sbjct: 126 YLESPVAGSPG------PILKAGTPVS-FMQPNIYSTTPVPSPASMAMPNVVMPPNDMGS 178

Query: 143 PSVSAGGIPSSQELAGTLHGXXXXXXXXXXXXXXXXXAGLPSG-------------GMLG 189
           P +          L G++                       SG             G+  
Sbjct: 179 PDLGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMGTSGSRPMLDQQIHSISGLSN 238

Query: 190 VGHP-----MQGLXXXXXXGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKP 244
              P     +Q +        LP+N   ++PT+YPPTHS+LQYHLYAPDPPP L+I LK 
Sbjct: 239 TSGPQPPGLLQSMNGASMDMGLPMN--LRYPTIYPPTHSILQYHLYAPDPPPQLEIALKE 296

Query: 245 NERTPETLFINNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDKKRY 303
           NERTP  LFI N LR+ LVK N  +LQ+FP G +LP IV DYFGLVP+DFH R+S K RY
Sbjct: 297 NERTPRMLFIPNDLREELVKRNLASLQLFPSGGNLPHIVKDYFGLVPLDFHQRSSVKDRY 356

Query: 304 NGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSFVTS 363
             HKNSLYKVFSN+DG+IY +RRIHDV I+D   +SK FQ WS + S+N+  LKD F+T+
Sbjct: 357 KKHKNSLYKVFSNVDGRIYLLRRIHDVNISDPTIISKTFQKWSKIDSSNVVALKDLFLTT 416

Query: 364 AFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVH-SNGLAL 422
           AF DSSL +V+DYYP + SLYE + +     E+ ++ LW++ VQ+   L+E+H +NG+ +
Sbjct: 417 AFGDSSLGIVYDYYPNATSLYEAHFVNYPTVEVTEDLLWSYAVQILNGLREIHNTNGVNI 476

Query: 423 NDLDWKKVIVTGEPGRIKVTDIGVYDTLNY-----HQEGRMLHTEQQQNYXXXXXXXXXX 477
            DLD  K+I+TG+ GRIK++    YD +N      +++       +++N+          
Sbjct: 477 GDLDCDKIILTGK-GRIKISAGAEYDIMNMCCPEDNEDDDNEEKLRKRNFVDLGEILFKL 535

Query: 478 VQRLCGASGPLDDVK-----SYHIDPLFKK-CIQYLQDTSNNNKNIEDFTKLFSHKVLSV 531
             ++C   G   DV      S  +  L K    + L D  N    IE +  L    V  V
Sbjct: 536 ASKMCNCHG--KDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIEKYIGL--DVVFKV 591

Query: 532 VNSLQYNSEYLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFD 591
           + + Q  SEY E  LSRELEN RLFRL+CKLN I+GR+E+R+DINW+E G+KF I+LF+D
Sbjct: 592 MEAQQTYSEYAENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVLFYD 651

Query: 592 YVFHQKD-DTGKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDL 646
           YVFHQ D +TGK V DLTHVLRCLNKLDAGV E ++LVTPDE+N  ++SYK++K+L
Sbjct: 652 YVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVKEL 707

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score =  397 bits (1020), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 289/463 (62%), Gaps = 39/463 (8%)

Query: 213 QFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTPETLFINNHLRDRLVKNNQTALQV 272
           ++P +YPP HS+LQYHLYAP+ P  LK  LKPNER+ + LFI N++R+ L K N + LQV
Sbjct: 217 KYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQV 276

Query: 273 FPRGS--LPDIVGDYFGLVPMDFHNRTSDKKRYNGHKNSLYKVFSNLDGKIYFMRRIHDV 330
           FP     +P IV DYF LVP       +       +K +L+KVFSN DGK Y ++R+ ++
Sbjct: 277 FPSSGKVIPSIVQDYFNLVP------LNFNNNDFLNKTTLFKVFSNYDGKAYVLKRLPNI 330

