Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08063g1861839541e-134
Sklu_2380.41601484468e-57
ACR171C2511444191e-51
Scas_685.82521443861e-46
YIR035C2541393852e-46
CAGL0F06919g2501443782e-45
Scas_628.62521423671e-43
CAGL0F06897g2581383592e-42
ABR247W2501453573e-42
ABR249W2501453452e-40
ABR248W2611353462e-40
ABR246W2501443234e-37
YIR036C2631513227e-37
KLLA0E09834g2681391463e-11
AFR561W2671501304e-09
Sklu_1578.32681501279e-09
Scas_594.122671491252e-08
Kwal_26.91602671491252e-08
YMR226C2671491234e-08
KLLA0B08371g2681501224e-08
Kwal_14.24442881411154e-07
AER373C3001551154e-07
KLLA0D15521g2561311111e-06
YLR426W3261211102e-06
Sklu_2348.52891711013e-05
CAGL0M11242g268149995e-05
YLR100W (ERG27)347187989e-05
KLLA0D02596g347147961e-04
KLLA0D06127g330173925e-04
Kwal_55.19569288146909e-04
Scas_566.11346190880.001
CAGL0H08063g290165860.002
YIL124W (AYR1)297170860.002
YNL202W (SPS19)295171860.002
KLLA0F04455g305169850.003
KLLA0E13860g889140850.004
Scas_662.4307176840.005
Scas_652.19d1344152840.005
KLLA0D18909g290103830.006
KLLA0E24046g280146820.009
Sklu_2420.5326171820.010
Kwal_14.151127794810.010
Kwal_47.17102285120810.010
Kwal_26.8282298109810.013
CAGL0J11264g40997810.014
YNL181W40799800.015
Kwal_26.8838323155800.016
Scas_652.19d341158800.018
CAGL0G08690g294170790.020
KLLA0F19756g346186790.024
Sklu_1570.1756142790.025
CAGL0L02167g901141780.033
Sklu_268.1244122750.054
Scas_613.18286170750.064
CAGL0J04774g338139730.13
Sklu_2244.235249730.13
YKR009C (FOX2)90080730.16
Scas_542.11*66364730.16
Scas_451.1105864730.17
Scas_523.1165864720.22
Scas_534.1131164720.23
Scas_462.181464720.23
Scas_535.1119764710.25
AGR068W348183710.25
Kwal_23.4572300103680.53
Kwal_33.14451406100680.56
Kwal_27.1215528092670.65
CAGL0M11506g348177670.67
Sklu_2219.3363138670.76
CAGL0H07513g35248660.87
YHR071W (PCL5)22983660.88
CAGL0K09152g327113661.0
Scas_693.23*370131661.1
ADL292C329137651.2
Sklu_2305.6541149651.6
Scas_683.2990755642.0
YML097C (VPS9)45128632.5
Scas_660.479161632.6
CAGL0J01353g82761632.8
CAGL0D02420g18544622.9
Scas_502.31032117623.8
AEL261C366107614.7
CAGL0K05269g76123615.5
ADR059C35147606.0
YKL055C (OAR1)27830606.0
CAGL0H05291g56848597.5
KLLA0C12694g259142597.5
CAGL0E05698g59943597.6
Kwal_14.259831149597.9
YMR089C (YTA12)82561598.2
KLLA0E09119g280135589.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08063g
         (183 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08063g complement(726232..726792) some similarities with s...   372   e-134
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          176   8e-57
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   166   1e-51
Scas_685.8                                                            153   1e-46
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   152   2e-46
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   150   2e-45
Scas_628.6                                                            145   1e-43
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   142   2e-42
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   142   3e-42
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   137   2e-40
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   137   2e-40
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   129   4e-37
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   128   7e-37
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    61   3e-11
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    55   4e-09
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            54   9e-09
Scas_594.12                                                            53   2e-08
Kwal_26.9160                                                           53   2e-08
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    52   4e-08
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    52   4e-08
Kwal_14.2444                                                           49   4e-07
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    49   4e-07
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    47   1e-06
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    47   2e-06
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       44   3e-05
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    43   5e-05
YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol redu...    42   9e-05
KLLA0D02596g join(complement(219682..219797),complement(218659.....    42   1e-04
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    40   5e-04
Kwal_55.19569                                                          39   9e-04
Scas_566.11                                                            39   0.001
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    38   0.002
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    38   0.002
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    38   0.002
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    37   0.003
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    37   0.004
Scas_662.4                                                             37   0.005
Scas_652.19d1                                                          37   0.005
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    37   0.006
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    36   0.009
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        36   0.010
Kwal_14.1511                                                           36   0.010
Kwal_47.17102                                                          36   0.010
Kwal_26.8282                                                           36   0.013
CAGL0J11264g complement(1094218..1095447) highly similar to sp|P...    36   0.014
YNL181W (YNL181W) [4419] chr14 (298335..299558) Protein of unkno...    35   0.015
Kwal_26.8838                                                           35   0.016
Scas_652.19d                                                           35   0.018
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    35   0.020
KLLA0F19756g 1830489..1831529 similar to sgd|S0004094 Saccharomy...    35   0.024
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             35   0.025
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    35   0.033
Sklu_268.1 , Contig c268 57-791 reverse complement                     33   0.054
Scas_613.18                                                            33   0.064
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    33   0.13 
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement         33   0.13 
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    33   0.16 
Scas_542.11*                                                           33   0.16 
Scas_451.1                                                             33   0.17 
Scas_523.1                                                             32   0.22 
Scas_534.1                                                             32   0.23 
Scas_462.1                                                             32   0.23 
Scas_535.1                                                             32   0.25 
AGR068W [4378] [Homologous to ScYLR100W (ERG27) - SH] complement...    32   0.25 
Kwal_23.4572                                                           31   0.53 
Kwal_33.14451                                                          31   0.56 
Kwal_27.12155                                                          30   0.65 
CAGL0M11506g 1134645..1135691 highly similar to sp|Q12452 Saccha...    30   0.67 
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         30   0.76 
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    30   0.87 
YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associat...    30   0.88 
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    30   1.0  
Scas_693.23*                                                           30   1.1  
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    30   1.2  
Sklu_2305.6 YGL077C, Contig c2305 10656-12281                          30   1.6  
Scas_683.29                                                            29   2.0  
YML097C (VPS9) [3874] chr13 complement(78335..79690) Protein inv...    29   2.5  
Scas_660.4                                                             29   2.6  
CAGL0J01353g 124994..127477 similar to sp|P40341 Saccharomyces c...    29   2.8  
CAGL0D02420g 247761..248318 weakly similar to sp|Q99176 Saccharo...    28   2.9  
Scas_502.3                                                             28   3.8  
AEL261C [2245] [Homologous to ScYPR169W - SH] (149024..150124) [...    28   4.7  
CAGL0K05269g 512844..515129 similar to tr|Q12311 Saccharomyces c...    28   5.5  
ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998) [...    28   6.0  
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    28   6.0  
CAGL0H05291g complement(509813..511519) similar to tr|Q02866 Sac...    27   7.5  
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    27   7.5  
CAGL0E05698g complement(566932..568731) similar to tr|Q08961 Sac...    27   7.6  
Kwal_14.2598                                                           27   7.9  
YMR089C (YTA12) [4047] chr13 complement(445608..448085) Mitochon...    27   8.2  
KLLA0E09119g 816861..817703 some similarities with ca|CA4969|IPF...    27   9.5  

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  372 bits (954), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 183/183 (100%), Positives = 183/183 (100%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60
           MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60

Query: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
           DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH
Sbjct: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120

Query: 121 ALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGLAYGRTRFTNQNSSQNSTCFQ 180
           ALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGLAYGRTRFTNQNSSQNSTCFQ
Sbjct: 121 ALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGLAYGRTRFTNQNSSQNSTCFQ 180

Query: 181 GNV 183
           GNV
Sbjct: 181 GNV 183

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  176 bits (446), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 1/148 (0%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVI-GIARSKDKLEELKTQYSGKFDYICGDV 59
           M+KV LVTG SRGIG +IV  LC+   +++V+ GIARS+  L  +K  +  KF+YI GD+
Sbjct: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60

Query: 60  SDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVG 119
           SDEE + + V +   K+ R+D +VANAGVL+PV+DVNNI +++WK+LFD+NFFS+VSLV 
Sbjct: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVS 120

Query: 120 HALPLLKQSNGNIVLVSSGASTKSYVCI 147
            +LP LK+ NGNIV VSSGASTK YVCI
Sbjct: 121 LSLPHLKKFNGNIVFVSSGASTKPYVCI 148

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  166 bits (419), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 76/144 (52%), Positives = 112/144 (77%), Gaps = 2/144 (1%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60
           M ++ +VTGVSRGIG S+VEK+C    T +V+G+ARS+  L+EL+  Y  +F+Y+ GDV+
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKVCRQPDT-VVLGVARSEAALQELRATYGEQFEYVVGDVA 59

Query: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
            E+   +A+    + Y R+D +VANAGVL+PV+DVN+I ++ W++L+++NFFSVV LVG 
Sbjct: 60  SEDA-QDALVARATAYGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVGR 118

Query: 121 ALPLLKQSNGNIVLVSSGASTKSY 144
           ALPLLK++ G++V VSSGASTK+Y
Sbjct: 119 ALPLLKKAGGSVVFVSSGASTKAY 142

>Scas_685.8
          Length = 252

 Score =  153 bits (386), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 76/144 (52%), Positives = 102/144 (70%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60
           M KV +VTGVSRGIG SIVE++  + +  IV GIARS+  L+ LK  Y  +F Y+ GD++
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFKLSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDIT 60

