Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08030g30229813090.0
Sklu_2380.52892148561e-115
Kwal_14.8682822168151e-109
YKL024C (URA6)2041947711e-103
Scas_685.92001957691e-103
CAGL0L09867g2601977601e-101
ACR170C2892157346e-97
CAGL0K11418g2222212345e-23
KLLA0F13376g2272132329e-23
AGR187W2772172297e-22
YDR226W (ADK1)2222172232e-21
Scas_721.822212132222e-21
KLLA0C17754g2271972102e-19
Kwal_27.116072272192058e-19
Kwal_56.234892252032031e-18
AGR115C2511931972e-17
Sklu_2123.22282131952e-17
Scas_681.182482091926e-17
CAGL0L11902g2511931849e-16
YER170W (ADK2)2251871696e-14
Sklu_2063.32081381016e-05
ACL150W219140936e-04
KLLA0D12386g211138830.013
YDL166C (FAP7)197140720.29
CAGL0C05005g107627691.3
ADR282C221124652.7
KLLA0D12012g53752653.6
Scas_617.742064627.1
Scas_680.122760617.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08030g
         (298 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08030g complement(724562..725470) some similarities with s...   508   0.0  
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                         334   e-115
Kwal_14.868                                                           318   e-109
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...   301   e-103
Scas_685.9                                                            300   e-103
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...   297   e-101
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...   287   6e-97
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...    95   5e-23
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...    94   9e-23
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...    93   7e-22
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...    91   2e-21
Scas_721.82                                                            90   2e-21
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...    86   2e-19
Kwal_27.11607                                                          84   8e-19
Kwal_56.23489                                                          83   1e-18
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...    80   2e-17
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                            80   2e-17
Scas_681.18                                                            79   6e-17
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...    75   9e-16
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    70   6e-14
Sklu_2063.3 YDL166C, Contig c2063 1224-1850                            44   6e-05
ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH] complement(8...    40   6e-04
KLLA0D12386g complement(1054141..1054776) similar to sp|Q12055 S...    37   0.013
YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential p...    32   0.29 
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    31   1.3  
ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)...    30   2.7  
KLLA0D12012g 1024590..1026203 similar to sgd|S0005951 Saccharomy...    30   3.6  
Scas_617.7                                                             28   7.1  
Scas_680.1                                                             28   7.2  

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/298 (84%), Positives = 253/298 (84%)

Query: 1   MLRSFIPTSRSVLLRYSPVQNYVLRSSVCRGLINAGQIXXXXXXXXXXXXXXXXXXXXXX 60
           MLRSFIPTSRSVLLRYSPVQNYVLRSSVCRGLINAGQI                      
Sbjct: 1   MLRSFIPTSRSVLLRYSPVQNYVLRSSVCRGLINAGQIQSYSQKASATATSASDSKGGNN 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXYQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGG 120
                                  YQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGG
Sbjct: 61  GGKGKLLLILGLLALGSSVVSLSYQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGG 120

Query: 121 PGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVAL 180
           PGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVAL
Sbjct: 121 PGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVAL 180

Query: 181 LKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGK 240
           LKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGK
Sbjct: 181 LKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGK 240

Query: 241 TSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKD 298
           TSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKD
Sbjct: 241 TSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKD 298

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score =  334 bits (856), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 183/214 (85%), Gaps = 3/214 (1%)

Query: 84  YQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSA 143
           YQKNPPV F E    D   K PAFS +DV VVFVLGGPGAGKGTQC KLVKD+GFVHLSA
Sbjct: 74  YQKNPPVEFMENAPED---KGPAFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSA 130

Query: 144 GDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPR 203
           GDLLRAEQ R+GS+YG LIK  IK+G IVPQEVTVALL+NAI  N+    K+FLVDGFPR
Sbjct: 131 GDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPR 190

Query: 204 KMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETS 263
           KMDQAITFE++IVPS  TLFFDCPE +MLERLL+RGKTSGR DDNIESI+KRF+TF+ETS
Sbjct: 191 KMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIKKRFRTFIETS 250

Query: 264 VPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIK 297
           +PVVEYFEKQNKV+KVSC+QP+DEVY+ V  A++
Sbjct: 251 MPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVE 284