Query: 331 -KITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGL 389
            K  +  ++SK +Q WS +   N+   +D F T+ F D S+C+VFDYYP S SLY+ + +
Sbjct: 331 DKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFV 390

Query: 390 ANSVNELNQEYLWAFLVQLTIALQEVHSNGLAL-NDLDWKKVIVTGEPGRIKVTDIGVYD 448
                 +   YLW +LVQLT  +  +HS  L++ N L+W+KV++TG+PGRIK++     D
Sbjct: 391 NFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD 450

Query: 449 TL-------NYHQEGRMLHTEQQQNYX-----------------XXXXXXXXXVQRLCGA 484
            L            G  +  +QQ +Y                           ++ +   
Sbjct: 451 LLFNDDTDTVVSSGGSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPKEYRLEEITPQ 510

Query: 485 SGPLDDVKSYHIDPLFKKCIQYL-QDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLE 543
           S  +DD++   ID  FK  ++YL  D  ++ K+I D T  F  K+  V+ S Q  +EY+E
Sbjct: 511 S--IDDMR--QIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYME 566

Query: 544 QQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKN 603
             LSRELEN RLFRL+ KLN I+GR+ESRIDINW+ESG KFPIILF+DYVFHQ D  GK 
Sbjct: 567 SVLSRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKP 626

Query: 604 VMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDL 646
           +MDLTHVLRCLNKLDAG+ E+LMLVTPDE+NCIIISYKELKDL
Sbjct: 627 IMDLTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELKDL 669

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 42/74 (56%), Gaps = 11/74 (14%)

Query: 13 PDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVP--------TQRSMTPL 64
          PD  K   CRNI I+GYCK E EGC F H  S  T   T ++VP        T  +MT +
Sbjct: 6  PDWAKDIPCRNITIYGYCKKEKEGCPFKH--SDNTTATTINDVPPPIDVGEATTPTMTSV 63

Query: 65 NVKFNAKTSSSFTP 78
            KFNAK S+SFTP
Sbjct: 64 -PKFNAKVSASFTP 76

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 16/145 (11%)

Query: 313 VFSNLDGKIYFMRRIHDVKITD-----SAQVSKPFQTWSHLRSANITVLKDSFVTSAFND 367
           V  + DG+++ ++R       +     S +V+  F T S LR  NI    D         
Sbjct: 280 VIKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNIIETLDMLQEGEL-- 337

Query: 368 SSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDW 427
               +V +Y P     Y+ + L  S N++ +  +W +  Q+   +  +HS GLA  DL  
Sbjct: 338 --FLVVMEYCP-----YDFFNLVMS-NQMTKHEVWCYFKQICRGVDYLHSQGLAHRDLKL 389

Query: 428 KKVIVTGEPGRIKVTDIGVYDTLNY 452
              +VT + G +K+ D G      Y
Sbjct: 390 DNCVVTAD-GILKLIDFGSAIIFRY 413

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 363 SAFND-SSLCMVFDYYPQSQ--SLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNG 419
           S F D SSL  + +Y P     SL + YG   S++E    Y   +  Q+  A+  +HSNG
Sbjct: 245 STFQDESSLYFLLEYAPNGDFLSLMKKYG---SLDETCARY---YAAQIIDAIDYLHSNG 298

Query: 420 LALNDLDWKKVIVTGEPGRIKVTDIGVYDTLN 451
           +   D+  + +++ GE  +IK+TD G    LN
Sbjct: 299 IIHRDIKPENILLDGE-MKIKLTDFGTAKLLN 329

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 72/146 (49%), Gaps = 16/146 (10%)

Query: 310 LYKVFSNLDGKIYFMRRIH-DVKITDSAQVSKPFQTWSHLRS-ANITVLKDSFVTSAFND 367
           +YK ++   G++Y ++ ++ D    +   V +  Q  + L+  +NIT     +  S   D
Sbjct: 37  VYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNIT----RYYGSYLKD 92