Query: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
           D+  + + V+    +  ++D +VANAGVL+PV+DVN+I I  WK+LFDINFFSVVSL   
Sbjct: 61  DQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTSI 120

Query: 121 ALPLLKQSNGNIVLVSSGASTKSY 144
            LP LK++NGNIV VSS AS   +
Sbjct: 121 TLPYLKKTNGNIVFVSSDASDMHF 144

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  152 bits (385), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 105/139 (75%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60
           M KV LVTGVSRGIG SIV+ L S++   +V G+ARS+  L++LK +Y  +F Y+ GD++
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDIT 60

Query: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
           ++  + + VN     + ++D +VANAGVL+PV++VN I ++ WK+L+DINFFS+VSLVG 
Sbjct: 61  EDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGI 120

Query: 121 ALPLLKQSNGNIVLVSSGA 139
           ALP LK++NGN+V VSS A
Sbjct: 121 ALPELKKTNGNVVFVSSDA 139

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  150 bits (378), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 102/144 (70%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60
           M KV LVTG SRGIG +IV+ + ++++  +V GIAR++D L+ LK     +F Y+ GD++
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSLKDTVGARFQYLAGDIT 60

Query: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
           DE+ I E V  +  +  R+D IVANAGVL+PV  V +  +++WK+L+DINFFS++ L+  
Sbjct: 61  DEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLINK 120

Query: 121 ALPLLKQSNGNIVLVSSGASTKSY 144
            LP L++S GN + VSSGASTK Y
Sbjct: 121 TLPHLEKSEGNAIFVSSGASTKPY 144

>Scas_628.6
          Length = 252

 Score =  145 bits (367), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 99/142 (69%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV +VTGVSRGIG +IV K+  + +  +V GIAR+   L+ELK+++  KF YI GDV+++
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIGLNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTNK 63

Query: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122
             + + +     K+ RLD +VANAGVL+PV +V  +    WK+LFDINFFS+VSLV   L
Sbjct: 64  SDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQSTL 123

Query: 123 PLLKQSNGNIVLVSSGASTKSY 144
           P ++ +N N V VSSGAS K+Y
Sbjct: 124 PFMENTNRNYVFVSSGASVKAY 145

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  142 bits (359), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 103/138 (74%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV LVTGVSRGIG SIV+ L S++   IV GIARS+  L+ LK  Y  +F Y  GD++++
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAPLKALKDTYGDRFFYTVGDITND 66

Query: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122
           +T+ + VN     + +++ ++ANAGVL+PV+++NNI ++ WKQL++INFFS+VSLV  AL
Sbjct: 67  DTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDIAL 126

Query: 123 PLLKQSNGNIVLVSSGAS 140
           P LK+++G+ + VSS AS
Sbjct: 127 PHLKKTHGSALFVSSDAS 144

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  142 bits (357), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 100/145 (68%), Gaps = 2/145 (1%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           +V +VTG SRGIG + VEKLC      +V+G+AR++ KL++LK ++  KFDY+ GDV+DE
Sbjct: 2   RVVIVTGASRGIGEATVEKLCPTADV-VVVGVARAETKLQKLKARHGKKFDYVVGDVTDE 60

Query: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122
             +   ++ + S+Y RLD +VANAGV    E +    I +W++LF+IN FSVV+LV  AL
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SRHERIATADIKEWRRLFEINLFSVVNLVSKAL 119

Query: 123 PLLKQSNGNIVLVSSGASTKSYVCI 147
           PLL++S G +++VSSG S   +  +
Sbjct: 120 PLLRESQGTVIVVSSGLSQMGHPAL 144

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  137 bits (345), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 99/145 (68%), Gaps = 2/145 (1%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV +VTG SRGIG++ V++LCS     +V+G+AR++ KL+ELK ++  KFDY+ GDV+DE
Sbjct: 2   KVIIVTGASRGIGAATVDRLCSTPDV-VVVGVARAETKLQELKARHGKKFDYVVGDVTDE 60

Query: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122
             +   ++ + S+Y RLD +VANAGV    + +    I +W++LF+IN FSVV+L   AL
Sbjct: 61  RVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKAL 119

Query: 123 PLLKQSNGNIVLVSSGASTKSYVCI 147
           PLL++S G  + V+SG S   +  +
Sbjct: 120 PLLRKSQGAFIAVTSGLSQMGHPAL 144

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  137 bits (346), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 96/135 (71%), Gaps = 2/135 (1%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV +VTG SRGIG++ V++LCS     +V+G+AR++ KL+ELK ++  KFDY+ GDV+DE
Sbjct: 13  KVIIVTGASRGIGAATVDRLCSTPEV-VVVGVARAETKLQELKARHGKKFDYVVGDVTDE 71

Query: 63  ETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122
             +   ++ + S Y RLD +VANAGV    E + +  I +W++LF+IN FSVV+L   AL
Sbjct: 72  RVVQAVIDKVSSGYGRLDAVVANAGVAGH-ERIEDADIKEWRRLFEINLFSVVNLASKAL 130

Query: 123 PLLKQSNGNIVLVSS 137
           PLL++S G  ++VSS
Sbjct: 131 PLLRKSQGAFLVVSS 145

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  129 bits (323), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 3/144 (2%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS 60
           M +V +VTG SRGIG + VEKLC+     +V+G+AR++  L+ LK +Y  KFDY+ GDV+
Sbjct: 1   MVRVIIVTGASRGIGEATVEKLCTAPDV-VVVGVARAEKTLKVLKERYGSKFDYVAGDVT 59

Query: 61  DEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
           DE  +   ++ + S Y RLD I+ANAGV    E +    I +WK+ F+I   S VSLV  
Sbjct: 60  DESVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVSK 117

Query: 121 ALPLLKQSNGNIVLVSSGASTKSY 144
           ALP+L++S G +++V+SG S   Y
Sbjct: 118 ALPMLRKSQGTVIVVTSGLSKVGY 141

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  128 bits (322), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 7/151 (4%)

Query: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQY-SGKFDYICGDV 59
           M KV L+TG SRGIG  +V+ +   +   IV G+AR++  L+ L+ +Y + KF Y   D+
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDI 60

Query: 60  SDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDV---NNIH-ISKWKQLFDINFFSVV 115
           +D   +   V  I  K+ +LDGIVANAG+L+PV+ +   N+ H I +W++LFD+NFFS+V
Sbjct: 61  TDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIV 120

Query: 116 SLVGHALPLLKQSN--GNIVLVSSGASTKSY 144
           SLV   LPLLK S   GNIV VSSGAS K Y
Sbjct: 121 SLVALCLPLLKSSPFVGNIVFVSSGASVKPY 151

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 60.8 bits (146), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 68/139 (48%), Gaps = 14/139 (10%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGK---FDYICGDV 59
           +V L+TG S GIG SI E L S      V G +R        K    GK   F  I  D+
Sbjct: 4   QVILITGASTGIGLSIAETLRSAGYE--VFGTSR--------KGSIPGKEYSFKMIKLDI 53

Query: 60  SDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVG 119
           +DEE++  AVN +  K  R+D +V NAG+      V        K +F+ NFF V  +  
Sbjct: 54  TDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTR 113

Query: 120 HALPLLK-QSNGNIVLVSS 137
             LP ++ Q +G I+ +SS
Sbjct: 114 AVLPHMREQRHGKIINISS 132

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (48%), Gaps = 7/150 (4%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKI-VIGIARSKDKLEELKTQYSGKFDYI---CG 57
           +K+ LVTG S GIG +            I +I +AR  +KL  LK +   K+       G
Sbjct: 13  NKIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVG 72

Query: 58  --DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVV 115
             DV+  + I   +  +  +++ +D ++ NAG     E V  I +   +++F+ N   +V
Sbjct: 73  QLDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLV 132

Query: 116 SLVGHALPLLKQSN-GNIVLVSSGASTKSY 144
            L    LP++K  N G+IV V S A  ++Y
Sbjct: 133 HLTQEVLPIMKAKNSGDIVNVGSIAGREAY 162

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 53.5 bits (127), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKI-VIGIARSKDKLEELKTQYSGKFD----YI- 55
           +K   +TG S GIG +   + C     KI ++  AR  +KL+ELK + + ++     YI 
Sbjct: 13  NKTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVYIG 72

Query: 56  CGDVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVV 115
             DV++ E I   ++ +  ++K +D ++ NAG     + V  I     + + + N  +++
Sbjct: 73  VLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLALI 132

Query: 116 SLVGHALPLLKQSN-GNIVLVSSGASTKSY 144
           ++    LP+ K  N G+IV + S A   +Y
Sbjct: 133 NITQAVLPIFKAKNFGDIVNLGSVAGRDAY 162

>Scas_594.12
          Length = 267

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 79/149 (53%), Gaps = 7/149 (4%)

Query: 3   KVFLVTGVSRGIG-SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD----YICG 57
           K+  +TG S GIG ++ +E + +   T  ++ +AR  +KL++LK     K+     YI  
Sbjct: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73

Query: 58  -DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVS 116
            DV++ ETI   ++ +  ++K +D ++ NAG     + V +I I   K + D N   +++
Sbjct: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133

