Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08052g1171166162e-84
CAGL0F06919g2501063747e-46
ACR171C2511073548e-43
YIR036C2631063522e-42
Scas_628.62521083495e-42
CAGL0F06897g2581063322e-39
YIR035C2541063294e-39
Scas_685.82521072885e-33
ABR247W2501081875e-18
ABR249W2501081875e-18
ABR248W2611041869e-18
ABR246W2501001823e-17
YKL055C (OAR1)27868840.001
Sklu_2420.532637780.010
KLLA0E24046g28097710.066
Scas_641.3128738710.067
Kwal_26.883832337700.100
AAL089W32837680.22
YOR246C33037670.23
YKL071W25641630.80
AGL060W89166621.2
KLLA0D06127g33037621.3
Kwal_55.1956928895611.4
CAGL0K09152g32737611.6
YDL114W30850611.9
ABR102W89135602.1
Sklu_2391.741744602.3
Kwal_34.1602429244602.4
KLLA0D12628g57852602.4
Scas_594.1226746592.8
CAGL0M11242g26846584.3
ACL091C64943584.4
KLLA0E22495g29244575.6
CAGL0L02167g90151575.8
YBR233W (PBP2)41355567.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08052g
         (116 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08052g complement(725895..726248) similar to sp|P40580 Sac...   241   2e-84
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   148   7e-46
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   140   8e-43
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   140   2e-42
Scas_628.6                                                            139   5e-42
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   132   2e-39
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   131   4e-39
Scas_685.8                                                            115   5e-33
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    77   5e-18
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    77   5e-18
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    76   9e-18
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    75   3e-17
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    37   0.001
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        35   0.010
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    32   0.066
Scas_641.31                                                            32   0.067
Kwal_26.8838                                                           32   0.100
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    31   0.22 
YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member...    30   0.23 
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    29   0.80 
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    28   1.2  
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    28   1.3  
Kwal_55.19569                                                          28   1.4  
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    28   1.6  
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    28   1.9  
ABR102W [694] [Homologous to ScYPR095C (SYT1) - SH] complement(5...    28   2.1  
Sklu_2391.7 YPL188W, Contig c2391 16074-17327                          28   2.3  
Kwal_34.16024                                                          28   2.4  
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    28   2.4  
Scas_594.12                                                            27   2.8  
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    27   4.3  
ACL091C [958] [Homologous to NOHBY] (182427..184376) [1950 bp, 6...    27   4.4  
KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candid...    27   5.6  
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    27   5.8  
YBR233W (PBP2) [411] chr2 (683385..684626) Protein required for ...    26   7.0  

>KLLA0E08052g complement(725895..726248) similar to sp|P40580
           Saccharomyces cerevisiae YIR036c, hypothetical start
          Length = 117

 Score =  241 bits (616), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MWKIYDQYGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSG 60
           MWKIYDQYGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSG
Sbjct: 1   MWKIYDQYGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSG 60

Query: 61  MTKEALQRFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
           MTKEALQRFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS
Sbjct: 61  MTKEALQRFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  148 bits (374), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQ 67
           YGW AYG+SKAA+NH   ++AAE  A+K I+VAPGVV TKMQ+DIR+ FGPSGMT +AL+
Sbjct: 145 YGWCAYGSSKAAVNHLTMSLAAENKAIKTIAVAPGVVDTKMQDDIRDKFGPSGMTADALK 204

Query: 68  RFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLR 113
           RF DL  N +LL   VPG IYA LA  GIP+EL+G Y+RYND +L+
Sbjct: 205 RFTDLKKNGELLDADVPGKIYARLAVSGIPAELNGEYVRYNDSRLQ 250

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  140 bits (354), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 66/107 (61%), Positives = 84/107 (78%), Gaps = 1/107 (0%)

Query: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69
           WGAYG+SKAALNHFA T+AAEEPAV+A++VAPGVV T+MQ DIR+ FG   M  EAL+RF
Sbjct: 145 WGAYGSSKAALNHFAMTLAAEEPAVRAVAVAPGVVDTQMQNDIRDKFGHR-MAPEALRRF 203