>Kwal_14.868
          Length = 282

 Score =  318 bits (815), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 181/216 (83%), Gaps = 3/216 (1%)

Query: 84  YQKNPPVAFEEGPVSDDKKKT-PAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLS 142
           YQKN PV F E    + K  T PAFS  DV V+FVLGGPGAGKGTQCA LV+D+ FVHLS
Sbjct: 66  YQKNGPVEFVEE--ENSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLS 123

Query: 143 AGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFP 202
           AGDLLRAEQ REGS+YG LIK  IK+G IVPQEVTVALL+ AI  NY+  +K+FLVDGFP
Sbjct: 124 AGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFP 183

Query: 203 RKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVET 262
           RKMDQAITFEE+IVPS  TLFFDCPEK+ML+RLL+RGKTSGR DDN+ESI+KRFKTF+ET
Sbjct: 184 RKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIET 243

Query: 263 SVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKD 298
           S+PVVEYFEKQ+KVV VSC+  V++VY+ V  A+K+
Sbjct: 244 SMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKE 279

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 167/194 (86%)

Query: 105 PAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKK 164
           PAFS D V V+FVLGGPGAGKGTQC KLVKD+ FVHLSAGDLLRAEQ R GSQYGELIK 
Sbjct: 9   PAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKN 68

Query: 165 CIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFF 224
           CIK+G+IVPQE+T+ALL+NAI+ N  ++  KFL+DGFPRKMDQAI+FE +IV S   LFF
Sbjct: 69  CIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFF 128

Query: 225 DCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQP 284
           DCPE IMLERLL+RGKTSGR DDNIESI+KRF TF ETS+PV+EYFE ++KVV+V C++ 
Sbjct: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRS 188

Query: 285 VDEVYQHVTEAIKD 298
           V++VY+ V +AI+D
Sbjct: 189 VEDVYKDVQDAIRD 202

>Scas_685.9
          Length = 200

 Score =  300 bits (769), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 166/195 (85%)

Query: 104 TPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIK 163
           T AF+ D V V+FVLGGPGAGKGTQCAKLV D+GFVHLSAGDLLRAEQ REGS++G LIK
Sbjct: 3   TTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIK 62

Query: 164 KCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLF 223
             I +G IVPQE+T+ALLKNAI  NY+   KKFLVDGFPRKMDQA++FEE+IVPS   LF
Sbjct: 63  HYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILF 122

Query: 224 FDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQ 283
           FDCPE +MLERLL RGKTSGR+DDNIESI+KRFKTF ETS+PVV+YFE Q+KV+K+ C+ 
Sbjct: 123 FDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDS 182

Query: 284 PVDEVYQHVTEAIKD 298
           PVD+VY+ V  A+ +
Sbjct: 183 PVDDVYKQVKAAVDE 197

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score =  297 bits (760), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 169/197 (85%)

Query: 100 DKKKTPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYG 159
           +K+  PAFS+D V V+FVLGGPGAGKGTQCAKLV D+ FVHLSAGDLLRAEQ REGS++G
Sbjct: 58  EKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFG 117

Query: 160 ELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPST 219
           ELIK  IK+G IVPQE+T++LL+ AI  NY  +  KFLVDGFPRKMDQA++FE++IVPS 
Sbjct: 118 ELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSK 177

Query: 220 MTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKV 279
            TLFF+CPE++MLERLL+RGKTSGR DDNIESI+KRF+TF ETS+PVV YF+ Q+KVVKV
Sbjct: 178 FTLFFECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKV 237

Query: 280 SCNQPVDEVYQHVTEAI 296
            C+ PV++VY  V +A+
Sbjct: 238 RCDHPVEDVYNQVKQAL 254

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score =  287 bits (734), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 171/215 (79%), Gaps = 5/215 (2%)

Query: 84  YQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSA 143
           YQK PP    E   ++D+   P  +  D  VVFVLGGPG+GKGTQC++LV+   FVH+ A
Sbjct: 75  YQKAPPRELRE---AEDESARPLPA--DASVVFVLGGPGSGKGTQCSRLVERMQFVHVGA 129