Query: 368 SSLCMVFDYYPQS--QSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDL 425
           +SL ++ ++      +SL           +++++Y+   + +L +AL+ +H + +   D+
Sbjct: 93  TSLWIIMEHCAGGSLRSLLRP-------GKIDEKYIGVIMRELLVALKCIHKDNVIHRDI 145

Query: 426 DWKKVIVTGEPGRIKVTDIGVYDTLN 451
               V++T E G +K+ D GV   +N
Sbjct: 146 KAANVLITNE-GNVKLCDFGVAAQVN 170

>Scas_580.6
          Length = 1015

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 69/146 (47%), Gaps = 16/146 (10%)

Query: 310 LYKVFSNLDGKIYFMRRIH-DVKITDSAQVSKPFQTWSHLRS-ANITVLKDSFVTSAFND 367
           +YK +     +IY ++ ++ D    +   V +  Q  S L+   NIT     +  S   D
Sbjct: 51  VYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQIPNIT----RYYGSYLKD 106

Query: 368 SSLCMVFDYYPQS--QSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDL 425
           +SL ++ +Y      +SL           +++++Y+   + +L +AL+ +H + +   D+
Sbjct: 107 TSLWIIMEYCAGGSLRSLLRP-------GKIDEKYIGVIMRELLVALKYIHKDNVIHRDI 159

Query: 426 DWKKVIVTGEPGRIKVTDIGVYDTLN 451
               V++T E G +K+ D GV   LN
Sbjct: 160 KAANVLITNE-GSVKLCDFGVAAQLN 184

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 395 ELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTLN 451
           +++++Y+   + +L +AL+ +H + +   D+    V++T E G++K+ D GV   LN
Sbjct: 108 KIDEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLITNE-GQVKLCDFGVAAQLN 163

>Kwal_55.21545
          Length = 865

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 11/115 (9%)

Query: 338 VSKPFQTWSHLRSA-NITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNEL 396
           V K  Q  S L+   NIT     +  S  ND+ L ++ +Y     SL           ++
Sbjct: 62  VQKEIQFLSSLKQVPNIT----HYYGSYLNDTKLWVIMEYC-AGGSLRTLL----RPGKI 112

Query: 397 NQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTLN 451
            ++Y+   + +L  AL  +H +G+   D+    V++T + G IK+ D GV   L+
Sbjct: 113 GEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLITND-GHIKLCDFGVAAQLS 166

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 66/150 (44%), Gaps = 12/150 (8%)

Query: 310 LYKVFSNLDGKIYFMRRIH-DVKITDSAQVSKPFQTWSHLRSA-NITVLKDSFVTSAFND 367
           +YK +     ++Y ++ ++ D    +   V K  Q  + L+   NIT     +  S   D
Sbjct: 39  VYKAYHAKTKQVYAVKVLNLDCPEDEVEDVQKEIQFLASLKQVPNIT----RYYGSYLYD 94

Query: 368 SSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDW 427
           + L ++ +Y     SL           +++++YL   + +L IAL  +H + +   D+  
Sbjct: 95  TKLWVIMEYC-AGGSLRTLL----RPGKIDEKYLGVIVRKLLIALVYIHKDNVIHRDIKA 149

Query: 428 KKVIVTGEPGRIKVTDIGVYDTLNYHQEGR 457
             V++T E G +K+ D GV   L      R
Sbjct: 150 ANVLITNE-GHVKLCDFGVAAQLTAANHKR 178

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 384 YETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTD 443
           Y+ + +  S N ++ E +   L Q+ I +  +HS GLA  DL     ++  + G +K+ D
Sbjct: 462 YDLFAIVMS-NRMSYEEICCCLKQILIGIGYLHSLGLAHRDLKLDNCVLNSQ-GIVKIID 519

Query: 444 IGVYDTLNYHQEGRMLHT 461
            G      Y   G ++  
Sbjct: 520 FGAAVVFTYPHSGTLVEA 537

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 372 MVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVI 431
           M+F+Y    Q L   Y + +    L + +   F   +  ALQ +H+N +   DL  + ++
Sbjct: 200 MLFEYVSGGQLL--DYIIQHG--SLKEHHARKFARGIASALQYLHANNIVHRDLKIENIM 255