Query: 117 LVGHALPLLKQSN-GNIVLVSSGASTKSY 144
           +    L + ++ N G+IV + S A   +Y
Sbjct: 134 VTQAVLHIFQKKNSGDIVNLGSVAGRDAY 162

>Kwal_26.9160
          Length = 267

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 77/149 (51%), Gaps = 7/149 (4%)

Query: 3   KVFLVTGVSRGIG-SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD----YICG 57
           K  L+TG S GIG ++ +E L +      +I  AR  +KL+E+K+Q+   F     YI  
Sbjct: 14  KTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIGQ 73

Query: 58  -DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVS 116
            DV+  + I   ++ +  ++K +D ++ NAG     + V  I  S  + +   N  ++++
Sbjct: 74  LDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALIN 133

Query: 117 LVGHALPLLKQSN-GNIVLVSSGASTKSY 144
           +    LP+ K  N G+IV + S A  ++Y
Sbjct: 134 MTQAVLPIFKAKNAGDIVNLGSVAGREAY 162

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 74/149 (49%), Gaps = 7/149 (4%)

Query: 3   KVFLVTGVSRGIG-SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD----YICG 57
           K  L+TG S GIG ++ +E L +      +I  AR  +KLEELK     +F     ++  
Sbjct: 14  KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQ 73

Query: 58  -DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVS 116
            D++  E I   +  +  ++K +D +V NAG     + V  I     + +FD N  ++++
Sbjct: 74  LDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN 133

Query: 117 LVGHALPLLKQSN-GNIVLVSSGASTKSY 144
           +    LP+ +  N G+IV + S A   +Y
Sbjct: 134 ITQAVLPIFQAKNSGDIVNLGSIAGRDAY 162

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 2   SKVFLVTGVSRGIG-SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD----YIC 56
           +K   +TG S GIG ++ +E L +      +I  AR   KLEELK + + ++     YI 
Sbjct: 13  NKTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYIG 72

Query: 57  G-DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVV 115
             DV++ E I   ++ +  ++K +D ++ NAG     + V  I     K + D N  +++
Sbjct: 73  QLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALI 132

Query: 116 SLVGHALPLLKQSN-GNIVLVSSGASTKSY 144
           ++    LP+ K  N G+IV + S A   +Y
Sbjct: 133 NVTQAVLPIFKAKNSGDIVNLGSVAGRDAY 162

>Kwal_14.2444
          Length = 288

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV +VTG S GIG  +  +L S      V   AR + +LE L  ++      +  DVS+ 
Sbjct: 5   KVAVVTGASSGIGYELTRQLAS--KGYKVYAAARREQRLETLAKEFPELVVPVKLDVSEP 62

Query: 63  ETITEAVNFI--ESKYKRLDGIVANAG--VLDPVEDVNNIHISKWKQLFDINFFSVVSLV 118
           E I      +  E   ++LD +  NAG     P  DV N  +   +Q F +N F  V+L 
Sbjct: 63  EQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTNDVL---EQAFKVNVFGPVNLC 119

Query: 119 GHALPLLKQSNGNIVLVSSGA 139
              LP + ++ G ++   S A
Sbjct: 120 KELLPFVIKAKGTVLFTGSVA 140

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 15/155 (9%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSG-KFDYICGDVS 60
           +KV LVTG S GIG  + ++L +     +V   ARS + +E L+ +    K   +  DV+
Sbjct: 14  AKVVLVTGASSGIGYELTKELAN--RGYVVYAAARSIEPIEALRDKCGPEKVIPVQLDVT 71

Query: 61  DEETITEAVNFIESKYK--RLDGIVANAG--VLDPVEDVNNIHISKWKQLFDINFFSVVS 116
           DEE +T+    +  +    +L  +  NAG     P  DV    I K    F +N F+ ++
Sbjct: 72  DEEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAVDVTPEMIEK---CFRVNVFAPMN 128

Query: 117 LVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNF 151
           +     PLL +++G IV   S A       IP  F
Sbjct: 129 ITREFAPLLIRAHGTIVFTGSLAG-----IIPFPF 158

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 62/131 (47%), Gaps = 6/131 (4%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICG---DV 59
           K+ LVTG S G+G  I   L  +    +VI  +R   +++E           + G   DV
Sbjct: 9   KIALVTGASTGVGEGIARALF-VRGATVVI-TSRHLSEVQETAGNIDPSGSRVIGKEVDV 66

Query: 60  SDEETITEAVNFIESKYKRLDGIVANAGVLDPVED-VNNIHISKWKQLFDINFFSVVSLV 118
           +  + + + +  I  ++  L  +V NAG+  P +  + +  I  W+Q+ D N       +
Sbjct: 67  TVAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTNINGTFYTL 126

Query: 119 GHALPLLKQSN 129
            +ALPL++ S+
Sbjct: 127 KYALPLMESSS 137

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 7/121 (5%)

Query: 4   VFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEE 63
           + L+TG S+G+G +IV +L    +   ++ +      +   + +     D IC D+SD+E
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVK-----DLIC-DLSDDE 125

Query: 64  TITEAVNFIESKYK-RLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHAL 122
            +   +N ++ KYK  +  IV NAGV       N +      ++F IN F+ +  +    
Sbjct: 126 EVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQFIQELA 185

Query: 123 P 123
           P
Sbjct: 186 P 186

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 73/171 (42%), Gaps = 21/171 (12%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV LVTG S GIG  I + L S   T  V   AR    ++ L+ ++  K   +  DVSD 
Sbjct: 5   KVALVTGASSGIGYEITKLLASKGYT--VYAAARRTTPIKPLEEEFPEKVIAVSLDVSDL 62

Query: 63  ETITEAVNFIESKYKR------LDGIVANAG--VLDPVEDVNNIHISKWKQLFDINFFSV 114
           + I +    +++++ R      L  +  NAG     P  DV N    K +Q F +N F  
Sbjct: 63  QQIQD----LKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGN---DKIEQCFKVNVFGP 115

Query: 115 VSLVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL-AYGR 164
           ++L       +  + G IV   S A     V  P   I    KA +  Y R
Sbjct: 116 MNLCREMSDFVINARGTIVFTGSLAGI---VPFPFGSIYSSTKAAIHQYAR 163

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 77/149 (51%), Gaps = 7/149 (4%)

Query: 3   KVFLVTGVSRGIG-SSIVEKL-CSIETTKIVIGIAR---SKDKLEELKTQYSGKFDYICG 57
           K+  +TG S GIG ++ +E L  S  + K+V+G  R    ++  +EL  QY     +I  
Sbjct: 14  KIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKIHIGK 73

Query: 58  -DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVS 116
            DV+D E + + +  +  ++K +D ++ NAG     + V +I       + + N  ++++
Sbjct: 74  LDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLALIN 133

Query: 117 LVGHALPLLKQSN-GNIVLVSSGASTKSY 144
           L    LPL K+ N G+IV + S A   +Y
Sbjct: 134 LTQLLLPLFKKKNSGDIVNLGSIAGRDAY 162

>YLR100W (ERG27) [3516] chr12 (341811..342854) 3-Keto sterol
           reductase, required for ergosterol biosynthesis [1044
           bp, 347 aa]
          Length = 347

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 42/187 (22%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGI-------ARSKDKLEELKTQY--SGK-- 51
           KV +VTG +  +G +IV +L   E T + + I        R ++ + ++K  Y  SG+  
Sbjct: 4   KVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVINQIKDFYNKSGRVE 63

Query: 52  -----FDYICGDVSDEETITEAVNFIESKYKRLDGIVANA--GVLD-------------- 90
                FDY+  D ++  ++  A   I  KY+ ++ +  NA  G+ D              
Sbjct: 64  DLEIDFDYLLVDFTNMVSVLNAYYDINKKYRAINYLFVNAAQGIFDGIDWIGAVKEVFTN 123

Query: 91  PVEDVNN----IHISKWKQ------LFDINFFSVVSLVGHALPLLKQSNGNIVLVSSGAS 140
           P+E V N    I +   K       +F  N F     +   LP L +    IV +SS  S
Sbjct: 124 PLEAVTNPTYKIQLVGVKSKDDMGLIFQANVFGPYYFISKILPQLTRGKAYIVWISSIMS 183

Query: 141 TKSYVCI 147
              Y+ +
Sbjct: 184 DPKYLSL 190

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 72/147 (48%), Gaps = 21/147 (14%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCS-IETTKIVI--------GIARSKDKLEELKTQYSGKFD 53
            V ++TG S G+G+ +V+ L S I   KIVI         ++ +KD++E L+        
Sbjct: 84  PVCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITKDRIEFLRC------- 136

Query: 54  YICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFS 113
               D+S +E +  A+  I++K+ ++D ++ NA +      + ++   +  ++F  N  S
Sbjct: 137 ----DLSSDEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLS 192

Query: 114 VVSLVGHALPLLKQSNGNIVLVSSGAS 140
            + L+    P  K +N +   V + AS
Sbjct: 193 TIRLIQAFHP-KKSANNDFYYVVNIAS 218

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 32/173 (18%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKIVIG---IARSKDKLEELKTQY---------- 48
           +KV LVTG + GIG   V  L  +   K+ +G    +R    ++E+K +           
Sbjct: 19  NKVALVTGGNSGIGYYTVLHL-YLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDE 77

Query: 49  ----------SGKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLD-PVEDV-N 96
                     +GK +Y+  D++D  ++ +A      +   LD ++ NAGV+  P E   +
Sbjct: 78  KPHDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELTKD 137

