Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E08008g40840214520.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08008g
         (402 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08008g complement(722953..724179) no similarity, hypotheti...   563   0.0  

>KLLA0E08008g complement(722953..724179) no similarity, hypothetical
           start
          Length = 408

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/402 (73%), Positives = 295/402 (73%)

Query: 1   MDLFTESSLLDFLLEENTVSEVGLVEEVPHCLVHLPTFSNVGPKTTTANTCKVPXXXXXX 60
           MDLFTESSLLDFLLEENTVSEVGLVEEVPHCLVHLPTFSNVGPKTTTANTCKVP      
Sbjct: 1   MDLFTESSLLDFLLEENTVSEVGLVEEVPHCLVHLPTFSNVGPKTTTANTCKVPSAKKSK 60

Query: 61  XXXXXXQFGELWEDDIARILESSLSIGGKNKTPAKVVPEKAXXXXXXXXXXXXXXXXXXX 120
                 QFGELWEDDIARILESSLSIGGKNKTPAKVVPEKA                   
Sbjct: 61  ALKKELQFGELWEDDIARILESSLSIGGKNKTPAKVVPEKASKQETKSKKRGKSKAKEKS 120

Query: 121 DRKLRSNEPLPNLRAGIAQSTGLLXXXXXXXXXXXXXHYTRNADSLAIDESEHNSTRSSK 180
           DRKLRSNEPLPNLRAGIAQSTGLL             HYTRNADSLAIDESEHNSTRSSK
Sbjct: 121 DRKLRSNEPLPNLRAGIAQSTGLLESGIFSSSTISESHYTRNADSLAIDESEHNSTRSSK 180

Query: 181 LARKQKSNLRTMQSSTTDEDENNVKNDLRSTINXXXXXXXXXXXXXXXXXXXSGETKAGS 240
           LARKQKSNLRTMQSSTTDEDENNVKNDLRSTIN                   SGETKAGS
Sbjct: 181 LARKQKSNLRTMQSSTTDEDENNVKNDLRSTINQRKKQRKEKREQRRVAKEASGETKAGS 240

Query: 241 EETDENFPETPGSSGKLSPKDSKNQGSKRMKELIKKELQINKSKESLKELQRAINDHPTT 300
           EETDENFPETPGSSGKLSPKDSKNQGSKRMKELIKKELQINKSKESLKELQRAINDHPTT
Sbjct: 241 EETDENFPETPGSSGKLSPKDSKNQGSKRMKELIKKELQINKSKESLKELQRAINDHPTT 300

Query: 301 EANTSDFTKTLCNKTEKEGFELLRGSEXXXXXXXXXXXXXXXXXXXXXXXXXXHQDSDLA 360
           EANTSDFTKTLCNKTEKEGFELLRGSE                          HQDSDLA
Sbjct: 301 EANTSDFTKTLCNKTEKEGFELLRGSEKVVVPKANSKSKSKSKDKLKNKPKASHQDSDLA 360

Query: 361 APENAIESGKSLDSKEPEXXXXXXXXXXXXXXXXXXNIESKD 402
           APENAIESGKSLDSKEPE                  NIESKD
Sbjct: 361 APENAIESGKSLDSKEPERKGRSTGGKKRKSKSHRKNIESKD 402

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.123    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,786,480
Number of extensions: 341593
Number of successful extensions: 1344
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1341
Number of HSP's successfully gapped: 26
Length of query: 402
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 298
Effective length of database: 12,995,837
Effective search space: 3872759426
Effective search space used: 3872759426
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)