Query: 432 VTGEPGRIKVTDIGVYDTLNYHQEGRMLHT 461
           ++   G IK+ D G+ +  +Y ++   LHT
Sbjct: 256 ISSS-GEIKIIDFGLSNIFDYRKQ---LHT 281

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 353 ITVLKDSFVTSAFN--DSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTI 410
           +T+ K  +V + ++   S   +  ++ P S S   +  L+ S+ E        + +Q+  
Sbjct: 98  VTLRKSKYVVNVYDLDISKRTIKMEFLPFSLSRVLSMDLSPSLQEKK-----CYFLQICE 152

Query: 411 ALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGV 446
           A+Q +HS G+   DL  + +++  +  +IK+ D GV
Sbjct: 153 AVQYLHSRGIVHRDLKLENIMLCADACQIKLIDFGV 188

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 11/125 (8%)

Query: 335 SAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVN 394
           S +V+  F   S L   NI    D          +  +V +Y P     Y+ + L  S N
Sbjct: 351 SKKVTTEFCIGSTLHHENIVETLDMLTEG----DTYLLVMEYAP-----YDFFNLVMS-N 400

Query: 395 ELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQ 454
            + Q+ +  +  QL   +  +HS GLA  DL     +VT + G +K+ D G      Y  
Sbjct: 401 LMTQDEVNCYFKQLCHGVNYLHSMGLAHRDLKLDNCVVTKD-GILKLIDFGSAVVFQYPY 459

Query: 455 EGRML 459
           E  ++
Sbjct: 460 EDTIV 464

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 24/108 (22%)

Query: 364 AFNDSSLCMVFDYYPQSQSLYETYGLANSV-------------------NELNQEYLWAF 404
           A  ++SL  +F Y+P    L+E   ++N                       L + +   F
Sbjct: 179 AIREASLGQIF-YHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYIIQHGSLREHHARKF 237

Query: 405 LVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIG---VYDT 449
              +  ALQ +H+N +   DL  + ++++   G IK+ D G   VYDT
Sbjct: 238 ARGVASALQYLHANNIVHRDLKIENIMISNS-GEIKIIDFGLSNVYDT 284

>KLLA0B06501g complement(576636..579089) some similarities with
           sp|P47116 Saccharomyces cerevisiae YJR059w PTK2 involved
           in polyamine uptake, hypothetical start
          Length = 817

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 402 WAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGV 446
           W    Q+   ++ +HS G+A  D+  + V+VT + G +K+TD G+
Sbjct: 372 WCCFKQIARGIRHMHSLGIAHRDIKLENVLVT-DYGALKLTDFGI 415

>Scas_660.20
          Length = 957

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 366 NDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDL 425
           ++ +L  V DY P  + L     L + +   ++ +   F VQL   L+ +HS G+   DL
Sbjct: 84  DEENLYYVLDYLPGGELL----SLLHKMKTFSEVWSKHFTVQLVDTLEFIHSQGVIHRDL 139

Query: 426 DWKKVIVTGEPGRIKVTDIGV 446
             + V++  + G++ +TD G 
Sbjct: 140 KPENVLLDRD-GKLMITDFGA 159

>Scas_655.2
          Length = 800

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 384 YETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTD 443
           Y+ + +  S N+++ E +     Q+   +Q +HS GLA  DL     ++  E G +K+ D
Sbjct: 527 YDLFAIVMS-NKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVI-NEKGIVKLID 584

Query: 444 IGVYDTLNY 452
            G     +Y
Sbjct: 585 FGAAVVFSY 593

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 366 NDSSLCMVFDYYPQSQ--SLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALN 423
           N  +L +V +Y P     +L +  G       L  E++  +L ++ I ++++H+NG+  +
Sbjct: 852 NKDNLFLVMEYLPGGDLATLLKMMGC------LPDEWVKQYLSEIIIGVEDMHNNGIIHH 905