Query: 97  NIHISKWKQLFDINFFSVVSLVGHALPLLKQSNGNIVLVSS-GASTKSYVCIP 148
           N  I         N+ S   L    LPL+K   G ++ VSS G +   + C P
Sbjct: 138 NFEIQ-----MQTNYVSHFLLTMRLLPLIKARKGRVITVSSLGHNLIFFNCNP 185

>Kwal_55.19569
          Length = 288

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 14/146 (9%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKL----EELKTQYSGKFDYICGD 58
           KV  ++G S GIG ++            V     S DKL    +EL   Y  +       
Sbjct: 39  KVACISGASSGIGGAVAVAFAQAGADIAVW--YNSNDKLIQTAKELSETYGVRAKAYKCP 96

Query: 59  VSDEETITEAVNFIESKYKRLDGIVANAGVL---DPV--EDVNNIHISKWKQLFDINFFS 113
           V+DE  + E +  +E  + ++D  VANAGV     P+   +   +   +W+++F+ +F  
Sbjct: 97  VTDEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFNTDFQG 156

Query: 114 V--VSLVGHALPLLKQSNGNIVLVSS 137
           V   S V  A+   KQ  G++V+ +S
Sbjct: 157 VYYCSKVIGAI-FKKQGRGSLVITAS 181

>Scas_566.11
          Length = 346

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 76/190 (40%), Gaps = 46/190 (24%)

Query: 1   MSKVFLVTGVSRGIGSSIV----------EKLCSIETTKIVIGIARSKDKLEELKTQ--- 47
           +SKV ++TG +  +G +I            +L  I T++ ++   R K+ +E +K     
Sbjct: 3   ISKVIVITGTNSNLGLNIAYRFIDNTPKDARLTFIVTSRTLL---RVKEVVELIKRHVVE 59

Query: 48  --YSG--KFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAG---------------- 87
             + G   +DYI  D ++  ++  A   +   YK +     NA                 
Sbjct: 60  VGHIGVVDYDYILVDFTNMVSVLNAYYELNKTYKEIHYFFVNAAQRVYDGIDWIGAVKEV 119

Query: 88  VLDPVEDVNNIHISKWK----------QLFDINFFSVVSLVGHALPLLKQSNGNIVLVSS 137
           + +P+E V N      +           +F  N F    L+   LPLLK  NG IV +SS
Sbjct: 120 ISNPLEAVTNPTYKIQRIGVKSKDGMGLVFQANVFGPYYLIQKLLPLLKAGNGTIVWISS 179

Query: 138 GASTKSYVCI 147
             S   Y+ +
Sbjct: 180 VMSAPKYLSL 189

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 13/165 (7%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICG----- 57
           KV  VTG +  I    VE L  +     +IG  R  +K E +  + S   D         
Sbjct: 23  KVGFVTGGAGTICRVQVEALVLLGCKVAIIG--RDHEKTERVAKEISSLVDNPDAVLPIS 80

Query: 58  --DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVV 115
             DV + + +  AV     +Y R+D ++A A   + + D N++  + +K +  I+     
Sbjct: 81  KVDVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSF 139

Query: 116 SLVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL 160
           +     +P L +S G+I+ VS   +T  Y  +P    +   KAG+
Sbjct: 140 NTAKATMPELIKSRGSILFVS---ATFHYYGVPFQSHVGAAKAGI 181

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 71/170 (41%), Gaps = 18/170 (10%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICG---DV 59
           K+ +VTG S GIG  + ++L       +V   AR  + + +L  Q+    D I     D+
Sbjct: 10  KIAVVTGASGGIGYEVTKELA--RNGYLVYACARRLEPMAQLAIQFGN--DSIKPYKLDI 65

Query: 60  SDEETITEAVNFIESKYK--RLDGIVANAG--VLDPVEDVNNIHISKWKQLFDINFFSVV 115
           S  E I     F+ +     +LD +  NAG     P  D  +  +   +Q F +N F  +
Sbjct: 66  SKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAV---EQCFKVNVFGHI 122

Query: 116 SLVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL-AYGR 164
           ++       L ++ G IV   S A   S+   P   I    KA +  Y R
Sbjct: 123 NMCRELSEFLIKAKGTIVFTGSLAGVVSF---PFGSIYSASKAAIHQYAR 169

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 78/171 (45%), Gaps = 25/171 (14%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIG------IARSKDKLEELK---TQYSGKFD 53
           KV  VTG   G G+     +C ++T  +V+       + R +++ E+     +Q +   D
Sbjct: 28  KVAFVTG---GAGT-----ICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKD 79

Query: 54  YICG----DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDI 109
            +      DV + E +  AV     K+ ++D ++A A   + V D  N+  + +K + DI
Sbjct: 80  AVLAIANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDI 138

Query: 110 NFFSVVSLVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL 160
           +     +     L  LK+S G+I+ VS   +T  Y  +P    +   KAG+
Sbjct: 139 DLLGSFNTAKACLKELKKSKGSILFVS---ATFHYYGVPFQGHVGAAKAGI 186

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 73/169 (43%), Gaps = 15/169 (8%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSD 61
           +K  LVTG S GIG  + ++L  +     V   AR    +EEL+ ++  +      DVS+
Sbjct: 4   TKYALVTGASSGIGYEVTKEL--LRRGWYVYACARRTHPMEELRAEFGDRCIPRKLDVSN 61

Query: 62  EETITEAVNFIESKY--KRLDGIVANAG--VLDPVEDVNNIHISKWKQLFDINFFSVVSL 117
           +  IT+    +E +   ++L  +  NAG     P  DV+   I      F +N +  ++ 
Sbjct: 62  QNDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEIID---NTFRVNVYGPINS 118

Query: 118 VGHALPLLKQSNGNIVLVSSGASTKSYVC-IPLNFILKRRKAGL-AYGR 164
                PL+  + G IV   S A     +C  P   +    KA +  Y R
Sbjct: 119 CREFAPLIINAKGTIVFTGSLAG----ICPFPFGAVYSASKAAIHQYAR 163

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 11/140 (7%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQY-SGKFDYICGDVSD 61
           KV ++TG   G+G S  +         ++  I      ++E+  +Y SG       D  D
Sbjct: 314 KVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSGS---AVADTHD 370

Query: 62  EETITEAVNFIES---KYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLV 118
              + EA   +++   K+ R+D +V NAG+L        +   +W  + +++ FS  +L 
Sbjct: 371 --IVKEAQQVVQTAVDKFGRVDILVNNAGILRD-RSFAKMTEDEWNAVINVHLFSTFALS 427

Query: 119 GHALPL-LKQSNGNIVLVSS 137
               P+ LKQ +G I+  +S
Sbjct: 428 KAVWPIFLKQKSGYIINTTS 447

>Scas_662.4
          Length = 307

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 70/176 (39%), Gaps = 22/176 (12%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICG----- 57
           K  +VTG S GIG  I ++L       IV   AR    +++L    + +           
Sbjct: 10  KTAIVTGASSGIGYEITKELA--RNGFIVYACARRLGPIDDLINDLAPELTTELAKAVIK 67

Query: 58  ----DVSDEETITEAVNFIESKYK--RLDGIVANAG--VLDPVEDVNNIHISKWKQLFDI 109
               D+S E+ + +   F+E +    +LD +  NAG     P  DV N      +Q F +
Sbjct: 68  PYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN---DVMEQCFKV 124

Query: 110 NFFSVVSLVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL-AYGR 164
           N F  V++       L Q+ G IV   S A    +   P   I    KA +  Y R
Sbjct: 125 NVFGHVNMCRELASYLIQARGTIVFTGSLAGITPF---PFGSIYSATKAAIHEYAR 177

>Scas_652.19d1
          Length = 344

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 68/152 (44%), Gaps = 20/152 (13%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQY-------SGKFDYI 55
           K  +VTG + GIG  +VE L        VIG+ R+  K EE K +         G    I
Sbjct: 42  KTAVVTGCNTGIGKHVVELLYQKNCN--VIGVVRTDAKGEEAKKEIIANNPKSKGNITII 99

Query: 56  CG-DVSDEETITEAVNFIESKY--KRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFF 112
            G D  D E +      I+     K L+ I+ NAG++ P  D     +  ++ +F  N  
Sbjct: 100 GGCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAGLMAP--DNKGTSVQGYEAMFQTNVL 157

Query: 113 SVVSLVGHAL-PL-LKQSN---GNIVLVSSGA 139
               L+ H L PL LK+ +     IV VSSGA
Sbjct: 158 G-SQLLQHFLDPLFLKEDDISLKRIVWVSSGA 188

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 4/103 (3%)

Query: 58  DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSL 117
           DV + + + EAV     K+ RLD ++A A   + + D  ++  + +K +  I+     + 
Sbjct: 83  DVRNVDQLHEAVKVAIQKFGRLDYVIAGAAG-NFLADFTHLSSNAFKSVVSIDLLGSFNT 141

Query: 118 VGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL 160
           V    P L ++ G+++ VS   ST  Y  +P    +   KAG+
Sbjct: 142 VKACFPELVKTKGSVLFVS---STLHYYGVPFQSHVGAAKAGI 181

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 14/146 (9%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD-----YICG 57
           KV +VTG S GIG ++ E L     +  V     S   L E   + S K++     Y C 
Sbjct: 31  KVAVVTGASSGIGYAVAEGLAQAGASLAVW--YNSNAALVERAVELSAKYNVKVVAYQC- 87