Query: 144 GDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPR 203
           GDLLR EQ R GSQYGELIK  IK+G IVPQEVTVALL+ AI  +Y +  +KFLVDGFPR
Sbjct: 130 GDLLRDEQNRPGSQYGELIKHHIKEGLIVPQEVTVALLRRAIEEHYRAGRRKFLVDGFPR 189

Query: 204 KMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETS 263
           KMDQA TFE+ +VPS   LFFDCPE++MLERLL RG+TSGR DDNIESI+KRF+T+VETS
Sbjct: 190 KMDQAFTFEKTVVPSKFVLFFDCPERVMLERLLTRGQTSGRSDDNIESIKKRFRTYVETS 249

Query: 264 VPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKD 298
           +PVVE+F +Q+KVV++SC+QPV+EVY+ V  A+K+
Sbjct: 250 MPVVEHFAQQDKVVRLSCDQPVEEVYKQVEAAVKE 284

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score = 94.7 bits (234), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 109/221 (49%), Gaps = 33/221 (14%)

Query: 107 FSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCI 166
            S  D + + ++G PGAGKGTQ   LV+ F   HL+ GD+LR+ Q  +G++ G   KK +
Sbjct: 1   MSSSDSIRMVLIGPPGAGKGTQAPNLVERFHAAHLATGDMLRS-QISKGTELGLQAKKIM 59

Query: 167 KDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFE----EEIVPSTMTL 222
             G +V  ++ V ++K+ +T+N    N  F++DGFPR + QA   +    E   P    +
Sbjct: 60  DQGGLVSDDIMVNMIKDELTNNPACKN-GFILDGFPRTIPQAEKLDNMLKERGTPLEKAV 118

Query: 223 FFDCPEKIMLERLLQR--GKTSG-------------------------RIDDNIESIQKR 255
                +++++ R+  R     SG                         R DDN ++++KR
Sbjct: 119 ELKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKR 178

Query: 256 FKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296
              + + + P+V++++K      V  +QP + V+  + +A+
Sbjct: 179 LGAYHDQTEPIVDFYKKTGIWADVDASQPPETVWSAILKAL 219

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score = 94.0 bits (232), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 109/213 (51%), Gaps = 33/213 (15%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQ 174
           + ++G PGAGKGTQ   L + F   HL+ GD+LR++ A++ +  G   KK + DG++V  
Sbjct: 14  MVLIGPPGAGKGTQAPNLTERFCACHLATGDMLRSQVAKQ-TPLGIEAKKIMDDGKLVSD 72

Query: 175 EVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIV----PSTMTLFFDCPEKI 230
           E+ + ++K+ +T+N +   K F++DGFPR + QA   +E +     P    +     +++
Sbjct: 73  EIMINMIKDELTNNQD-CKKGFILDGFPRTIPQAEKLDEMLAQQGRPLEKAVELKIDDEL 131

Query: 231 MLERLLQR--GKTSG-------------------------RIDDNIESIQKRFKTFVETS 263
           ++ R+  R     SG                         R DDN+E+++KR  ++ + +
Sbjct: 132 LVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKKRLTSYHKQT 191

Query: 264 VPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296
            P+V++++K      V  +QP   V+  + + +
Sbjct: 192 EPIVDFYKKTGIWAGVDASQPPKTVWSDILKCL 224

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score = 92.8 bits (229), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 108/217 (49%), Gaps = 33/217 (15%)

Query: 111 DVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGE 170
           + + + ++G PGAGKGTQ  KL + F   HL+ GD+LR++ A++ +  G   KK +  G 
Sbjct: 61  EAIRMVLIGPPGAGKGTQAPKLKEKFCVCHLATGDMLRSQVAKQ-TALGVQAKKIMDQGG 119

Query: 171 IVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIV----PSTMTLFFDC 226
           +V  E+ V ++K+ + SN   +N  F++DGFPR + QA   +E +V    P    +    
Sbjct: 120 LVSDEIMVNMIKDELRSNPECAN-GFILDGFPRTIPQAQKLDEMLVAQGKPLDRAVELKI 178

Query: 227 PEKIMLERLLQR--GKTSG-------------------------RIDDNIESIQKRFKTF 259
            +++++ R+  R     SG                         R DDN ++++KR   +
Sbjct: 179 DDELLVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLDAY 238