Query: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
            +L  N +LL P +P TI+ANLA +GIP   +G YLRYND+ L +++
Sbjct: 204 TELKKNSELLDPQIPATIFANLALRGIPDCANGKYLRYNDDILAAYA 250

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  140 bits (352), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 78/106 (73%), Gaps = 2/106 (1%)

Query: 9   GWGAYGASKAALNHFAATIAAEEPA--VKAISVAPGVVKTKMQEDIRETFGPSGMTKEAL 66
           GW AYG SKAALNHFA  IA+EEP+  V+A+ +APGVV T+MQ+DIRET GP GMT +AL
Sbjct: 153 GWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMTPKAL 212

Query: 67  QRFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKL 112
           +RF  L+    LL P VP  + A L  KGIP  L+G YLRYNDE+L
Sbjct: 213 ERFTQLYKTSSLLDPKVPAAVLAQLVLKGIPDSLNGQYLRYNDERL 258

>Scas_628.6
          Length = 252

 Score =  139 bits (349), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 1/108 (0%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQ 67
           +GW AY ASKAALN FA ++A E+P VK ISVAPGVV T+MQ DIRE +G + MT E+L+
Sbjct: 146 FGWAAYSASKAALNSFAMSVANEKPKVKTISVAPGVVDTQMQVDIREKYG-NEMTTESLK 204

Query: 68  RFVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSF 115
           RF+DLH N +LL   VPG +YA LA  GIP EL+G Y RYND++L S 
Sbjct: 205 RFIDLHKNGELLDSDVPGEVYAKLAVNGIPDELNGKYSRYNDDRLASL 252

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 80/106 (75%)

Query: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69
           WGAYG+SKAALNHFA T+A EE AV+A++VAPG+V T MQ +IRE  GP GM++E L+ F
Sbjct: 151 WGAYGSSKAALNHFAMTLANEEKAVRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMF 210

Query: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSF 115
            DL  +++LL  S+P T+Y+ LA  GIP E++G YL ++ E L+ F
Sbjct: 211 RDLKKDNKLLHSSIPATVYSKLALNGIPEEINGQYLSFDAEVLKEF 256

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  131 bits (329), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (71%)

Query: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69
           WGAYG+SKAALNHFA T+A EE  VKAI+VAPG+V T MQ +IRE  GPS M+ E L+ F
Sbjct: 147 WGAYGSSKAALNHFAMTLANEERQVKAIAVAPGIVDTDMQVNIRENVGPSSMSAEQLKMF 206

Query: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSF 115
             L +N+QLL  SVP T+YA LA  GIP  ++G YL YND  L  F
Sbjct: 207 RGLKENNQLLDSSVPATVYAKLALHGIPDGVNGQYLSYNDPALADF 252

>Scas_685.8
          Length = 252

 Score =  115 bits (288), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRF 69
           WGAY ASKA LN FA T+A EEPAVK +SVAPG+V T MQ +IRE  G   MT E    F
Sbjct: 147 WGAYSASKACLNRFAMTVANEEPAVKCLSVAPGIVDTSMQVNIRENVGKD-MTSEDHAMF 205

Query: 70  VDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
            DL ++++LL  +VP T+Y+ LA  GIP +++G YL ++D  L+ F+
Sbjct: 206 KDLKESNKLLDSNVPATVYSKLALNGIPVDVNGKYLSFDDPILKEFA 252

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score = 76.6 bits (187), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%), Gaps = 4/108 (3%)

Query: 10  WGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKM-QEDIRETFGPSGMTKEALQR 68
             AY +SK ALNHFA  +A EEP ++ I++ PG V+T M  E I      +G    A++ 
Sbjct: 144 LAAYASSKIALNHFALILAMEEPEIRTIALDPGAVQTDMLAEGINAADEAAGSQDNAVR- 202

