Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0E07986g72171038590.0
ACR168W70771021090.0
Sklu_2380.677471621080.0
Kwal_14.87472272120560.0
Scas_685.1076070618000.0
YKL022C (CDC16)84077517350.0
CAGL0L09823g74358215530.0
Scas_599.58092451463e-09
YHR166C (CDC23)6262541311e-07
CAGL0I02288g6392201283e-07
ABR206W6822991283e-07
KLLA0A05258g6321731274e-07
YBR112C (SSN6)9662211267e-07
KLLA0B09262g9412211241e-06
Scas_680.356312051231e-06
Kwal_23.36708022151213e-06
Scas_705.559072101213e-06
CAGL0C01903g7692721203e-06
ADL344W9101961195e-06
Kwal_27.107406282671151e-05
AGL294W6562571113e-05
KLLA0C15455g5661971042e-04
CAGL0D01364g11482091033e-04
KLLA0E20933g7102271024e-04
YBL084C (CDC27)758226980.001
CAGL0K11209g590197970.001
Kwal_56.24750619173950.003
Scas_631.41398115940.004
Sklu_2239.3284164870.017
AEL281C1390153850.043
Kwal_23.5408141065850.046
CAGL0E01573g90459810.13
CAGL0G10087g1411181810.15
Scas_721.6457847790.21
Kwal_55.221521101152790.22
ADL177C90565790.24
Scas_718.37d60149780.27
KLLA0B03520g140184780.33
YDR244W (PEX5)61262770.43
Kwal_55.2203990465770.44
ABR131W594106760.49
CAGL0H10098g86186760.55
Sklu_2077.432368750.59
YOR007C (SGT2)34664740.81
CAGL0J09570g54951740.86
CAGL0M01914g67642740.97
Sklu_1876.21090126741.0
KLLA0E01914g1073123741.0
KLLA0F13046g1379108731.1
AFR453W56962721.5
Kwal_47.18684809214721.7
Kwal_33.1528128767701.8
Kwal_27.1173757563711.8
KLLA0D01155g33567702.5
ACR005W327116692.6
Scas_585.491861702.7
CAGL0A03630g106261702.8
KLLA0F04191g88587693.4
KLLA0E07227g89695693.6
AGR398W1057121694.0
YNL313C90466684.4
Scas_706.4762047684.4
KLLA0D06402g63143684.4
Kwal_56.23065907115685.2
YPR189W (SKI3)1432120685.2
Scas_718.84237444676.0
Kwal_33.14767594226659.0
CAGL0L03608g822149659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E07986g
         (710 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces c...  1491   0.0  
ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH] complement...   816   0.0  
Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement      816   0.0  
Kwal_14.874                                                           796   0.0  
Scas_685.10                                                           697   0.0  
YKL022C (CDC16) [3233] chr11 complement(394369..396891) Componen...   672   0.0  
CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...   602   0.0  
Scas_599.5                                                             61   3e-09
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    55   1e-07
CAGL0I02288g complement(203605..205524) similar to sp|P16522 Sac...    54   3e-07
ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH] complement(...    54   3e-07
KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces c...    54   4e-07
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    53   7e-07
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    52   1e-06
Scas_680.35                                                            52   1e-06
Kwal_23.3670                                                           51   3e-06
Scas_705.55                                                            51   3e-06
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    51   3e-06
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    50   5e-06
Kwal_27.10740                                                          49   1e-05
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    47   3e-05
KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces...    45   2e-04
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    44   3e-04
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    44   4e-04
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    42   0.001
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...    42   0.001
Kwal_56.24750                                                          41   0.003
Scas_631.4                                                             41   0.004
Sklu_2239.3 YJR088C, Contig c2239 5120-5974                            38   0.017
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    37   0.043
Kwal_23.5408                                                           37   0.046
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    36   0.13 
CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces c...    36   0.15 
Scas_721.64                                                            35   0.21 
Kwal_55.22152                                                          35   0.22 
ADL177C [1564] [Homologous to ScYNL313C - SH] (383369..386086) [...    35   0.24 
Scas_718.37d                                                           35   0.27 
KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces c...    35   0.33 
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...    34   0.43 
Kwal_55.22039                                                          34   0.44 
ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W (...    34   0.49 
CAGL0H10098g complement(984334..986919) similar to sp|P19735 Sac...    34   0.55 
Sklu_2077.4 YOR007C, Contig c2077 4462-5433 reverse complement         33   0.59 
YOR007C (SGT2) [4822] chr15 complement(338938..339978) Protein c...    33   0.81 
CAGL0J09570g complement(939447..941096) some similarities with s...    33   0.86 
CAGL0M01914g 232780..234810 some similarities with sp|P14922 Sac...    33   0.97 
Sklu_1876.2 YOL145C, Contig c1876 732-4004                             33   1.0  
KLLA0E01914g complement(180022..183243) similar to sp|P89105 Sac...    33   1.0  
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    33   1.1  
AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH] complement(...    32   1.5  
Kwal_47.18684                                                          32   1.7  
Kwal_33.15281                                                          32   1.8  
Kwal_27.11737                                                          32   1.8  
KLLA0D01155g complement(104847..105854) similar to sgd|S0005533 ...    32   2.5  
ACR005W [1053] [Homologous to ScYOR007C (SGT2) - SH] complement(...    31   2.6  
Scas_585.4                                                             32   2.7  
CAGL0A03630g complement(364712..367900) similar to sp|P33339 Sac...    32   2.8  
KLLA0F04191g 397611..400268 weakly similar to sp|P19735 Saccharo...    31   3.4  
KLLA0E07227g complement(655635..658325) similar to sp|P42842 Sac...    31   3.6  
AGR398W [4709] [Homologous to ScYOL145C (CTR9) - SH] complement(...    31   4.0  
YNL313C (YNL313C) [4300] chr14 complement(45307..48021) Protein ...    31   4.4  
Scas_706.47                                                            31   4.4  
KLLA0D06402g 547385..549280 weakly similar to sp|P40358 Saccharo...    31   4.4  
Kwal_56.23065                                                          31   5.2  
YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein w...    31   5.2  
Scas_718.84                                                            30   6.0  
Kwal_33.14767                                                          30   9.0  
CAGL0L03608g complement(412378..414846) some similarities with s...    30   9.9  

>KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces
           cerevisiae YKL022c CDC16 subunit of anaphase-promoting
           complex (cyclosome) singleton, start by similarity
          Length = 721

 Score = 1491 bits (3859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/710 (100%), Positives = 710/710 (100%)

Query: 1   MSSSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPH 60
           MSSSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPH
Sbjct: 1   MSSSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPH 60

Query: 61  QDRSPLVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTDTV 120
           QDRSPLVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTDTV
Sbjct: 61  QDRSPLVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTDTV 120

Query: 121 ELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDP 180
           ELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDP
Sbjct: 121 ELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDP 180

Query: 181 NDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTN 240
           NDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTN
Sbjct: 181 NDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTN 240

Query: 241 PFQSEPSSPGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYL 300
           PFQSEPSSPGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYL
Sbjct: 241 PFQSEPSSPGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYL 300

Query: 301 LSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYL 360
           LSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYL
Sbjct: 301 LSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYL 360

Query: 361 KDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLL 420
           KDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLL
Sbjct: 361 KDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLL 420

Query: 421 SHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEG 480
           SHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEG
Sbjct: 421 SHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEG 480

Query: 481 EHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNEL 540
           EHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNEL
Sbjct: 481 EHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNEL 540

Query: 541 GVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKT 600
           GVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKT
Sbjct: 541 GVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKT 600

Query: 601 VLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAHMI 660
           VLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAHMI
Sbjct: 601 VLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAHMI 660

Query: 661 IDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQGIS 710
           IDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQGIS
Sbjct: 661 IDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQGIS 710

>ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH]
           complement(650615..652738) [2124 bp, 707 aa]
          Length = 707

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/710 (56%), Positives = 517/710 (72%), Gaps = 21/710 (2%)

Query: 3   SSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPHQD 62
           S+ +TPS  +STLAISP V   G  R    +   +  S G +  G          TP   
Sbjct: 2   STGNTPSQHESTLAISPFVTNRG--RSQQEQRRVMMPSTGEDSLGPSGMADSGTHTPRNS 59

Query: 63  --RSPLVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTDTV 120
              SPLVQK    + L TP +    G A   LL SM+K  LFGPA+PSTLRK S   +  
Sbjct: 60  VVHSPLVQK----TQLGTPYMAE--GAATGGLLGSMSKTALFGPAVPSTLRKVSNVREYR 113

Query: 121 ELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDP 180
              +S  +    +      D+++LS+ EKLRLWRHDALMQHHY+TAE+IGD +YSMT+DP
Sbjct: 114 RPGDSDGEGGEGYG----VDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDP 169

Query: 181 NDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTN 240
           NDAFWLAQVYYN G Y+RAVEL+  D LD+ S+MCRYL ALCL K+ K ++ALDI+G+ N
Sbjct: 170 NDAFWLAQVYYNMGQYIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVN 229

Query: 241 PFQSEPSS-PGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDY 299
           PF+ + +    N DGG+KLESS+C LRG IY + +N++ AKECFKEAV VDVKN+EAFD 
Sbjct: 230 PFKDDSAEHVRNLDGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDR 289

Query: 300 LLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYY 359
           L+S +MLT  E+ + +  L F DLDDN+E++RCLY ++LSKY   T+++ A + L D+Y+
Sbjct: 290 LISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYH 349

Query: 360 LKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFL 419
           L+DN+ V   EIELL  Q K+ +C++LCE+VLE DE+N +VLP Y+QCL+    KNKLFL
Sbjct: 350 LEDNKDVQTTEIELLIFQGKYLECLELCEKVLEQDEFNFDVLPTYVQCLYELGGKNKLFL 409

Query: 420 LSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAE 479
           +SHKLAE+FPKS VTWFAV TYY  +  ++EARKYFS++S++DP+FGY+WLGFAHTY  E
Sbjct: 410 VSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVE 469