Query: 58  DVSDEETITEAVNFIESKYKRLDGIVANAGVL---DPVEDV--NNIHISKWKQLFDINFF 112
            V++E  + + +  +  ++ ++D  +ANAGV     P+ +   +     +W ++   +F 
Sbjct: 88  PVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDEWNKVIHTDFN 147

Query: 113 SVVSLVGHALPLLK-QSNGNIVLVSS 137
            V     +     K Q +G++V+ +S
Sbjct: 148 GVYYCAKYVGAQFKRQGSGSMVITAS 173

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 72/171 (42%), Gaps = 30/171 (17%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSI---------------ETTKIVIGIARSKDK---LEEL 44
           KV LVTG + GIG   V  L                  +  K +   A+S+ +    + L
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVNQAIKAIQNEAKSRQRKSTFKGL 78

Query: 45  KTQYS-GKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKW 103
           K + + GK  ++  D+SD  ++ +A    +     LD ++ NAGV+    ++        
Sbjct: 79  KLERNFGKLHFLSLDLSDLRSVDKAAAKFKGLELSLDVLINNAGVMALPYEIT------- 131

Query: 104 KQLFDI----NFFSVVSLVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLN 150
           K  F+I    N+ S   L    LP +K+ NG ++ VSS      +    LN
Sbjct: 132 KDGFEIQLQTNYISHFLLTMRLLPRIKRCNGRVITVSSIGHNLEFTYFNLN 182

>Kwal_14.1511
          Length = 277

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 1  MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDK----LEELKTQYSG--KFDY 54
          M K  L+TG ++GIG +I   L        +  + +  +K    L+E+K   SG     +
Sbjct: 1  MPKTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 55 ICGDVSDEETITEAVNFIESKYKRLDGIVANAGV 88
          +  DVS++E++   V+ + S +   D ++ NAG+
Sbjct: 61 LPIDVSNKESVFGVVDKVASHFGAFDVMINNAGI 94

>Kwal_47.17102
          Length = 285

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 55/120 (45%), Gaps = 6/120 (5%)

Query: 4   VFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEE 63
           V +VTG S G+G +IV++         +I +      +E  K  +   + Y C D+S+  
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLISL-----DIEPPKKSFPNVYHYTC-DLSNSS 87

Query: 64  TITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHALP 123
            + + +  ++  +  +  ++ NAG+    ++   +      ++F +N F+ + LV    P
Sbjct: 88  DVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFTPMRLVQELSP 147

>Kwal_26.8282
          Length = 298

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 11/109 (10%)

Query: 1   MSK--VFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSK-DKLEELKTQYSGKFDYICG 57
           MSK  V LVTG +RGIG +IV+KL     + ++IG   +  D++ +   +   K  +   
Sbjct: 32  MSKLPVALVTGATRGIGRAIVDKLADKGVSCLMIGSQMTSFDRMRKRPPKIRNKHQWHRA 91

Query: 58  DVSD--------EETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNI 98
              D        E+ +   V+F  S +++L    AN   L  + D ++I
Sbjct: 92  LAIDLGKWPQWTEQDVYTGVHFNGSMHEQLYAQEANQWSLFDIPDTHDI 140

>CAGL0J11264g complement(1094218..1095447) highly similar to
           sp|P53878 Saccharomyces cerevisiae YNL181w, start by
           similarity
          Length = 409

 Score = 35.8 bits (81), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 57/97 (58%), Gaps = 9/97 (9%)

Query: 3   KVFLVTGV-SRGIGSSIVEKLCSIETTKIVIGI---ARSKDKLEELKTQYSGKFDYI--C 56
           KV++VTG  S+G+G+S+V ++  +    I++       + D  E+L+ +   +  ++  C
Sbjct: 54  KVYIVTGATSQGMGTSVVLEMARLGAQLIILCRDVDEWTTDWCEDLRERTQNELIFVEQC 113

Query: 57  GDVSDEETITE-AVNFIE-SKYKRLDGIVANAGVLDP 91
            D+SD   + + A  +++ S  +RLDG+VA +G ++P
Sbjct: 114 -DLSDLYEVRKFATTWLDNSPPRRLDGVVALSGDMEP 149

>YNL181W (YNL181W) [4419] chr14 (298335..299558) Protein of unknown
           function, has low similarity to a region of WW
           domain-containing oxidoreductase (mouse Wwox), which is
           an apoptosis activator induced by hyaluronidase and
           enhanced by mouse Trp53 and functions in tumor necrosis
           [1224 bp, 407 aa]
          Length = 407

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 57/99 (57%), Gaps = 13/99 (13%)

Query: 3   KVFLVTGV-SRGIGSSIVEKLCSIETTKIVIGIARSKDKL-----EELKTQYSGKFDYI- 55
           KV+LVTG  S+G+G+S+  K+  +    I++   R  D+      EEL+ +   +  ++ 
Sbjct: 54  KVYLVTGATSQGMGTSVAYKMAELGAQLIIL--TREVDEWVTEWCEELREKTKNELIFVE 111

Query: 56  -CGDVSDEETITE-AVNFIE-SKYKRLDGIVANAGVLDP 91
            C D+S+   I + A ++++ S  +RLDG++  +G ++P
Sbjct: 112 KC-DLSNLWEIRKFATSWLDNSPPRRLDGVIVMSGDMEP 149

>Kwal_26.8838
          Length = 323

 Score = 35.4 bits (80), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 27/155 (17%)

Query: 3   KVFLVTGVSRGIGSSIVEKLC------------SIETTKIVIGI---ARSKDKLEELKTQ 47
           KV LVTG + GIG   V  L             S    + +  I   AR++ K E+ +++
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYLHGFAVYVAGRNSSRVNRAIKDIKKEARTRIKKEDPESR 78

Query: 48  YS-GKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVL----DPVEDVNNIHISK 102
           +  G+  ++  D+++ + + +A     S   RLD ++ NAGV+       ED   I +  
Sbjct: 79  HPVGELYFLSLDLTELKLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTEDGFEIQLQ- 137

Query: 103 WKQLFDINFFSVVSLVGHALPLLKQSNGNIVLVSS 137
                  N+ +   L    LP +K+  G I+ VSS
Sbjct: 138 ------TNYIAHFLLTMRLLPSVKRCRGRIITVSS 166

>Scas_652.19d
          Length = 341

 Score = 35.4 bits (80), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 72/158 (45%), Gaps = 23/158 (14%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVS- 60
           SK  L+TG + GIG  +++ L S      +I + RS +K E  K +   K+    G +S 
Sbjct: 41  SKTALITGTNTGIGFEVMKLLYSKNCN--IIAVVRSAEKGEAAKKEAIEKYPNSKGSISV 98

Query: 61  -------DEETITEAVNFIESKY--KRLDGIVANAGVLDPVEDVNNIHISK--WKQLFDI 109
                  D  T+  A   I+     K L+ I+ NAG++ PV    N   SK   + +F  
Sbjct: 99  VGGNDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAGLMAPV----NTGTSKQGLEAMFST 154

Query: 110 NFFSVVSLVGHAL-PLLKQSNGN---IVLVSSGASTKS 143
           N      L+ H L PL  + + +   IV VSSGA   +
Sbjct: 155 NVLG-PQLLQHFLDPLFLKKDDDLKRIVWVSSGAHANA 191

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 35.0 bits (79), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 74/170 (43%), Gaps = 16/170 (9%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICG--DVS 60
           KV +VTG S GIG  + ++L        V   AR    +E L   + GK   +    D+S
Sbjct: 8   KVAVVTGASSGIGYEVTKELA--RKGFKVFACARRTAPIEPLVNSF-GKELIVPHHLDIS 64

Query: 61  DEETITEAVNFIESKY--KRLDGIVANAG--VLDPVEDVNNIHISKWKQLFDINFFSVVS 116
           + + + +   F+ S+   ++LD +  NAG     P  DV+N      +Q F +N F  ++
Sbjct: 65  ELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALDVSN---DVMEQCFKVNVFGHIN 121

Query: 117 LVGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL-AYGRT 165
           +       L  + G ++   S A    +  +P   I    KA +  Y RT
Sbjct: 122 MTRELAQYLINAKGTVIFTGSIA---GFSTLPFGSIYAATKAAIHEYART 168

>KLLA0F19756g 1830489..1831529 similar to sgd|S0004094 Saccharomyces
           cerevisiae YLR100w ERG27 3-keto sterol reductase,
           hypothetical start
          Length = 346

 Score = 35.0 bits (79), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 73/186 (39%), Gaps = 40/186 (21%)

Query: 2   SKVFLVTGVSRGIGSSIVEKL---CSIETTKIVIGIARSKDKLEE-----------LKTQ 47
           SKV +VTG +  +G +IV +L      E    ++  +R+  ++ E           +   
Sbjct: 4   SKVAVVTGTNSNLGLNIVYRLIERSEPEDNLTIVVTSRTLPRVRECIDLIKAFVNTINRT 63

Query: 48  YSGKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANA--GVLD--------------P 91
            S  +DY+  D ++  +I +A   +  +Y  ++    NA  GV                P
Sbjct: 64  GSVDYDYLLVDFTNMISILDAHYSLSKRYDHINYFFVNAAQGVYSGIDWLGAVKEVFSSP 123