Query: 69  FVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
             +L    ++  P  PG + A LA++GIP EL+G Y+R + EKL +++
Sbjct: 203 --ELLKQVRVATPEEPGAVLAALAARGIPEELNGKYVRADSEKLAAYT 248

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score = 76.6 bits (187), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 9   GWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQR 68
              AY +SK ALNHFA  +A EE  ++++++ PG+V+T M          +  T++   R
Sbjct: 143 ALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQTDMTAAALVAADKAAGTQDNSVR 202

Query: 69  FVDLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
             +L    +++ P  PGT+ A LA+KGIP EL+G Y+ ++ EKL +++
Sbjct: 203 --ELTKQIRMVSPEEPGTVLAALAAKGIPEELNGKYVTFDSEKLAAYT 248

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score = 76.3 bits (186), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 2/104 (1%)

Query: 13  YGASKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRFVDL 72
           Y +SK ALNHFA  +A EEP ++ I++ PGV +T M  D       +  T++   R  ++
Sbjct: 158 YASSKIALNHFAMILAMEEPEIRTIALDPGVAQTDMLTDGLNAADQAAGTQDNAAR--EM 215

Query: 73  HDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
             + ++  P  PGT+ A LA+KGIP EL+G ++ Y+ E+L +++
Sbjct: 216 MRHVRVASPDEPGTVLAALAAKGIPEELNGKFVVYDSEELAAYT 259

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score = 74.7 bits (182), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 63/100 (63%), Gaps = 2/100 (2%)

Query: 17  KAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRFVDLHDND 76
           K ALNHF   +AAEEPA++A++VAPGVV+T M  +  +    +   ++    F  +    
Sbjct: 151 KIALNHFIRILAAEEPALRAVAVAPGVVRTDMTVEALDASEDAPGARDNF--FKAVLKQG 208

Query: 77  QLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFS 116
           +++ P  PG + A LA KGIP EL+G +++++ EKL +++
Sbjct: 209 RVVLPDAPGAVLAALAVKGIPQELNGRFVQFDSEKLAAYA 248

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 11/68 (16%)

Query: 9   GWGAYGASKAALNHFAATIAAE-EPA-VKAISVAPGVVK---------TKMQEDIRETFG 57
           G   Y ASKAAL+ F   +AAE EP  ++  +++PG+VK          + +E +  T G
Sbjct: 194 GTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPVEAKEMLERTIG 253

Query: 58  PSGMTKEA 65
            SG +  A
Sbjct: 254 ASGTSAPA 261

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 34.7 bits (78), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVV 44
           + W  Y  +K AL  F   +A + P V  ISV PG+V
Sbjct: 193 FTWMRYAMAKTALIQFTKMLAIKHPDVLCISVHPGLV 229

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 32.0 bits (71), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 26/97 (26%)

Query: 12  AYGASKAALNHFAATIAAEEPAVKAI-SVAPGVVKTKMQEDIRETFGPSGMTKEALQRFV 70
            Y A+KA + HFA ++A E      + +V+PG + T +   + E                
Sbjct: 187 CYNAAKAGVIHFAKSLAVEWAGFARVNTVSPGYIATPISNFVDE---------------- 230

Query: 71  DLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRY 107
           DL +    L P         +  +G+P EL GAYL +
Sbjct: 231 DLKNKWHSLIP---------MGREGLPQELVGAYLYF 258

>Scas_641.31
          Length = 287

 Score = 32.0 bits (71), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 9   GWGAYGASKAALNHFAATIAAEEPA--VKAISVAPGVV 44
           G   Y ASKAAL  +  T++ E     ++A+S+APG+V
Sbjct: 207 GTSIYSASKAALIQYTRTLSQETETWGIRALSMAPGLV 244

>Kwal_26.8838
          Length = 323

 Score = 31.6 bits (70), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVV 44
           + W  Y  +K A   FA  +A + P V  +SV PG+V
Sbjct: 190 FTWMRYAMAKTASIQFAKMLAIKHPDVLCMSVHPGLV 226