Query: 424 DLDWKKVIVTGEPGRIKVTDIGV 446
           DL  + +++    G +K+TD G+
Sbjct: 906 DLKPENLLIDVS-GHLKLTDFGL 927

>Kwal_33.14434
          Length = 759

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 64/153 (41%), Gaps = 16/153 (10%)

Query: 305 GHKNSLYKVFSNLDGKIYFMRRI-----HDVKITDSAQVSKPFQTWSHLRSANITVLKDS 359
           G   S+  V    D K++ ++       H+ K     +++  +   + LR  NI      
Sbjct: 413 GAGGSVRLVRRTQDNKLFAVKEFRTKFDHEAKRDYVKKITSEYCIGTTLRHPNII----E 468

Query: 360 FVTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNG 419
            V   ++++ +  V ++       Y+ + +  S N+++ E +     Q+   +Q +HS G
Sbjct: 469 TVEIVYDNNRILQVMEFCD-----YDLFAIVMS-NKMSYEEICCCFKQILTGVQYLHSMG 522

Query: 420 LALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNY 452
           LA  DL     ++    G +K+ D G     +Y
Sbjct: 523 LAHRDLKLDNCVINKH-GVVKLIDFGAAAVFSY 554

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 384 YETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTD 443
           Y+ + +  S N+++ E +     Q+   +Q +HS GLA  DL     ++  E G +K+ D
Sbjct: 522 YDLFAIVMS-NKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVIN-EKGIVKLID 579

Query: 444 IGVYDTLNY 452
            G     +Y
Sbjct: 580 FGAAVVFSY 588

>Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement
          Length = 809

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 401 LWAFLVQLTIALQEVHSNGLALN-DLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEG 456
           +W  +V+L++AL+ +H +   ++ DL    V++T E G +K+ D G+   L   +EG
Sbjct: 584 VWKIIVELSLALRFIHDSCRVVHLDLKPANVLITFE-GTLKLADFGMAAKLPISEEG 639

>Scas_649.21
          Length = 294

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 12  RPDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETE 48
           R ++F+   C N +  GYC + N  C F HG++K+ +
Sbjct: 216 RANNFRTKNCNNWLKLGYCPYGNRCC-FKHGDNKDIQ 251

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 16  FKGTQCRNIIIHGYCKFENEGCQFNHG 42
           +K   C    + GYCK+E++ CQF HG
Sbjct: 182 YKTELCETFTVKGYCKYESK-CQFAHG 207

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 403 AFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGV 446
           + + QL  AL+  H+ G+A  D   + ++VT   G+IK+TD G+
Sbjct: 130 SLMFQLCSALKYCHTLGIAHRDFKPENILVTNT-GKIKLTDFGL 172

>YDR151C (CTH1) [995] chr4 complement(764172..765149) Protein
           containing two CCCH-type zinc finger domains, which bind
           DNA or RNA, has a region of high similarity to a region
           of mouse Zfp36l2, which is an apoptosis activator that
           may destabilize transcripts containing an AU-rich
           elements [978 bp, 325 aa]
          Length = 325

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 16  FKGTQCRNIIIHGYCKFENEGCQFNHG 42
           +K   C +  I GYCK+ N+ CQF HG
Sbjct: 205 YKTELCESFTIKGYCKYGNK-CQFAHG 230

>Scas_502.2
          Length = 1116

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 366 NDSSLCMVFDYYPQSQ--SLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALN 423
           +++SL  + +Y P     SL + +G       LN+E    +  Q+  A++ +HS G+   
Sbjct: 244 DEASLYFLLEYAPNGDLLSLMKKFG------SLNEECCCYYGAQIIDAIKFMHSKGIIHR 297

Query: 424 DLDWKKVIVTGEPGRIKVTDIGVYDTLN 451
           D+  + +++  +  ++K+TD G    L+
Sbjct: 298 DIKPENILLDKD-MKVKITDFGTAKILD 324