Query: 92  VEDVNNIHISKWK----------QLFDINFFSVVSLVGHALPLLKQSNGNIVLVSSGAST 141
           +E V N      +           +F  N F    L+   LPLL+   G +V VSS  S 
Sbjct: 124 LEAVTNPTYKIQRVGVKSKDGMGLVFQANVFGPYYLIQKLLPLLQAGQGTVVWVSSIMSA 183

Query: 142 KSYVCI 147
             Y+ +
Sbjct: 184 PKYLSL 189

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 35.0 bits (79), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 15/142 (10%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           K+ +VTG   G+G S            +V  I   +  ++E+   Y G        + D+
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEINKIYGG-----GSAIPDK 239

Query: 63  ETI----TEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHIS--KWKQLFDINFFSVVS 116
             +    TE V      + R+D +V NAG+L    D + + ++  +W  +  ++ FS   
Sbjct: 240 HDVVTQPTEIVKTALEAFGRVDVLVNNAGIL---RDRSFLKMTDEEWYAVLKVHLFSTYG 296

Query: 117 LVGHALP-LLKQSNGNIVLVSS 137
           L     P  LKQ +G I+  +S
Sbjct: 297 LSKAVWPVFLKQRSGYIINTTS 318

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 34.7 bits (78), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 13/141 (9%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDE 62
           KV ++TG   G+G S            +V  I      + E+ ++Y G+   I       
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKY-GEGRAIP---DTH 379

Query: 63  ETITEAVNFIES---KYKRLDGIVANAGVLDPVEDVNNIHIS--KWKQLFDINFFSVVSL 117
             +TEA   IE+    Y R+D +V NAG+L    D + + ++  +W  +  ++ +S   L
Sbjct: 380 NVVTEANQVIETAMKAYGRVDVLVNNAGIL---RDRSFLKMTDQEWFAVVQVHLYSTFLL 436

Query: 118 VGHALPL-LKQSNGNIVLVSS 137
                P+ LKQ  G+I+  +S
Sbjct: 437 SKAVWPIFLKQKGGHIINTTS 457

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 33.5 bits (75), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 54/122 (44%), Gaps = 17/122 (13%)

Query: 6   LVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQY--SGKFDYICGDVSDEE 63
           +VTG + GIG +IV + C ++    VI    ++  L  LK     S   D    DV   E
Sbjct: 8   IVTGAASGIGKAIVNQ-C-LQEGASVIACDLNEQALLVLKESLNDSTVLDTYPMDVRKYE 65

Query: 64  TITEAVNFIESKYKRLDGIVANAGV-------------LDPVEDVNNIHISKWKQLFDIN 110
            +     ++E+++  +DG+V NAG+             +D V D+N      + Q+F   
Sbjct: 66  EVAAFFAYVETEHSDVDGLVNNAGIYLAKHILDYQEDEIDKVLDINVKGYIYFSQMFGKK 125

Query: 111 FF 112
            F
Sbjct: 126 LF 127

>Scas_613.18
          Length = 286

 Score = 33.5 bits (75), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 72/170 (42%), Gaps = 27/170 (15%)

Query: 4   VFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEE 63
           V LVTG S G+G  IV++L S   T I++ I     +    K        Y   DV  +E
Sbjct: 37  VALVTGGSSGLGLEIVKQLLSKRCTVIILDIYPPNIQFGADKA-----LTYYKCDVGSQE 91

Query: 64  TITEAVNFIESKYKRLDGIVANAGV--LDPVEDVNNIHISKWKQLFDINFFSVVSLVGHA 121
            I +    I   +  +  ++ NAG+  L P+ + +   ++K   + ++N+     L+   
Sbjct: 92  EIEKTYKRISKDHASIHILINNAGITCLKPITEFSKEEVNK---VINVNYLGACKLM--H 146

Query: 122 LPLLKQSNGNIV-------------LVSSGASTKSYVCI--PLNFILKRR 156
           L L   + G IV             L + GAS    +     LN +LK+R
Sbjct: 147 LWLSANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKR 196

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 64/139 (46%), Gaps = 12/139 (8%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQY---SGKFDYICGDV 59
            + L+TG S G+G  I+ KL        VI +        +L  QY     +   I  D+
Sbjct: 70  PIVLITGGSNGLGRCIIHKLLRSYNNIKVINL--------DLDVQYWSEEARVINIECDL 121

Query: 60  SDEETITEAVNFIESKYK-RLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLV 118
            + + +  A+  I+ +Y+ +++ ++ NAGV        +  I + +++ +IN +S   ++
Sbjct: 122 VNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARIL 181

Query: 119 GHALPLLKQSNGNIVLVSS 137
              +P   Q    IV +SS
Sbjct: 182 QAIIPRDNQRQLYIVTISS 200

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1  MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYS 49
          MS    V+G +  I   ++++L   E  K VIG ARS++K ++L +Q+S
Sbjct: 8  MSTTVFVSGATGFIAQYVIDELLKTEKYK-VIGSARSQEKADKLLSQFS 55

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 62  EETITEAVNFIE---SKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLV 118
            + +TEA   I+   SK++R+D +V NAG+L   +    +   +W  +  ++ FS  SL 
Sbjct: 378 HDVVTEAPLIIQTAISKFQRVDILVNNAGILRD-KSFLKMKDEEWFAVLKVHLFSTFSLS 436

Query: 119 GHALPLL-KQSNGNIVLVSS 137
               P+  KQ +G I+  +S
Sbjct: 437 KAVWPIFTKQKSGFIINTTS 456

>Scas_542.11*
          Length = 663

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16  SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESK 75
           S +VEKL   +++  VI + R +  +E+L  Q+  KF+++ G +  +E + +   FIE  
Sbjct: 261 SKLVEKLMLYDSSSKVIIVCRERVTVEKLYFQH--KFEWLHGRLDADEKMQKTRRFIEDP 318

Query: 76  YKRL 79
             R+
Sbjct: 319 ECRI 322

>Scas_451.1
          Length = 1058

 Score = 32.7 bits (73), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16  SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESK 75
           S +VEKL   +++  VI + R +  +E+L  Q+  KF+++ G +  +E + +   FIE  
Sbjct: 355 SKLVEKLMLYDSSSKVIIVCRERVTVEKLYFQH--KFEWLHGRLDADEKMQKTRRFIEDP 412

Query: 76  YKRL 79
             R+
Sbjct: 413 ECRI 416

>Scas_523.1
          Length = 1658

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16   SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESK 75
            S +VEKL   +++  VI + R +  +E+L  Q+  KF+++ G +  +E + +   FIE  
Sbjct: 1086 SKLVEKLMLYDSSSKVIIVCRERVTVEKLYFQH--KFEWLHGRLDADEKMQKTRRFIEDP 1143

Query: 76   YKRL 79
              R+
Sbjct: 1144 ECRI 1147

>Scas_534.1
          Length = 1311

 Score = 32.3 bits (72), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16   SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESK 75
            S +VEKL   +++  VI + R +  +E+L  Q+  KF+++ G +  +E + +   FIE  
Sbjct: 1119 SKLVEKLMLYDSSSKVIIVCRERVTVEKLYFQH--KFEWLHGRLDADEKMQKTRRFIEDP 1176

Query: 76   YKRL 79
              R+
Sbjct: 1177 ECRI 1180

>Scas_462.1
          Length = 814

 Score = 32.3 bits (72), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16  SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESK 75
           S +VEKL   +++  VI + R +  +E+L  Q+  KF+++ G +  +E + +   FIE  
Sbjct: 682 SKLVEKLMLYDSSSKVIIVCRERVTVEKLYFQH--KFEWLHGRLDADEKMQKTRRFIEDP 739

Query: 76  YKRL 79
             R+
Sbjct: 740 ECRI 743

>Scas_535.1
          Length = 1197

 Score = 32.0 bits (71), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 16   SSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESK 75
            S +VEKL   +++  VI + R +  +E+L  Q+  KF+++ G +  +E + +   FIE  
Sbjct: 1119 SKLVEKLMLYDSSSKVIIVCRERVTVEKLYFQH--KFEWLHGRLDADEKMQKTRRFIEDP 1176

Query: 76   YKRL 79
              R+
Sbjct: 1177 ECRI 1180

>AGR068W [4378] [Homologous to ScYLR100W (ERG27) - SH]
           complement(845794..846840) [1047 bp, 348 aa]
          Length = 348

 Score = 32.0 bits (71), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 72/183 (39%), Gaps = 38/183 (20%)

Query: 2   SKVFLVTGVSRGIGSSIVEKLCSIETTKIVIG---IARSKDKLEELKTQYSGK------- 51
           S++  ++ +   I   ++E+        IV+    + R ++ ++ +KT Y+ K       
Sbjct: 10  SRLTYISNLGLNIAYRLIEQFTDDSKLVIVVTSRTLPRVREVVDLIKT-YAEKCGKSGAV 68

Query: 52  -FDYICGDVSDEETITEAVNFIESKYKRLDGIVANAG----------------VLDPVED 94
            FDY+  D +D  ++  A   +E +Y  +    ANA                 + DP++ 
Sbjct: 69  DFDYLLVDFTDMVSVLGAAYELEKRYDAIHYFYANAAQGVYSGIDWLGATKAVLRDPLDA 128