Query: 480 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNE 539
           GEHEQALSAYSTAARFFPGTHLPHLYLGMQY+RMD L+LAEEYFMMAYD+CPTDPLLLNE
Sbjct: 470 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNE 529

Query: 540 LGVIYFKRQNYIKAKKYMKRAHDAIKNMKSE-SKAWISIVINLGHTYRKLGEDERAIKCF 598
           LGV+YFK+ +Y +AKK+ KRA +AI   +S+ S   IS  +NLGHTYRKL EDERA+ CF
Sbjct: 530 LGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCF 589

Query: 599 KTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAH 658
           KTVLE  KP+A +WC+L  +YL+MKK++KAID+ H  LA++  +Q   +LLK AL++N H
Sbjct: 590 KTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVH 649

Query: 659 MIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQG 708
           + +D  HP+++S+ I       +S NDKKR SLG  + DPV  AKRLKQG
Sbjct: 650 LPLDNGHPLMVSAKISE--NMKMSSNDKKR-SLG--NIDPVVIAKRLKQG 694

>Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement
          Length = 774

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/716 (56%), Positives = 528/716 (73%), Gaps = 22/716 (3%)

Query: 3   SSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPHQ- 61
           S+ +TPS   STLAISPLV +  +  G   +N    + Q R   G  S     AQTPH  
Sbjct: 55  STGNTPSQHNSTLAISPLVTKRTSLHG--QKNSQQQHQQLRRWCGATST----AQTPHHP 108

Query: 62  -DRSPLVQKIRDVSHLATPAVMRHNG-TAGSSLLASMTKNGLFGPALPSTLRKTSTS--- 116
              SPL+QKI++ + LATPA    +G TAG  LLASM+K+GLFGPA+PSTLRK S +   
Sbjct: 109 VTNSPLIQKIQNPTSLATPAPPAGDGSTAG--LLASMSKSGLFGPAVPSTLRKISVTRSF 166

Query: 117 ---TDTVELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLI 173
              T   + +NS  D++++  S    D+S LS  EKLRLWRHDALMQHHY+TAE+IGD +
Sbjct: 167 DGQTSAKDDSNSELDDNLEVISGATIDISTLSPAEKLRLWRHDALMQHHYRTAEYIGDKV 226

Query: 174 YSMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEAL 233
           YS+T+DPNDAFWLAQVYYN GSY+RAVEL+  D LD+ S+MCRYL ALCL K+ K ++AL
Sbjct: 227 YSITRDPNDAFWLAQVYYNNGSYIRAVELLSRDGLDTSSVMCRYLTALCLIKMEKYDDAL 286

Query: 234 DIIGDTNPFQSEPSS-PGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVK 292
           DI+G++NPF+   +    N DGG+KLESS+C LRG+IY + +N E+AK+ FKEAVQVDVK
Sbjct: 287 DIVGESNPFKDVSAQHVKNQDGGIKLESSLCYLRGKIYSAQNNFEKAKQSFKEAVQVDVK 346

Query: 293 NYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARK 352
           N+EAFD L+S ++LT  ++W+ + +L F DLDDNEE+++ LY ++LSKY +  +I  AR+
Sbjct: 347 NFEAFDELISNNLLTPNQEWEFLSTLDFSDLDDNEELIKSLYTTKLSKYLNLDQISEARE 406

Query: 353 VLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFA 412
            L ++Y L+DN  ++ +EI+    Q KF++C+ LCEQVLE DE+N  VLP YI CL+   
Sbjct: 407 YLINEYNLEDNTDLIRSEIDTFFTQCKFSKCLCLCEQVLERDEFNFYVLPTYIACLYELG 466

Query: 413 AKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGF 472
            KNKLFL+SHKLAENFPKSPVTW  V TYYL + KV+EARKYFS++SI+DP+FG +W+GF
Sbjct: 467 GKNKLFLVSHKLAENFPKSPVTWLGVGTYYLSINKVAEARKYFSKASILDPNFGQAWIGF 526

Query: 473 AHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPT 532
           AHTY AEGEHEQA+SAYSTA+RFFPGTHLP+L+LGMQY  M+ LSLAEEY  +AYD+CP 
Sbjct: 527 AHTYAAEGEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIVMNTLSLAEEYLTLAYDICPH 586

Query: 533 DPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDE 592
           DPLLLNE+GVIYFK+ +Y KAKKY K+A +A K + S+SKAW+SI  NLGHTYRK+G+ E
Sbjct: 587 DPLLLNEMGVIYFKKSDYPKAKKYFKKAWEASKRLNSDSKAWLSIHTNLGHTYRKMGDYE 646

Query: 593 RAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTA 652
           RA+ CFK VLE+S    +++C++G +YL+++KIEKAIDS H ALAL   NQ +  LLK A
Sbjct: 647 RAVACFKIVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPSNQIAQDLLKQA 706