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 30.8 bits (68), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVV 44
           + W  Y  +K A   F   +A + P V  I+V PG+V
Sbjct: 195 FTWLRYAMAKTAAIQFTKMLAIKHPDVMCIAVHPGLV 231

>YOR246C (YOR246C) [5035] chr15 complement(795801..796793) Member of
           the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases, has low
           similarity to a region of WW domain-containing
           oxidoreductase (mouse Wwox), which is an apoptosis
           activator [993 bp, 330 aa]
          Length = 330

 Score = 30.4 bits (67), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVV 44
           + W  Y  SK AL      +A + P V  +SV PG+V
Sbjct: 197 FTWFRYAMSKTALIQCTKMLAIKYPDVLCLSVHPGLV 233

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 28.9 bits (63), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 12  AYGASKAALNHFAATIAAE-EP-AVKAISVAPGVVKTKMQE 50
           AYG SKAALN+   T++ E +P     ++  PG+V T M +
Sbjct: 163 AYGQSKAALNYAVKTLSFELKPEGFTVVAFHPGMVSTDMGQ 203

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 28.5 bits (62), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 4   IYDQYGWGAYGASKAALNHFAATIAAE--EPAVKAISVAP----GVVKTKMQE-DIRETF 56
           IY  +G   Y A+KAA+  F+ ++A E  +  ++   +AP     + KT   E +I+ +F
Sbjct: 457 IYGNFGQANYSAAKAAVLGFSKSLAIEGAKRGIRVYVIAPHAFTNMTKTIFGETEIKSSF 516

Query: 57  GPSGMT 62
            PS ++
Sbjct: 517 EPSQVS 522

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 28.5 bits (62), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVV 44
           + W  Y  +K A   F   +A + P +  +S+ PG+V
Sbjct: 197 FMWCRYALAKTASIQFTKMLAIKNPDILCMSLHPGLV 233

>Kwal_55.19569
          Length = 288

 Score = 28.1 bits (61), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 26/95 (27%)

Query: 12  AYGASKAALNHFAATIAAEEPAVKAI-SVAPGVVKTKMQEDIRETFGPSGMTKEALQRFV 70
            Y A+KA + H + ++A E      + S++PG + T +      TF  + M     QR+ 
Sbjct: 195 CYNAAKAGVIHLSRSLAVEWAGFARVNSISPGYIDTPIA-----TFAEAKMK----QRW- 244

Query: 71  DLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYL 105
                 +L P          L  +G+P EL GAYL
Sbjct: 245 -----HELTP----------LGREGLPEELVGAYL 264

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 28.1 bits (61), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 8   YGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGVV 44
           + W  Y  +K A   +   +A + P +  +SV PG+V
Sbjct: 194 FTWFRYAMTKVASIQYTKMLAIKNPDILFVSVHPGLV 230

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 28.1 bits (61), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 9/50 (18%)

Query: 12  AYGASKAAL--------NHF-AATIAAEEPAVKAISVAPGVVKTKMQEDI 52
           +YGASK A+         HF + +    +  +K + V PG +KT M  D+
Sbjct: 181 SYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLLVCPGKIKTNMFIDV 230

>ABR102W [694] [Homologous to ScYPR095C (SYT1) - SH]
           complement(570873..573548) [2676 bp, 891 aa]
          Length = 891

 Score = 27.7 bits (60), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 81  PSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSF 115
           PS+PG +  +  +    +E+ G YL+ + E LR+F
Sbjct: 569 PSMPGVLQLSHKNLATFTEVKGGYLKASKEMLRNF 603

>Sklu_2391.7 YPL188W, Contig c2391 16074-17327
          Length = 417

 Score = 27.7 bits (60), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 71  DLHDNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRS 114
           DLH ND++   +  GTIY N     +PS +D   LR   + +++
Sbjct: 341 DLHVNDEIHVVNEVGTIYVN--GSQLPSTMDKHELRQKKKSIKN 382