Query: 260 VETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296
              + P+V++++K      V  +QP   V+  + +A+
Sbjct: 239 HAQTEPIVDFYKKTGIWAGVDASQPPKTVWSDILKAL 275

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score = 90.5 bits (223), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 107/217 (49%), Gaps = 33/217 (15%)

Query: 107 FSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCI 166
            S  + + + ++G PGAGKGTQ   L + F   HL+ GD+LR++ A+ G+Q G   KK +
Sbjct: 1   MSSSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK-GTQLGLEAKKIM 59

Query: 167 KDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFE----EEIVPSTMTL 222
             G +V  ++ V ++K+ +T+N    N  F++DGFPR + QA   +    E+  P    +
Sbjct: 60  DQGGLVSDDIMVNMIKDELTNNPACKN-GFILDGFPRTIPQAEKLDQMLKEQGTPLEKAI 118

Query: 223 FFDCPEKIMLERLLQR------GKTSGRI---------------------DDNIESIQKR 255
                +++++ R+  R      G++  +I                     DDN ++++KR
Sbjct: 119 ELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKR 178

Query: 256 FKTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHV 292
              +   + P+V++++K      V  +QP   V+  +
Sbjct: 179 LAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADI 215

>Scas_721.82
          Length = 221

 Score = 90.1 bits (222), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 105/213 (49%), Gaps = 33/213 (15%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQ 174
           + ++G PGAGKGTQ   LV+ F   HLS GD+LR++ A+  ++ G+  KK +  G +V  
Sbjct: 8   MVLIGPPGAGKGTQAPNLVEKFHACHLSTGDMLRSQIAKN-TELGQEAKKIMDQGGLVSD 66

Query: 175 EVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIV----PSTMTLFFDCPEKI 230
           E+ V ++K+ +T+N    N  F++DGFPR + QA   ++ +     P    +     + +
Sbjct: 67  EIMVNMIKDELTNNPACKN-GFILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDDL 125

Query: 231 MLERLLQR--GKTSG-------------------------RIDDNIESIQKRFKTFVETS 263
           ++ R+  R     SG                         R DDN ++++KR   +   +
Sbjct: 126 LVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQT 185

Query: 264 VPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296
            P+V++++K      V  +QP   V+  + +++
Sbjct: 186 EPIVDFYKKTGIWSGVDASQPPATVWDEILKSL 218

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score = 85.5 bits (210), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 99/197 (50%), Gaps = 34/197 (17%)

Query: 119 GGPGAGKGTQCAKLVKDFGFVH-LSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVT 177
           G PG+GKGTQ +KL+K+FG +  +S+GDLLR +Q   G+  G      I+ G+++P ++ 
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71

Query: 178 VALLKNAITS-NYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLF----FDCPEKIML 232
             ++ + + S  + + N  +L+DGFPR + QA   ++ ++    +L      D P +++L
Sbjct: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131

Query: 233 ERLLQR--GKTSGRI-------------------------DDNIESIQKRFKTFVETSVP 265
           ER+  R     SGR+                         DD  E   KR + + +T  P
Sbjct: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191

Query: 266 VVEYFEKQNKVVKVSCN 282
           + E++ KQ  +  +S N
Sbjct: 192 LKEHYLKQGILSTISGN 208

>Kwal_27.11607
          Length = 227

 Score = 83.6 bits (205), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 110/219 (50%), Gaps = 45/219 (20%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQ 174
           + ++G PGAGKGTQ   L + F   HL+ GD+LR++ A++ ++ G   KK +  G +V  
Sbjct: 14  MVLIGPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAQK-TELGLEAKKIMDQGGLVSD 72

Query: 175 EVTVALLKNAITSNYNSSNKKFLVDGFPR------KMDQAIT-------------FEEEI 215
           ++ V ++K+ + +N    +  F++DGFPR      K+DQ +T              ++E+
Sbjct: 73  DIMVKMIKHELITNPECKS-GFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIELKIDDEL 131

Query: 216 VPSTMT-------------LFFDCPEKIML-----ERLLQRGKTSGRIDDNIESIQKRFK 257
           + S +T               F+ P+K M      E L+QR       DDN ++++KR  
Sbjct: 132 LVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQRS------DDNADALKKRLG 185