Query: 653 LEINAHMIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQG 708
           LE+N   ++DE HP+V+SS I N   S+   N KKR    + +      AKRL QG
Sbjct: 707 LEVNMCTVLDETHPLVVSSKI-NESASNYFPNSKKR---DLVNQSAAKIAKRLIQG 758

>Kwal_14.874
          Length = 722

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/721 (55%), Positives = 520/721 (72%), Gaps = 30/721 (4%)

Query: 3   SSHDTPSHVQSTLAISPLV-QRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQIAQTPHQ 61
           S  +TPS   STLAISPLV  RT   +G  +RN     S  R   G      + AQTPH 
Sbjct: 2   SRGNTPSQHNSTLAISPLVGSRT--LQGPQHRNQ-TNASSTRQWSGEH----RTAQTPHH 54

Query: 62  D--RSPLVQKIRDVSHLATPA-VMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTD 118
               SPLVQKI++ + LATPA V  H  TAG  LLASMTKNGLFGP +PSTLRK S   D
Sbjct: 55  SVTYSPLVQKIQNNASLATPAPVQDHGSTAG--LLASMTKNGLFGPQIPSTLRKVSIVGD 112

Query: 119 TVELNNSTN-------DEDIDHASDNVF---DVSDLSSVEKLRLWRHDALMQHHYKTAEH 168
           +     S++       D +    SD+V    D++ L + EKLRLWRHD+LMQH Y+TAE 
Sbjct: 113 SRRHPGSSSGAGGDITDPNAQLDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEF 172

Query: 169 IGDLIYSMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNK 228
           +GD +Y+MT DPNDAFWLAQVYYN GSY+RAVEL+  + LD+ S+MCRYL ALCL +L K
Sbjct: 173 LGDKVYAMTGDPNDAFWLAQVYYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKK 232

Query: 229 LEEALDIIGDTNPFQSEPSS-PGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAV 287
            E+ALDI+G+TNPF+    S   N DGG+KLESSMC LRG+I+ +L++ ++AK+  KEAV
Sbjct: 233 YEDALDIVGETNPFRDPLGSHVKNQDGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAV 292

Query: 288 QVDVKNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEI 347
            VDVKN+EAFD L+SK++LT +E+W  + SL F DLDDNE+++R LY+SRLSKY +  ++
Sbjct: 293 LVDVKNFEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQV 352

Query: 348 EHARKVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQC 407
             A   L+++Y L  N  ++ ++ + L  Q KF+ C+KLCE+ LE DE+N  +LPI+I C
Sbjct: 353 FKAHDFLNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISC 412

Query: 408 LHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGY 467
           L+    KNKLFL+SHK+AENFPK P+TWF V  YY+C  KV+EARKYFS++SI+DPSF  
Sbjct: 413 LYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQ 472

Query: 468 SWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAY 527
           +W+GFAHTY  EGEHEQA+SAYSTA+RFFPGTHLP+L+LGMQY  M  L LAEEYF++AY
Sbjct: 473 AWIGFAHTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAY 532

Query: 528 DMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRK 587
           D+CP DPLLLNE+GV+YFK+ +Y KAKKY+K+A +AIK + SESK+W+SI  NL HTYRK
Sbjct: 533 DVCPYDPLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRK 592

Query: 588 LGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNK 647
           LGE+E+A+ CFK VLE++       C+LG++YLRM +IEKAID+ H ALAL   NQA+  
Sbjct: 593 LGENEKAVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQD 652

Query: 648 LLKTALEINAHMIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLKQ 707
           LLK AL++N   I+D++HP+VISS +Q+  +  VS   +KR +      D    AKRLK 
Sbjct: 653 LLKQALDVNMSTILDDSHPLVISSKLQDQNSDVVS---RKRAA---NRVDVRDIAKRLKH 706

Query: 708 G 708
           G
Sbjct: 707 G 707

>Scas_685.10
          Length = 760

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/706 (49%), Positives = 484/706 (68%), Gaps = 34/706 (4%)

Query: 2   SSSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRNVEGGRSNIPQ----IAQ 57
           +S + TPS   ST+AISP V     +R   +R  P  N+Q  N    + N         Q
Sbjct: 5   TSPNQTPSQHNSTIAISPFVGNRTRSRLPTHRIHPATNAQRENPLSNQLNQSWNRTVSGQ 64

Query: 58  TPHQD--RSPLVQKIRD---VSHLATP-------AVMRHNGTAGSSLLASMTKNGLFGPA 105
           +P++    SPLVQK       + L TP            N    SSLLAS++K  +FG  
Sbjct: 65  SPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPTNLNANPNSSLLASLSKGNVFGST 124

Query: 106 LPSTLRKTSTSTDTVELNNSTNDEDIDHASDNV---------------FDVSDLSSVEKL 150
           + S+LRK S   ++     +T DE++ +  +                  D+S+L+S+E+L
Sbjct: 125 ISSSLRKVSIQPNSNIPETNTKDENMSNEINKATTTTLTTNTTIVSPEIDLSELTSIERL 184