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 369 SLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWK 428
           SL MV +Y P     Y+ + L  + N ++ + +  +  QL   +  +H+ G+A  DL   
Sbjct: 254 SLLMVMEYAP-----YDFFDLVMT-NTMSPDEISCYFKQLCHGVNYLHAMGIAHRDLKLD 307

Query: 429 KVIVTGEPGRIKVTDIGVYDTLNYHQEGRML 459
             +VT + G +K+ D G      Y  E  ++
Sbjct: 308 NCVVTND-GILKLIDFGSAVIFQYPYERNIV 337

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 366 NDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDL 425
           N  +L +V +Y P      +   L   +  L  ++   +L ++ + + ++H NG+  +DL
Sbjct: 864 NKDNLFLVMEYLPGG----DLATLIKMMGYLPDQWAKQYLTEIVVGVNDMHQNGIIHHDL 919

Query: 426 DWKKVIVTGEPGRIKVTDIGV 446
             + +++    G +K+TD G+
Sbjct: 920 KPENLLIDNA-GHVKLTDFGL 939

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 9/87 (10%)

Query: 366 NDSSLCMVFDYYPQSQ--SLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALN 423
           ++++L  + +Y P     SL + +G       LN+E    +  Q+  A+  +HS+G+   
Sbjct: 189 DEANLYFLLEYAPNGDFLSLIKKFGT------LNEECTIYYSAQIIDAIGSMHSHGIIHR 242

Query: 424 DLDWKKVIVTGEPGRIKVTDIGVYDTL 450
           D+  + +++ G   +IK+TD G    L
Sbjct: 243 DIKPENILLDGN-MKIKLTDFGTAKLL 268

>AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH]
           complement(1109175..1111499) [2325 bp, 774 aa]
          Length = 774

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 399 EYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGV 446
           E  W    Q+   ++++H+ G+A  D+  + V+ T + G +K+TD GV
Sbjct: 346 EEKWCCFKQIARGVRQMHNLGIAHRDIKLENVLAT-DYGALKLTDFGV 392

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/159 (18%), Positives = 64/159 (40%), Gaps = 27/159 (16%)

Query: 319 GKIYFMRRIHDVKITDSAQVSKPFQTWSH----------------LRSANITVLKDSFVT 362
           G +  M+RI D ++    +    F+  S                 LR  NI     S + 
Sbjct: 435 GSVRLMKRISDNQVFAVKEFRPKFEHESKRDYVKKITSEYCIGTTLRHPNII----STIE 490

Query: 363 SAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLAL 422
             + ++ +  V +Y       Y+ + +  S N+++ E +     Q+   ++ +HS GLA 
Sbjct: 491 IVYENNRIFQVMEYCD-----YDLFAIVMS-NKMSYEEICCCFKQILTGVEYLHSIGLAH 544

Query: 423 NDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHT 461
            D+     ++  + G +K+ D G  +  +Y     ++ +
Sbjct: 545 RDMKLDNCVINNQ-GIVKLIDFGAAEVFSYPHSKTLIES 582

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 68/161 (42%), Gaps = 18/161 (11%)

Query: 297 TSDKKRYNGHKNSLYKVFSNLD-GKIYFMRRIHD-----VKITDSAQVSKPFQTWSHLRS 350
           T  K +Y  H   + +       G+++ +R +H+     +K+    Q+ +  Q   H   
Sbjct: 51  TVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQI-EHTND 109

Query: 351 AN--ITVLKDSFVT---SAFNDS-SLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAF 404
               + +++  F+      F DS +L MV DY        E + L              +
Sbjct: 110 ERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGG----ELFSLLRKSQRFPNPVAKFY 165

Query: 405 LVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIG 445
             ++T+AL+ +HS+ +   DL  + +++    G IK+TD G
Sbjct: 166 AAEVTLALEYLHSHNIIYRDLKPENILLDRN-GHIKITDFG 205