Query: 258 TFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296
            + + + P+V++++K      V  +QP   V+  + + +
Sbjct: 186 AYHQQTEPIVDFYKKTGIWSGVDASQPPKTVWADILKCL 224

>Kwal_56.23489
          Length = 225

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 101/203 (49%), Gaps = 34/203 (16%)

Query: 111 DVLVVFVLGGPGAGKGTQCAKLVKDFGFVH-LSAGDLLRAEQAREGSQYGELIKKCIKDG 169
           + L + +LG PG+GKGTQ +KL+  F ++  +S+GDLLR E  ++ +  G L  + I  G
Sbjct: 2   NALRILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKK-THLGSLASEYISQG 60

Query: 170 EIVPQEVTVALLKNAITS-NYNSSNKKFLVDGFPRKMDQAITFEEEIVPS----TMTLFF 224
           +++P  +   L+ N +T+    SS+  FL+DGFPR +DQA +   ++ P      + +  
Sbjct: 61  KLLPDSLVTELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVEL 120

Query: 225 DCPEKIMLERLLQR--GKTSGRI-------------------------DDNIESIQKRFK 257
           D P  ++LER+  R     SGR+                         DD  E   KR +
Sbjct: 121 DVPSSVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLE 180

Query: 258 TFVETSVPVVEYFEKQNKVVKVS 280
            + +T  P+ +++     + KVS
Sbjct: 181 NYAQTVEPLKQFYADLGILHKVS 203

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 91/193 (47%), Gaps = 34/193 (17%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDF-GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVP 173
           + +LG PGAGKGTQ  +L++ F G   +++GDLLR E A  GS  GE     I  G ++P
Sbjct: 33  LLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLP 91

Query: 174 QE-VTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEE--EIVPSTMTLFFD--CPE 228
              V+ A+L       +      +L+DGFPR + QA   +   E   + +TL  +   PE
Sbjct: 92  DALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEVAVPE 151

Query: 229 KIMLERLLQR--GKTSGRI-------------------------DDNIESIQKRFKTFVE 261
            ++L+R+ +R     SGR+                         DD  E   KR + +  
Sbjct: 152 DVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAA 211

Query: 262 TSVPVVEYFEKQN 274
           T+ P+ E++ +Q 
Sbjct: 212 TAGPLKEHYARQG 224

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 101/213 (47%), Gaps = 33/213 (15%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQ 174
           + ++G PGAGKGTQ   L + F   HL+ GD+LR++ A++ +  G   KK +  G +V  
Sbjct: 15  MVLIGPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAKK-TALGLEAKKIMDQGGLVSD 73

Query: 175 EVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIV----PSTMTLFFDCPEKI 230
           ++ V ++K  + +N    N  F++DGFPR + QA   +E +     P    +     +++
Sbjct: 74  DIMVNMIKEELATNPECKN-GFILDGFPRTIPQAEKLDEMLAEQGKPLERAIELKIDDEL 132

Query: 231 MLERLLQR--GKTSG-------------------------RIDDNIESIQKRFKTFVETS 263
           ++ R+  R     SG                         R DDN ++++KR   + + +
Sbjct: 133 LVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKRLNAYHQQT 192

Query: 264 VPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAI 296
            P+V++++K      V  +Q    V+  + + +
Sbjct: 193 EPIVDFYKKTGIWSGVDASQAPSTVWSDILKCL 225

>Scas_681.18
          Length = 248

 Score = 78.6 bits (192), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 103/209 (49%), Gaps = 36/209 (17%)

Query: 107 FSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVH-LSAGDLLRAEQAREGSQYGELIKKC 165
            SK   + +  LG PG+GKGTQ ++L++    V+ +S+GD+LR E   E ++ G+L  + 
Sbjct: 2   LSKLPSMRLVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQF 60

Query: 166 IKDGEIVPQEVTVALLKNAIT-SNY--NSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTL 222
           I  G+++P ++   LL + +   N+    S   +++DGFPR + QA  F+E +      L
Sbjct: 61  IAQGKLIPDDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNL 120