Query: 95  VNNIHISKWK----------QLFDINFFSVVSLVGHALPLLKQSNGNIVLVSSGASTKSY 144
           V N      +           +F  N F    L+   +PLL +    +V +SS  S   Y
Sbjct: 129 VTNPTYKIQRVGVKSRDGLGLVFQANVFGPYYLIRRIIPLLAKGKAKVVWLSSLMSDVKY 188

Query: 145 VCI 147
           + +
Sbjct: 189 LSL 191

>Kwal_23.4572
          Length = 300

 Score = 30.8 bits (68), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 49/103 (47%), Gaps = 4/103 (3%)

Query: 58  DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSL 117
           DV + E + EAV     ++ R+D ++A A   + +   + +  + +K +  I+     + 
Sbjct: 93  DVREIEQLEEAVARTVERFGRIDFVIAGAAG-NFIAPFSKLSANAFKSVVSIDLLGSFNT 151

Query: 118 VGHALPLLKQSNGNIVLVSSGASTKSYVCIPLNFILKRRKAGL 160
               L  L+++ G+I+ VS   +T  Y  +P    +   KAG+
Sbjct: 152 AKACLAELQRTKGSILFVS---ATFHYYGVPYQSHVGAAKAGV 191

>Kwal_33.14451
          Length = 406

 Score = 30.8 bits (68), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 58/100 (58%), Gaps = 13/100 (13%)

Query: 3   KVFLVTGVS-RGIGSSIVEKLCSIETTKIVIGIARSKDK-----LEELKTQYSGKFDYI- 55
           KV+++TG + +G+G+++  ++       I++   R+ D+     +E+L+++ S +  Y+ 
Sbjct: 54  KVYILTGATTQGMGTAVALEMAQRGAQLIIL--TRTIDEWSTEWVEDLRSRTSNELIYLE 111

Query: 56  -CGDVSDEETITE-AVNFIE-SKYKRLDGIVANAGVLDPV 92
            C D+ D   + + A  +++ S  +RLDG+V  +G L+P 
Sbjct: 112 QC-DLCDLYEVRKFATKWLDNSPPRRLDGVVVMSGDLEPA 150

>Kwal_27.12155
          Length = 280

 Score = 30.4 bits (67), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 54  YICGDVSDEETITEAVNFIESKYKRLDGIVANAGVL---DPVEDVNNIHIS--KWKQLFD 108
           Y C  V DE+ +   +  + +++ R+D  VANAGV     P+ D     ++  +W ++  
Sbjct: 85  YKC-PVDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQ 143

Query: 109 INFFSVV---SLVGHALPLLKQSNGNIVLVSS 137
            +F  V      VG      +Q +G++V+ +S
Sbjct: 144 TDFQGVYYCSKYVGEV--FQRQQHGSLVVTAS 173

>CAGL0M11506g 1134645..1135691 highly similar to sp|Q12452
           Saccharomyces cerevisiae YLR100w ERG27 3-keto sterol
           reductase, hypothetical start
          Length = 348

 Score = 30.4 bits (67), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 70/177 (39%), Gaps = 44/177 (24%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIGI-------ARSKDKLEELK----TQY--- 48
           KV ++TG +  +G +I  +L   ++  + + +        R ++ +E +K    TQ    
Sbjct: 7   KVAVITGANSNLGLNIAYRLIERQSADVRLTLVVTSRTLPRVREVVELIKKFVATQEDPC 66

Query: 49  SGKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAG----------------VLDPV 92
           S  FDY+  D ++  ++  A   +  KY+ ++    NA                 + DP+
Sbjct: 67  SVDFDYLLVDFTNMVSVLNAYYDLNQKYESINYFFVNAAQGVYDGIDWIGAVKQVLSDPL 126

Query: 93  EDVNNIHISKWKQL------------FDINFFSVVSLVGHALPLLKQSNGNIVLVSS 137
           E V N    K  QL            F  N F    L+   LP L +    +V +SS
Sbjct: 127 EAVTNPTYRK--QLVGVKSKDEMGLVFQANVFGPYYLIQKILPQLSKGKATVVWISS 181

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 30.4 bits (67), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 68/138 (49%), Gaps = 11/138 (7%)

Query: 6   LVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLE---ELKTQYSGKFDYICGDVSDE 62
           L+TG S G+G  IV++   +     ++ I      +    E+K+  +  F Y C D+S+ 
Sbjct: 87  LITGGSGGLGLEIVQQFQLLNIKTFILDIVPPPQMVFGNCEIKSN-TNVFYYPC-DISNP 144

Query: 63  ETITEAVNFIESKYKRLDGIVANAGVLD--PVEDVNNIHISKWKQLFDINFFSVVSLVGH 120
           + I E    I+ ++  +  ++ NAG+     ++++++  I K  Q   +N+ S    +  
Sbjct: 145 KEIAELHKKIKLQHGNVTILINNAGITSGYRLQELSDKVIEKTIQ---VNYVSAFYTIQE 201

Query: 121 ALP-LLKQSNGNIVLVSS 137
            LP ++  S G IV V+S
Sbjct: 202 FLPDMVSMSRGYIVNVAS 219

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 30.0 bits (66), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 6   LVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFD 53
           +VTG S GIG     +L S     ++  I+R++ KL  LK +  GKF+
Sbjct: 66  VVTGASDGIGKEFASQLASKGFNLVL--ISRTESKLVALKDELEGKFN 111

>YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associates
           with the Pho85p cyclin-dependent kinase and regulates
           Gcn4p stability [690 bp, 229 aa]
          Length = 229

 Score = 30.0 bits (66), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 24  SIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESKYKRLDGIV 83
           S++  +I+ G+  +KD L  ++    GK +Y      DE  + E    +++K +   G  
Sbjct: 148 SMKNWQIISGL-HAKD-LSLMERWCLGKLNYELAIPYDEFLLWETNTLMKAKLRV--GTP 203

Query: 84  ANAGVLDPVEDVNNIHISKWKQL 106
           ANA V  P E  N+   + WKQ+
Sbjct: 204 ANAPVKRPRESDNDYDANSWKQI 226

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 30.0 bits (66), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 22/113 (19%)

Query: 3   KVFLVTGVSRGIGSSIVEKLCSIETTKIVIG-----IARSKDKL---------------- 41
           +V +VTG + GIG   V  L        V G     ++R+ D +                
Sbjct: 18  RVAVVTGGNSGIGWFTVLHLYMHGFRVYVCGRNSHKVSRAMDDIIEEAVRRHNLYLKGLH 77

Query: 42  EELKTQYSGKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLD-PVE 93
           ++  T+Y G   Y+  D++D + +  A   I      LD +V NAGV+  P E
Sbjct: 78  DQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNNAGVMAVPYE 130

>Scas_693.23*
          Length = 370

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 56/131 (42%), Gaps = 28/131 (21%)

Query: 45  KTQYSGKF--DYICGDVSDEETITEAVNFIESKYKRLDGIVANAG--------------- 87
           K +Y GK   D+   D+S++E++  A + +E+    ++ +  N+                
Sbjct: 46  KIRYKGKISIDFSILDLSNKESVIRAKSVLEATASEINYVFVNSAYGVCGGINWWKAVLE 105

Query: 88  -VLDPVEDVNNIHISKWK----------QLFDINFFSVVSLVGHALPLLKQSNGNIVLVS 136
            +++PV+ V +      +           +F +N F+   L+   LP LK     I+ +S
Sbjct: 106 LIMNPVKAVTDPGYKLQEVGLKSKDGMGLIFQVNVFAPHFLIMLLLPQLKAGKAKIIWIS 165

Query: 137 SGASTKSYVCI 147
           S  S + Y+ +
Sbjct: 166 SLRSDQKYLSL 176

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 12/137 (8%)

Query: 4   VFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEE 63
           + LVTG + G+G  IV +L   +   +++ +    D LE L    +G   Y C D+S   
Sbjct: 62  IALVTGGAGGLGKEIVRELRRRQIVTVILDVVPPPD-LESL----TGVHFYAC-DISLPG 115

Query: 64  TITEAVNFIESKYKRLDGIVANAGVLD--PVEDVNNIHISKWKQLFDINFFSVVSLVGHA 121
            I      I      +  ++ NA +    P++ V+N    K +Q+  +N     +L+   
Sbjct: 116 RIRVIHENIIRDVGHVTILINNAAITSDLPLDRVDN---DKIEQIIRVNLLGPYTLIREF 172

Query: 122 LP-LLKQSNGNIVLVSS 137
           LP ++    G IV ++S
Sbjct: 173 LPSMIAIDRGYIVNIAS 189

>Sklu_2305.6 YGL077C, Contig c2305 10656-12281
          Length = 541

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 60/149 (40%), Gaps = 27/149 (18%)

Query: 6   LVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYS---GKF---------- 52
           +VTG+S G    IV  +  I    + IGI+     L EL + Y    G+F          
Sbjct: 74  MVTGISSGGPMMIVYGIIIIALVSVCIGIS-----LGELSSAYPHAGGQFWWSLKLAPPK 128

Query: 53  -----DYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLF 107
                 Y+CG  +   ++  + +   S    L G+ A   +  P  +V   HI    +L 
Sbjct: 129 YRRFAAYMCGSFAWAGSVFTSASTTLSVATELVGMYA---LTHPDFEVKRWHIFVCFELL 185

Query: 108 DINFFSVVSLVGHALPLLKQSNGNIVLVS 136
            + F  + +  G +LPL+  S   I L S
Sbjct: 186 HL-FLMIFNCSGKSLPLISSSALYISLFS 213