Query: 151 RLWRHDALMQHHYKTAEHIGDLIYSMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLDS 210
           RLWRHDALMQH Y+TAE+IG+ IY++T+DPNDAFWLAQVYYN   ++RA++L+  D L+S
Sbjct: 185 RLWRHDALMQHMYRTAEYIGNKIYTITEDPNDAFWLAQVYYNNNEFIRAIDLLTKDNLES 244

Query: 211 ESIMCRYLAALCLFKLNKLEEALDIIGDTNPFQ--SEPSSPGNA-DGGVKLESSMCLLRG 267
            +I+CRYL  LCLFKL + ++ALD++ + NPF    + S P  A DGG+K+ESS+C LRG
Sbjct: 245 LNIICRYLMGLCLFKLQRYDDALDVVDELNPFSDSKQDSDPTIAPDGGIKVESSLCYLRG 304

Query: 268 RIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNE 327
            I+ + +N+++AK  FKEAV VDVKNYEAF+ L+SK++++  E+WDL+ SL F  L DNE
Sbjct: 305 LIFAAQNNLKKAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDNE 364

Query: 328 EMMRCLYISRLSKYQHQTEIEHARKVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLC 387
           EM+R LY   +SKY HQ   + A++ LSD+Y L +N  +L  +IE L +Q KF++C++ C
Sbjct: 365 EMIRYLYTLNVSKYIHQDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEAC 424

Query: 388 EQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGK 447
           E+ L+ DEYN  +LP YI CL+    KNKLFLLSH LAE FPKS +TWF+VATYY+ +  
Sbjct: 425 EKALDGDEYNPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIED 484

Query: 448 VSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLG 507
           V +ARKYFS++SI+DPSF  +WLGFAHTY  EGEH+QALSAY+TAARFFPG H+P+L+LG
Sbjct: 485 VPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLG 544

Query: 508 MQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNM 567
           M+Y   + LSLAEEYF +AYD C  DPLLLNE+GV+YFK+    K+K+Y+K+A +A++N 
Sbjct: 545 MEYMATNTLSLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNS 604

Query: 568 KSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEK 627
              S   ISI +NL HTYRKLGE ERAIKCFK VLE +   A ++C+LGFLYL+ K++ K
Sbjct: 605 SGTSTIVISIQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGK 664

Query: 628 AIDSFHKALALDQGNQASNKLLKTALEINAHMIIDENHPMVISSNI 673
           AID  H++LAL   N ++ +LL  ALE+NA +++DENHP+V+++ +
Sbjct: 665 AIDYLHESLALKPSNTSAQELLLHALELNASIVLDENHPLVMNAEL 710

>YKL022C (CDC16) [3233] chr11 complement(394369..396891) Component
           of anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2523 bp, 840 aa]
          Length = 840

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/775 (45%), Positives = 500/775 (64%), Gaps = 84/775 (10%)

Query: 1   MSSSHDTPSHVQSTLAISPLVQRTGANRGSMN-----RNDPIGNSQGRNVEGGRSNIPQI 55
           MS S     H  STLA SP V    A R   +     +ND +     R            
Sbjct: 43  MSPSEQHSQH-NSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRT---------NT 92

Query: 56  AQTPHQD--RSPLVQKIRDVSHLATP-----------AVMRHNGTAGSSLLASMTKNGLF 102
           A +P+Q    SPL+QK++  +++ TP             +  N    ++LLASM+KN +F
Sbjct: 93  ATSPYQSLANSPLIQKLQ--ANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNSMF 150

Query: 103 GPALPSTLRKTSTS---TDTVE--LNNSTNDEDIDHASDNV------------------- 138
           G  +PSTLRK S      D+V+  + +  NDED+ +  D                     
Sbjct: 151 GSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTT 210

Query: 139 -----------FDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDPNDAFWLA 187
                       DVS+LS++E+LRLWR DALMQH Y+TAE+I D +Y+++ DP+DAFWL 
Sbjct: 211 TTLTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLG 270

Query: 188 QVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTNPFQSEPS 247
           QVYYN   YVRAVELI  + LD  +I+CRYL  L   KL + ++ALD+IG+ NPF  +PS
Sbjct: 271 QVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPS 330

Query: 248 SPGN----------------ADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDV 291
           +                    DGG+K+ESS+C LRG+IY + +N  +A++ F+EA+ VD+
Sbjct: 331 TTAANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDI 390

Query: 292 KNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHAR 351
           KN+EAF+ LLSK++LT  E+WDL  SL F +  +++E+M+ LY   LSKY +  +I  + 
Sbjct: 391 KNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSN 450

Query: 352 KVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSF 411
           ++L+  Y L DN  V+ +++++   Q KF +C++LCE VLE DE+N  +LP YI CL+  
Sbjct: 451 EILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYEL 510

Query: 412 AAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLG 471
           + KNKLFLLSH+LAE FPKS +TWF+VATYY+ + ++SEA+KY+S+SSI+DPSF  +WLG
Sbjct: 511 SNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLG 570