>Kwal_33.13681
          Length = 715

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 401 LWAFLVQLTIALQEVH-SNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTL 450
           +W  +V+L++AL+ VH S  +A  DL    V++T E G +K+ D G+   L
Sbjct: 487 IWKIIVELSLALRFVHDSCQIAHLDLKPANVLITFE-GNLKLADFGMAAKL 536

>CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase,
           hypothetical start
          Length = 728

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 361 VTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGL 420
           V   + D+ +  V +Y       Y+ + +  S N+++ E +     Q+   +Q +HS GL
Sbjct: 440 VEIVYEDNRIFQVMEYCD-----YDLFAIVMS-NKMSYEEICCCFKQILCGVQYLHSIGL 493

Query: 421 ALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNY 452
           A  DL     ++  + G +K+ D G     +Y
Sbjct: 494 AHRDLKLDNCVINSK-GIVKLIDFGAAVVFSY 524

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 366 NDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDL 425
           +++SL  + +Y P    L     +      LN+E    +  Q+  A+  +H NG+   D+
Sbjct: 252 DEASLYFLLEYAPNGDFL----SVMKKFGSLNEECCRYYGAQMLDAIDFIHKNGVVHRDI 307

Query: 426 DWKKVIVTGEPGRIKVTDIGVYDTLNYHQE 455
             + +++  E  ++K+TD G    L+  ++
Sbjct: 308 KPENILL-DEHMKVKLTDFGTAKLLDRDEK 336

>YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine
           protein kinase required for high-affinity polyamine
           transport [2457 bp, 818 aa]
          Length = 818

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 402 WAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYD 448
           +    Q+   ++  H NG+A  DL  + V+++ E G  K+TD G+ D
Sbjct: 366 YCLFKQVAQGIKFCHDNGIAHRDLKPENVLISKE-GICKLTDFGISD 411

>Sklu_2092.2 YMR133W, Contig c2092 1528-2703 reverse complement
          Length = 391

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 96  QPGAPVNDQPMLADGPQISGTMSPSLMNSN 125
           +PG  +N+QP+L DGP I+    P + N N
Sbjct: 305 KPGKLLNEQPLLKDGPVITHQNDPVITNRN 334

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 372 MVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVI 431
           M+F+Y    Q L   Y + +    L + +   F+  +  ALQ +H N +   DL  + ++
Sbjct: 199 MLFEYVSGGQLL--DYIIQH--GSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIM 254

Query: 432 VTGEPGRIKVTDIGVYDTLNYHQEGRMLHT 461
           ++   G IK+ D G+    N +   + LHT
Sbjct: 255 ISTS-GEIKIIDFGLS---NLYDNKKQLHT 280

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 11/101 (10%)

Query: 349 RSANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQL 408
           R  NI  L D F      DS + M    Y     LYE    A++V +  +  +   + Q+
Sbjct: 143 RHQNIAALLDFF------DSYIIME---YCSGGDLYEAIK-ADAVPKKTKS-ITHIITQI 191

Query: 409 TIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDT 449
             A++ VH+ G+   D+  + ++++G    IK+TD G+  T
Sbjct: 192 MDAIEYVHNKGIYHRDIKPENILISGIDWTIKLTDWGLATT 232

>ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C
           (RNP1) - SH] (229767..230663) [897 bp, 298 aa]
          Length = 298

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 232 PDPPPHLKIPLKPNERTPETLFINN 256
           P PP   K+PL   ER+ +TL++NN
Sbjct: 134 PAPPQREKVPLDQLERSSDTLYVNN 158

>Sklu_2396.3 YLR136C, Contig c2396 8035-8892 reverse complement
          Length = 285

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 16  FKGTQCRNIIIHGYCKFENEGCQFNHG 42
           +K   C +    GYCK+ N+ CQF HG
Sbjct: 181 YKTELCESFTTKGYCKYGNK-CQFAHG 206

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 70/161 (43%), Gaps = 9/161 (5%)