>Scas_683.29
          Length = 907

 Score = 29.3 bits (64), Expect = 2.0,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 8/55 (14%)

Query: 63  ETITEAVNFIESK---YKRLDGIVAN-----AGVLDPVEDVNNIHISKWKQLFDI 109
           ET  E  NFI+ K   Y++L     N     + +L+P+E++ NIHI   +  +DI
Sbjct: 774 ETYPEENNFIQEKNGQYRKLFNNGENNKDEESAILNPIEELLNIHIPINENFWDI 828

>YML097C (VPS9) [3874] chr13 complement(78335..79690) Protein
           involved in vacuolar sorting [1356 bp, 451 aa]
          Length = 451

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 80  DGIVANAGVLDPVEDVNNIHISKWKQLF 107
           D +  N  +L P+++V NI ISK+ +LF
Sbjct: 347 DELQPNGTLLKPLDEVTNIVISKFNELF 374

>Scas_660.4
          Length = 791

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 31  VIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIE--SKYKRLDGIVANAGV 88
           + GI+RSK K    +T    KF  + G    +E I E V+F++  S+Y+++   +    +
Sbjct: 292 IFGISRSKAKRFNTETDVKIKFKDVAGCDEAKEEIMEFVSFLKEPSRYEKMGAKIPRGAI 351

Query: 89  L 89
           L
Sbjct: 352 L 352

>CAGL0J01353g 124994..127477 similar to sp|P40341 Saccharomyces
           cerevisiae YMR089c YTA12 or sp|P39925 Saccharomyces
           cerevisiae YER017c AFG3, hypothetical start
          Length = 827

 Score = 28.9 bits (63), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 31  VIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIES--KYKRLDGIVANAGV 88
           + GI+RSK K    +T    KF  + G    +E I E V+F+ +  +Y+++   +    +
Sbjct: 330 IFGISRSKAKKFNTETDVKVKFKDVAGCDEAKEEIMEFVSFLRNPQRYEKMGAKIPRGAI 389

Query: 89  L 89
           L
Sbjct: 390 L 390

>CAGL0D02420g 247761..248318 weakly similar to sp|Q99176
          Saccharomyces cerevisiae YLR119w SRN2 suppressor of
          RNA1-1 mutation, hypothetical start
          Length = 185

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 37 SKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESKYKRLD 80
          S ++L EL  Q+  K  + C  +   E ITE V  +++++K L+
Sbjct: 37 SYNELLELINQHRDKLHWFCASMDSFEPITEEVKRLKNQFKELE 80

>Scas_502.3
          Length = 1032

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 14/117 (11%)

Query: 5   FLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKD-KLEELKTQY-SGKFDYI--CGDVS 60
           F+ T ++ GI     EKL   ET   V+ I ++ +  L+ ++    +GK++Y+  C    
Sbjct: 335 FMRTIINLGIHGVPTEKLT--ETKNKVLDILKNHEIDLKRIRQVVDNGKWEYVLRCEKNG 392

Query: 61  DEETITEAV--NFIESKYKRLDG--IVANAGVLDPVEDVNNIHISKWKQLFDINFFS 113
           D  T+++A   +F+   Y   DG  + A+   L   +D++N  I++WK+L D  F S
Sbjct: 393 DS-TLSQAAITDFL---YGNPDGSSLEASTKDLSDFDDLSNWTITQWKELVDRIFVS 445

>AEL261C [2245] [Homologous to ScYPR169W - SH] (149024..150124)
           [1101 bp, 366 aa]
          Length = 366

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 40/107 (37%), Gaps = 14/107 (13%)

Query: 31  VIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLD 90
           V G+  S   L     ++ G    IC D       +   + +  K   L G V    VLD
Sbjct: 89  VPGVETSGVSLLWTTKRHKGSVRCICFDADGTHIYSVGTDNVLKKADTLTGKVVKKCVLD 148

Query: 91  PVEDVNNIHISKWKQLFDINFFSVVSLVGHALPLLKQSNGNIVLVSS 137
           P ++V               +  +V    H L LL   NGN+ +++S
Sbjct: 149 PGQNVK--------------YTKLVKSATHPLVLLGDENGNVTVLNS 181

>CAGL0K05269g 512844..515129 similar to tr|Q12311 Saccharomyces
           cerevisiae YPR031w, start by similarity
          Length = 761

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 82  IVANAGVLDPVEDVNNIHISKWK 104
           + AN   ++P+E V NI+ S+WK
Sbjct: 345 VFANLHYMEPIEGVENINKSRWK 367

>ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998)
           [1056 bp, 351 aa]
          Length = 351

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 6   LVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKF 52
           LVTG S GIG     +L S      V+ ++R++ KL ELK +   K+
Sbjct: 72  LVTGASDGIGKEFALQLASKGFN--VLLVSRTEAKLLELKQEIMAKY 116

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
          3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
          aa]
          Length = 278

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 4  VFLVTGVSRGIGSSIVEKLCSIETTKIVIG 33
          V +VTG +RGIG +I +KL     + I++G
Sbjct: 6  VAIVTGATRGIGKAICQKLFQKGLSCIILG 35

>CAGL0H05291g complement(509813..511519) similar to tr|Q02866
           Saccharomyces cerevisiae YPL070w, hypothetical start
          Length = 568

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 95  VNNIHISKWKQLFDINFFSVVSLVGHALPLLKQS-----NGNIVLVSS 137
           +NN+ I K+K L + + F+ +  VG ++P+   S     NGN  L +S
Sbjct: 203 LNNLKIEKYKDLCERDLFNRILQVGTSVPISSPSKSANVNGNSTLANS 250

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 24/142 (16%)

Query: 4   VFLVTGVSRGIGSSIVEKLCSIETTKIVIG-----IARSKDKLEELKTQYSGKF------ 52
           V +V+G +RGIGS I ++L     + I IG     + +++ +++    Q++         
Sbjct: 6   VSIVSGATRGIGSKIRDELLLSGYSVIYIGSNDDSVVKNQPRIKLNHGQFAKGISINFKG 65

Query: 53  ----------DYIC--GDVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHI 100
                      +IC  G +  +    + +   + K  RLD +V  AG+      +   + 
Sbjct: 66  WPTWVDTTWSQFICRNGKIETKIESNDLMAGFDKKQYRLDLLVNCAGITQTTAAI-KANT 124

Query: 101 SKWKQLFDINFFSVVSLVGHAL 122
           ++   + ++NF S VSL   AL
Sbjct: 125 NEMADIMNVNFMSSVSLTQLAL 146

>CAGL0E05698g complement(566932..568731) similar to tr|Q08961
           Saccharomyces cerevisiae YPL208w, start by similarity
          Length = 599

 Score = 27.3 bits (59), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 10  VSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKF 52
           V   +G S+ EKLCS+    IV+  +R     E+LK++  GK+
Sbjct: 131 VGTNLGGSVKEKLCSVIKEWIVLIESR-----EDLKSKVDGKY 168

>Kwal_14.2598
          Length = 311

 Score = 27.3 bits (59), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 2  SKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSG 50
          ++V L+ G S+G+G +   K  +  +   VI ++RS+ KL+      SG
Sbjct: 8  NQVVLIAGGSQGLGKAFASKFYNEGSNNKVIVVSRSRTKLQNAVCDVSG 56

>YMR089C (YTA12) [4047] chr13 complement(445608..448085)
           Mitochondrial protein involved with Afg3p in proteolytic
           and chaperonin activities in the inner membrane, member
           of the AAA family of ATPases [2478 bp, 825 aa]
          Length = 825

 Score = 27.3 bits (59), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 31  VIGIARSKDKLEELKTQYSGKFDYICGDVSDEETITEAVNFIE--SKYKRLDGIVANAGV 88
           + G++RSK K    +T    KF  + G    +E I E V+F++  S+Y+++   +    +
Sbjct: 326 IFGLSRSKAKKFNTETDVKIKFKDVAGCDEAKEEIMEFVSFLKEPSRYEKMGAKIPRGAI 385

Query: 89  L 89
           L
Sbjct: 386 L 386

>KLLA0E09119g 816861..817703 some similarities with
           ca|CA4969|IPF3930 Candida albicans unknown function,
           hypothetical start
          Length = 280

 Score = 26.9 bits (58), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 8/135 (5%)

Query: 4   VFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEELKTQYSGKFDYICGDVSDEE 63
           + +V G SRGIGS +V    S+    I+I      + +E  +  +     Y C D+SD E
Sbjct: 40  IVVVAGGSRGIGSHLVTMFDSLGYKTILIDKRYPLNLIEPHRVSF-----YKC-DISDFE 93

Query: 64  TITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVGHALP 123
                ++ I  ++ ++  +  NA  L    D         ++L    +   + ++ H LP
Sbjct: 94  YTRLILDDISVRFGQIT-VFINAVSLKSFTDAEVGKGVSLRKLMRTVYAGSMHIIQHILP 152

Query: 124 -LLKQSNGNIVLVSS 137
            ++    G I+ ++S
Sbjct: 153 KMIAYDRGYIIDIAS 167

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,857,343
Number of extensions: 244732
Number of successful extensions: 913
Number of sequences better than 10.0: 106
Number of HSP's gapped: 870
Number of HSP's successfully gapped: 106
Length of query: 183
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 88
Effective length of database: 13,307,399
Effective search space: 1171051112
Effective search space used: 1171051112
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)