Query: 472 FAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCP 531
           FAHTY  EGE +QAL+AYSTA+RFFPG HLP L+LGMQ+  M+ L+LAE YF++AYD+CP
Sbjct: 571 FAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICP 630

Query: 532 TDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGED 591
            DPL+LNE+GV+YFK+  ++KAKKY+K+A + +K++   S+  ISI +NLGHTYRKL E+
Sbjct: 631 NDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNEN 690

Query: 592 ERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKT 651
           E AIKCF+ VLE +   + + CSLG+LYL+ KK++KAID  HK+L L   N ++  LLK 
Sbjct: 691 EIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKN 750

Query: 652 ALEINAHMIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLK 706
           ALE+N  + +D +HP++  SN+ +  +   +  +KKR+SL   ++DPV  AKRL+
Sbjct: 751 ALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSL---TYDPVNMAKRLR 802

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/582 (48%), Positives = 409/582 (70%), Gaps = 16/582 (2%)

Query: 137 NVFDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDPNDAFWLAQVYYNQGSY 196
           N  D++ +  +E+L+LWRHDA +QH Y TAE +   IY+MT D NDAFWLA +YY+ GS+
Sbjct: 158 NEIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSH 217

Query: 197 VRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTNPF--QSEPSSPGNADG 254
            R +EL+  D + S SI+CRYL A C   +   ++ALDI+G+TNPF   +E S+   +DG
Sbjct: 218 NRCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIESDG 277

Query: 255 GVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYLLSKHMLTTAEQWDL 314
           G+KLESSMC LRG+IYV+ ++  +AKE FKEAV VD KN+EA+  L+  H+LTT E+W+L
Sbjct: 278 GIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEEWEL 337

Query: 315 VRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYLKDNRTVLLAEIELL 374
           + SL FD L D+  +++ LY   LSK Q+Q  I  A+ +L   Y L D+  ++ ++I++L
Sbjct: 338 LDSLDFDSLGDDSILVKSLYTLELSKNQNQDRITEAQDILRQDYDLADDIDIVTSDIDIL 397

Query: 375 NNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVT 434
            NQ KF+QC+ +CE +L+ D++N ++LP YI CL+   + NKLFLL+H+LAE  P++ +T
Sbjct: 398 FNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEKDPRNCIT 457

Query: 435 WFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAAR 494
           W+ VATYY+ + ++ EARKYFS+SSIMDP+F  +WLGFAHT+  EGE +QA+SAYSTAAR
Sbjct: 458 WYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQAISAYSTAAR 517

Query: 495 FFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAK 554
           FFPG  LP+L+LGMQY   + L+LAEEYF +AY+  P DP++LNE+GV+ FK+    KAK
Sbjct: 518 FFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAK 577

Query: 555 KYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCS 614
           +Y+K+A +  K+M+  SK  +S+ INL HTYR+LGE+E+AIK    +LE ++ ++ ++CS
Sbjct: 578 RYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCS 637

Query: 615 LGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALEINAHMIIDENHPMVISSNI- 673
           LGFLYL+  +++KAID+ H+ LA++ GN ++ KLL  ALE+N  + +DENHP+V++SNI 
Sbjct: 638 LGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLELDENHPLVVNSNIL 697

Query: 674 -------------QNIPTSHVSKNDKKRTSLGITSFDPVTEA 702
                        Q   + +V K   K   L   S  P  EA
Sbjct: 698 DEEHSASKIGKRRQPFESINVDKKRNKAGQLTEQSLSPAGEA 739

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 64  SPLVQKIRDVSHLATP----AVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTS 114
           SPLVQK    S LATP         N     SLLASM+KN + G  +PSTLRK S
Sbjct: 30  SPLVQKYAGAS-LATPRKHLGASNSNNGNNGSLLASMSKNSMLGSTIPSTLRKVS 83

>Scas_599.5
          Length = 809

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 108/245 (44%), Gaps = 14/245 (5%)

Query: 402 PIYIQCLHSFAA-------KNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKY 454
           P  I+ L +F+        K  L  LS+ L + F   P TW AV   +       EA + 
Sbjct: 553 PTRIKDLETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSLQKDHDEAIRA 612

Query: 455 FSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMD 514
           F +++ +DP+F Y++    H Y++   ++ A + Y  A       +  +  +GM   ++ 
Sbjct: 613 FDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLG 672

Query: 515 DLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAW 574
           +   A  YF  A  + P++ +L+   GV   K  N  KA  Y + A   I+   S +K  
Sbjct: 673 EYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQ-IQPTSSLAK-- 729

Query: 575 ISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHK 634
                   H    + +  +A+  F+ +++ +   AT+   LG LY  M + + AI  +  
Sbjct: 730 ----FKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKDAIKRYTI 785

Query: 635 ALALD 639
           A+ LD
Sbjct: 786 AMNLD 790

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 15/110 (13%)

Query: 534 PLLLNELGVIYFKRQNYIKAKKYMKRAH----DAIKNMKSESKAWISIVINLGHTYRKLG 589
           P    +LG ++F+  NY  + KY K+        IK++++ S         L H + K  
Sbjct: 522 PWCQAQLGKLHFEIVNYKTSLKYFKKLRLLQPTRIKDLETFSTL-------LWHLHDKTN 574