Query: 223 F----FDCPEKIMLERLLQR--GKTSGRI-------------------------DDNIES 251
                 D P +++LER+  R     SGRI                         DD+  +
Sbjct: 121 NLVVELDVPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAAT 180

Query: 252 IQKRFKTFVETSVPVVEYFEKQNKVVKVS 280
            +KR + + ET  P+ EY++ Q  +  +S
Sbjct: 181 FKKRLQEYHETLGPLKEYYQSQGLLQTIS 209

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score = 75.5 bits (184), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 94/193 (48%), Gaps = 34/193 (17%)

Query: 123 AGKGTQCAKLVKDF-GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEV-TVAL 180
           +GKGTQ +KL+K       +S+GD+LR E  + G++ G L  K I  G+++P +V T  L
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHE-LKSGTELGVLAAKYIAQGKLIPDKVITQVL 77

Query: 181 LKNAITSNYNSSNKKFLVDGFPRKMDQAITFE----EEIVPSTMTLFFDCPEKIMLERLL 236
           + +     + +    +L+DGFPR   QA + +    E      + +  D PE+++LER+ 
Sbjct: 78  IAHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERID 137

Query: 237 QR--GKTSGRI-------------------------DDNIESIQKRFKTFVETSVPVVEY 269
            R     SGR+                         DDN++  +KR K + +T  P+ E+
Sbjct: 138 NRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEH 197

Query: 270 FEKQNKVVKVSCN 282
           + KQ  +  +S +
Sbjct: 198 YAKQGILATISGD 210

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 69.7 bits (169), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 88/187 (47%), Gaps = 34/187 (18%)

Query: 119 GGPGAGKGTQCAKLVKDF-GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVT 177
           G PG+GKGTQ ++L+K       +S+GD+LR E   E S  G      I  G+++P ++ 
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE-STLGREATTYIAQGKLLPDDLI 79

Query: 178 VALLKNAITS-NYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLF----FDCPEKIML 232
             L+   +++  +   +  +L+DGFPR   QA   +E +     +L      D PE  +L
Sbjct: 80  TRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTIL 139

Query: 233 ERLLQR------GKT---------------------SGRIDDNIESIQKRFKTFVETSVP 265
           ER+  R      G+                      + R+DD  E  +KR + + +T+ P
Sbjct: 140 ERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEP 199

Query: 266 VVEYFEK 272
           + +Y++K
Sbjct: 200 LKDYYKK 206

>Sklu_2063.3 YDL166C, Contig c2063 1224-1850
          Length = 208

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 21/138 (15%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDFG-FVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVP 173
           + V G PG GK T C  LV+    + + +  D  R  +  +G  Y E+ K  I D + + 
Sbjct: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDG--YDEVRKSHIVDEDKLL 67

Query: 174 QEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLE 233
            E+   L K     +++ +      D FP ++              + +   C   I+ +
Sbjct: 68  DELEPLLRKGKSIVDWHVN------DVFPERL------------IDLVVVLRCDNSILYD 109

Query: 234 RLLQRGKTSGRIDDNIES 251
           RL +RG    +I++N+++
Sbjct: 110 RLHKRGYHDSKIEENLDA 127

>ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH]
           complement(87745..88404) [660 bp, 219 aa]
          Length = 219

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 61/140 (43%), Gaps = 25/140 (17%)

Query: 115 VFVLGGPGAGKGTQCAKLVK---DFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEI 171
           + V G PG GK T C  L +   D+ + ++S  D  R     +G  Y E  K  I D + 
Sbjct: 10  ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDG--YDEARKSHIVDEDR 65

Query: 172 VPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIM 231
           +  E+   L +     +++ +      D FP ++              + +   C   I+
Sbjct: 66  LLDELEPLLRRGGAIVDWHVN------DIFPERL------------IDLVVVLRCDNAIL 107

Query: 232 LERLLQRGKTSGRIDDNIES 251
            +RL +RG  S +I++NI++
Sbjct: 108 HDRLQKRGYHSSKIEENIDA 127

>KLLA0D12386g complement(1054141..1054776) similar to sp|Q12055
           Saccharomyces cerevisiae YDL166c singleton, start by
           similarity
          Length = 211

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 58/138 (42%), Gaps = 21/138 (15%)