Query: 305 GHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQ--VSKPFQTWSHLRSANITVLKDSFVT 362
           GH     KV  N+  ++      + VK+ ++A+  + K       L   NI  +  S V 
Sbjct: 151 GHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNIIRIHQSCVD 210

Query: 363 SAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLAL 422
           +  N      +F        L+      + +  +++      + Q+ +AL+ +HSNG+  
Sbjct: 211 ALGN----VYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSNGIVH 266

Query: 423 NDLDWKKVIV-TGEP-GRIKVTDIGVYDTLNYHQEGRMLHT 461
            DL    +++ T EP  ++ + D G+   L+ + + RM HT
Sbjct: 267 RDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERM-HT 306

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 380  SQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRI 439
            S  L++   L  ++ E   + L+    Q+   L+ +H NG+   D+  + VIV    GR+
Sbjct: 1092 SIDLFDLIELKTNMTEHEAKLLFK---QVASGLRHLHENGIVHRDIKDENVIVDNR-GRV 1147

Query: 440  KVTDIG 445
            K+ D G
Sbjct: 1148 KIIDFG 1153

>Sklu_2199.2 YGL025C, Contig c2199 1811-2935 reverse complement
          Length = 374

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 58/146 (39%), Gaps = 31/146 (21%)

Query: 6   SGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTPLN 65
           S  N N P +FK                N+       ++  T   TT+   T++   P  
Sbjct: 160 SAANTNSPSNFK---------------RNKSSAGTPNSNVNTPTATTNSNATKKPRKPRQ 204

Query: 66  VKFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGP-QISGTMSP-SLMN 123
            K N  TS + TP  +         S P   P APV+    +A  P QI   +SP ++M+
Sbjct: 205 TKKNTTTSVAATPMPT---------SKPQSTPAAPVS----VATNPSQILSNVSPMNMMS 251

Query: 124 SNATAFAPSFNPYASESFTPSVSAGG 149
           S     +P  N   ++ FT SV  GG
Sbjct: 252 SPMNVMSP-INSIGAQQFTGSVQGGG 276

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 372 MVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVI 431
           M+F+Y    Q L   Y + +    L + +   F   +  ALQ +H N +   DL  + ++
Sbjct: 157 MLFEYVSGGQLL--DYIIQH--GSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIM 212

Query: 432 VTGEPGRIKVTDIGVYDTLNYHQEGRMLHT 461
           ++   G I++ D G+    N +   + LHT
Sbjct: 213 ISSS-GEIRIIDFGLS---NMYDPKKQLHT 238

>Kwal_47.18650
          Length = 2159

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 45/115 (39%), Gaps = 11/115 (9%)

Query: 13  PDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTPLNVKFNAKT 72
           PD+      R+       +  + G Q    NS +T   TT E  T         + +A+ 
Sbjct: 646 PDTSSVNAGRSSTELSTSRSASSGVQITTENSAQTSSPTTIEGST---------RSDAQA 696

Query: 73  SSSFTPGK-SPAVRSPDFSSLPAFQPG-APVNDQPMLADGPQISGTMSPSLMNSN 125
             S TP    P  +SP  S  P+     A V D     DG   SG +SPS  +SN
Sbjct: 697 VESSTPSTLQPTTKSPTPSDTPSTTESLAQVTDSLSSNDGSVASGNLSPSATSSN 751

>Scas_634.5
          Length = 790

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 401 LWAFLVQLTIALQEVHSNGLALN-DLDWKKVIVTGEPGRIKVTDIGV 446
           +W  +V+L++AL+ +H     ++ DL    +++T E G +K+ D G+
Sbjct: 554 IWKIIVELSLALRFIHQTCHVVHLDLKPTNILITFE-GNLKLADFGM 599

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,157,256
Number of extensions: 1009243
Number of successful extensions: 3347
Number of sequences better than 10.0: 86
Number of HSP's gapped: 3314
Number of HSP's successfully gapped: 121
Length of query: 646
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 538
Effective length of database: 12,857,365
Effective search space: 6917262370
Effective search space used: 6917262370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)