Query: 590 EDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
             + +      +++  +     WC++G L+   K  ++AI +F KA  LD
Sbjct: 575 LTDLS----NILMDEFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLD 620

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 103/254 (40%), Gaps = 13/254 (5%)

Query: 346 EIEHARKVLSDKYYLKD-NRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIY 404
           ++E   +V  +  +LK  N T+    ++ +  +S+F       + +++ D Y L  L  Y
Sbjct: 317 DLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRF-------DDIVKQDPYRLNDLETY 369

Query: 405 IQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPS 464
              L+     +KL  L+  +++     P T   +A YY    +  ++  YF R+  +D  
Sbjct: 370 SNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYFRRALTLDKK 429

Query: 465 FGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFM 524
              +W    H +V       A+  Y  A    P        LG  Y  +D    +  YF 
Sbjct: 430 TTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQ 489

Query: 525 MAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHT 584
            A  + P D  +   LG  Y K  N ++A K  KR+  A + +   +    SI   L   
Sbjct: 490 KACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNT----SIYYRLAQL 545

Query: 585 YRKLGEDERAIKCF 598
           Y +L ED +  K F
Sbjct: 546 YEEL-EDLQECKKF 558

>CAGL0I02288g complement(203605..205524) similar to sp|P16522
           Saccharomyces cerevisiae YHR166c CDC23, hypothetical
           start
          Length = 639

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 88/220 (40%), Gaps = 1/220 (0%)

Query: 342 QHQTEIEHARKVLSDKYYLKDNRTVLLAEIELLNNQ-SKFTQCMKLCEQVLEVDEYNLEV 400
           + Q  ++       D   L  N T L A+  L + Q   +    ++ E+++E D Y L+ 
Sbjct: 319 EFQGNVDEYLTTFEDLLTLFPNFTFLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDD 378

Query: 401 LPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSI 460
           +  +   L+      KL  L+  +++     P T   +A YY    +  ++  YF R+  
Sbjct: 379 MDTFSNILYVMQKNAKLAYLAQFVSQIDRFRPETCCVIANYYSARQEHEKSIMYFRRALT 438

Query: 461 MDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAE 520
           +D     +W    H +V       A+ +Y  A    P        LG  Y  +D    + 
Sbjct: 439 LDKKTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSL 498

Query: 521 EYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRA 560
            YF  A  + P D  +   LG  Y K  N+ +A K  +RA
Sbjct: 499 YYFQRACILKPLDKRMWQALGSCYAKVGNHAEAIKCYERA 538

>ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH]
           complement(787181..789229) [2049 bp, 682 aa]
          Length = 682

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 120/299 (40%), Gaps = 18/299 (6%)

Query: 276 MEQAKECFKEAVQVDVKNYEAFDY------LLSKHMLTTAEQWDLVRSLQFDDL------ 323
           +E+ +    EA++  V++ E + Y       L+  +  T E   LV+ L+  DL      
Sbjct: 286 LEKKQGLASEAIKSFVRSLELYPYNWTCWCELATCITRTDESLLLVKHLR--DLFPANGE 343

Query: 324 -DDNEEMMRCLYISRLSKYQHQTEIEHARKVLSDKYYLKDNRTVLLAEIELLN-NQSKFT 381
             DN  M+R   IS    +    + +H    L     L  N + L +E+ LLN +   + 
Sbjct: 344 RGDNAVMLRFFKISIFKDFG--GDFDHFMDELDYLMGLFPNFSFLKSELALLNYHYMDYV 401

Query: 382 QCMKLCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATY 441
               + ++++++D Y L+ L IY   L+     +KL  LS   A+     P T   +A Y
Sbjct: 402 NAELIFDEIVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIANY 461

Query: 442 YLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHL 501
           +    +  +A  YF R+  ++ +   +W    H +V       A+  Y  A    P    
Sbjct: 462 FSAKQQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFK 521

Query: 502 PHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRA 560
               LG  Y  +D    A  Y   A  + P D  +   L   Y K     +A K  +RA
Sbjct: 522 AWYGLGQAYEVLDRHLYALYYLQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRA 580

>KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces
           cerevisiae YHR166c CDC23 subunit of anaphase-promoting
           complex (cyclosome), start by similarity
          Length = 632

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 72/173 (41%)

Query: 388 EQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGK 447
           ++++ +D Y L+ L  Y   L+      KL  L+   A      P T   +A Y+    +
Sbjct: 359 DELVTMDPYRLDDLDTYSNVLYVLQKPYKLAYLAQYAANVDIYRPETCCIIANYFSSKQQ 418

Query: 448 VSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLG 507
             ++  YF R+ ++D S+ ++W+   H ++       A+  Y  A+   P        LG
Sbjct: 419 HEKSILYFRRALMLDKSYTHAWILMGHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLG 478