Query: 115 VFVLGGPGAGKGTQCAKLVKDF-GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVP 173
           + V G PG GK T C  L +    + + +  D  +     +G  Y +  K  I D + + 
Sbjct: 10  IIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDG--YDDARKSNIVDDDKLL 67

Query: 174 QEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLE 233
            E+   L K     +++ +      D FP ++              + +   C   I+ +
Sbjct: 68  DELEPLLRKGGCIIDWHVN------DVFPERL------------VDLVVVLRCDNGILYD 109

Query: 234 RLLQRGKTSGRIDDNIES 251
           RL +RG  + +I++N+++
Sbjct: 110 RLNKRGYHNAKIEENMDA 127

>YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential
           protein important for Skn7p-dependent transcription of
           target genes during oxidative stress [594 bp, 197 aa]
          Length = 197

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 57/140 (40%), Gaps = 25/140 (17%)

Query: 115 VFVLGGPGAGKGTQCAKL---VKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEI 171
           + V G PG GK + C  L   +KD+ + ++S  D  +     EG   G       +   I
Sbjct: 10  IIVTGTPGCGKSSTCEFLKNKLKDYKYYNIS--DFAKDNDCFEGYDEG-------RKSHI 60

Query: 172 VPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIM 231
           V ++  + +L+  +    NS     + D FP ++              + +   C    +
Sbjct: 61  VDEDKLLDMLEPLLRQG-NSIVDWHVNDVFPERL------------IDLVVVLRCDNSNL 107

Query: 232 LERLLQRGKTSGRIDDNIES 251
             RL  RG    +I++N+++
Sbjct: 108 YSRLHARGYHDSKIEENLDA 127

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 174 QEVTVALLKNAITSNYNSSNKKFLVDG 200
           +E  + +LKN +  NYNSSN+K L+D 
Sbjct: 585 KEFKLEILKNIVNYNYNSSNQKILLDS 611

>ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)
           [666 bp, 221 aa]
          Length = 221

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 48/124 (38%), Gaps = 20/124 (16%)

Query: 101 KKKTPAFSKDDVLVVFVLG--------GPGAGKGTQCAKLVKDFGF-VHLSAGDLLRAEQ 151
           +++   F  D++ V+ VL          P   +  +  + ++ F    H     LL    
Sbjct: 79  RRRVTVFKPDELEVLAVLADVPVEKIRAPAGARAVRVQQALERFRTDEHDKYHALLEELH 138

Query: 152 AREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITF 211
           A  G  Y   +          P+   VAL+   +     + +   L+ GFPR M +AI F
Sbjct: 139 AVHGDDYSAHL----------PKGALVALMGRYLKEVCQAGDSVVLL-GFPRNMQEAIQF 187

Query: 212 EEEI 215
           E E+
Sbjct: 188 ESEV 191

>KLLA0D12012g 1024590..1026203 similar to sgd|S0005951 Saccharomyces
           cerevisiae YPL030w, hypothetical start
          Length = 537

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 5/52 (9%)

Query: 122 GAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVP 173
           G G G  C  L+++ GF  L     + A Q +  S Y   +K+C+K+  I+P
Sbjct: 299 GCGNGVLCYILIQE-GFKGLG----IDARQRKSWSIYPAEVKRCLKEQVIIP 345

>Scas_617.7
          Length = 420

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 32/64 (50%)

Query: 138 FVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFL 197
           F H+  G L +AE  +      + I+K  K+  ++  E+T+ +  N      +++ K F+
Sbjct: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297

Query: 198 VDGF 201
            +GF
Sbjct: 298 EEGF 301

>Scas_680.1
          Length = 227

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 156 SQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEI 215
           +QYGE   K   D   +P  +   LL   I    NS  KK +V  FP+ ++ AI FE EI
Sbjct: 144 NQYGE---KSYVDN--LPAGMQSMLLGRYIKEVLNSP-KKVIVVNFPKNIEDAIKFESEI 197

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,336,049
Number of extensions: 335559
Number of successful extensions: 1204
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1176
Number of HSP's successfully gapped: 39
Length of query: 298
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 197
Effective length of database: 13,099,691
Effective search space: 2580639127
Effective search space used: 2580639127
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)