>Kwal_34.16024
          Length = 292

 Score = 27.7 bits (60), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 12  AYGASKAALNHFAATIAAE-----EPA--VKAISVAPGVVKTKM 48
            Y ASKAA+ H A   A E     EPA  ++  SV+PG   T +
Sbjct: 193 CYNASKAAVRHMARGFAVEFAHLTEPAGRIRCNSVSPGYTDTIL 236

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 27.7 bits (60), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%)

Query: 25  ATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRFVDLHDND 76
           A I    P VK +S+      +  QE I  T GP   + E L  F+  + ND
Sbjct: 259 AGICGMRPTVKRVSLLDVTPSSGGQESIVPTIGPLARSIEELDYFMKHYIND 310

>Scas_594.12
          Length = 267

 Score = 27.3 bits (59), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 6   DQYGWGA-YGASKAALNHFAATIAAE--EPAVKAISVAPGVVKTKM 48
           D Y  G+ Y ASK A+  F  ++  E     ++ I +APG+V+T+ 
Sbjct: 160 DAYPTGSIYCASKFAVRAFTESLRRELINTKIRVILIAPGIVETEF 205

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 26.9 bits (58), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 6   DQYGWGA-YGASKAALNHFAATIAAE--EPAVKAISVAPGVVKTKM 48
           D Y  GA Y A+K A+  F  ++  E     ++ I +APG+V+T+ 
Sbjct: 160 DAYPTGAIYCATKHAVRAFTQSLRKELINTDIRVIEIAPGMVETEF 205

>ACL091C [958] [Homologous to NOHBY] (182427..184376) [1950 bp, 649
           aa]
          Length = 649

 Score = 26.9 bits (58), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 1   MWKIYDQYGWGAYGASKAALNHFAATIAAEEPAVKAISVAPGV 43
           M  +++ YGW    A++ A +H+       +P +K IS+   V
Sbjct: 365 MADLWEDYGWIDREAARQARSHYTGFAINAKPGLKVISLNSNV 407

>KLLA0E22495g 1996893..1997771 similar to ca|CA3677|CaSOU3 Candida
           albicans putative sorbitol utilization protein (by
           homology), start by similarity
          Length = 292

 Score = 26.6 bits (57), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 12  AYGASKAALNHFAATIAAE-----EPA--VKAISVAPGVVKTKM 48
            Y ASKAA+ H A   A E      PA  ++  SV+PG   T +
Sbjct: 193 CYNASKAAVRHMAKGFAVEFSGLTSPAGKIRCNSVSPGYTDTLL 236

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 26.6 bits (57), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 4   IYDQYGWGAYGASKAALNHFAATIAAE--EPAVKAISVAPGVVKTKMQEDI 52
           ++  +G   Y A+K  L  FA T+A E  +  +   S+AP + +++M E++
Sbjct: 156 LFGNFGQANYSAAKLGLVGFAETLAKEGYKYNINVNSIAP-LARSRMTENV 205

>YBR233W (PBP2) [411] chr2 (683385..684626) Protein required for
          proper chromosome segregation during meiosis, confers
          resistance to the antimalarial drug mefloquine when
          overproduced, contains KH RNA-binding domains [1242 bp,
          413 aa]
          Length = 413

 Score = 26.2 bits (56), Expect = 7.0,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 26/55 (47%)

Query: 37 ISVAPGVVKTKMQEDIRETFGPSGMTKEALQRFVDLHDNDQLLPPSVPGTIYANL 91
          + V+P  +K K  ED  E    + + + AL+      DND   P +VP  ++  +
Sbjct: 17 VLVSPNTLKRKKGEDTSEEQLEAEIKRVALKDADSHSDNDHDSPDNVPSDVHLRM 71

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,774,102
Number of extensions: 136447
Number of successful extensions: 462
Number of sequences better than 10.0: 51
Number of HSP's gapped: 452
Number of HSP's successfully gapped: 52
Length of query: 116
Length of database: 16,596,109
Length adjustment: 86
Effective length of query: 30
Effective length of database: 13,618,961
Effective search space: 408568830
Effective search space used: 408568830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 54 (25.4 bits)