Query: 508 MQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRA 560
             Y  +D  S A  YF  A  + P D  +       Y K    ++A K  +R+
Sbjct: 479 QAYEVLDKHSFALYYFQKACALKPLDKRMWFASASCYEKLDKTVQAIKCFQRS 531

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 544 YFK-RQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVL 602
           YF  +Q + K+  Y +RA   +   KS + AWI     +GH + ++     AI+C++   
Sbjct: 412 YFSSKQQHEKSILYFRRA---LMLDKSYTHAWIL----MGHEFIEMKNSHAAIECYRRAS 464

Query: 603 ESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           + +      W  LG  Y  + K   A+  F KA AL
Sbjct: 465 DVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACAL 500

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 15/221 (6%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSA 488
           P S     ++A  Y        A + + R+ +++P     W    H Y+   + ++A +A
Sbjct: 77  PSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNA 136

Query: 489 YSTAARFFPGTHLPHLY--LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFK 546
           Y  A       ++P L+  +G+ Y+R   L  AEE F    ++ P       +   IYF+
Sbjct: 137 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKANEIYFR 192

Query: 547 RQNYIKAKKYMKRAHDAIKNMKSESKA----WISIVINLGHTYRKLGEDERAIKCFKTVL 602
                K +    +A +  + +  +  A    W  I   LG     +GE + A + ++ VL
Sbjct: 193 LGIIYKHQGKWSQALECFRYILPQPPAPLQEW-DIWFQLGSVLESMGEWQGAKEAYEHVL 251

Query: 603 ESSKPTATLWCSLGFLY----LRMKKIEKAIDSFHKALALD 639
             ++  A +   LG LY    ++    +KA+D   K+L  D
Sbjct: 252 AQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEAD 292

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 89/214 (41%), Gaps = 13/214 (6%)

Query: 434 TWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAA 493
           TW ++A+    +G    A   +  +   +PS   +    AH Y +    ++A   Y  A 
Sbjct: 48  TWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERAL 107

Query: 494 RFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMA-YDMC-PTDPLLLNELGVIYFKRQNYI 551
              P        LG  Y  +DDL  A   +  A Y +  P  P L + +G++Y +     
Sbjct: 108 LVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDR----Y 163

Query: 552 KAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATL 611
            +  Y + A   +  +    +    I   LG  Y+  G+  +A++CF+ +L   +P A L
Sbjct: 164 GSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYIL--PQPPAPL 221

Query: 612 -----WCSLGFLYLRMKKIEKAIDSFHKALALDQ 640
                W  LG +   M + + A +++   LA +Q
Sbjct: 222 QEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQ 255

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/223 (20%), Positives = 84/223 (37%), Gaps = 21/223 (9%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFG-----YSWLGFAHTYVAEGEHE 483
           P  P  W  +   Y   G +  A + F++   +DP F      Y  LG    Y  +G+  
Sbjct: 147 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGI--IYKHQGKWS 204

Query: 484 QALSAYSTAARFFPGTHLP------HLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLL 537
           QAL  +       P    P         LG     M +   A+E +            +L
Sbjct: 205 QALECFR---YILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQHHAKVL 261

Query: 538 NELGVIY-FKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIK 596
            +LG +Y      +   +K +     +++   S++  W     +LG  +    +   A  
Sbjct: 262 QQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWY----HLGRVHMIRTDYTAAYD 317

Query: 597 CFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
            F+  +         WCS+G LY ++ +   A+D++ +A+ L+
Sbjct: 318 AFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN 360

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 13/130 (10%)

Query: 525 MAYDMC----PTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVIN 580
           MAYD      P+    L  L  +Y  R  + +A +  +RA      +   S  W +    
Sbjct: 67  MAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPEL---SDVWAT---- 119

Query: 581 LGHTYRKLGEDERAIKCFKTVLE--SSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           LGH Y  L + +RA   ++  L   S+     LW  +G LY R   ++ A ++F K L L
Sbjct: 120 LGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLEL 179

Query: 639 DQGNQASNKL 648
           D   + +N++
Sbjct: 180 DPHFEKANEI 189

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 15/221 (6%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSA 488
           P S     ++A  Y        A + + R+   +P  G  W    H Y+   E + A +A
Sbjct: 139 PSSTNALTSLAHLYRSRDMFQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAA 198

Query: 489 YSTAARFFPGTHLPHLY--LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFK 546
           Y  A       ++P L+  +G+ Y+R   L  AEE F    ++ P       +   IYF+
Sbjct: 199 YQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ----FEKANEIYFR 254

Query: 547 RQNYIKAKKYMKRAHDAIKNMKSESKA----WISIVINLGHTYRKLGEDERAIKCFKTVL 602
                K +    +A +  + +  +  A    W  +   LG     +GE + A   ++ ++
Sbjct: 255 LGIIYKHQGKWNQALECFRYILPQPPAPLQEW-DVWFQLGSVLESMGEWQGARDAYEHII 313

Query: 603 ESSKPTATLWCSLGFLY----LRMKKIEKAIDSFHKALALD 639
             +   A +   LG LY    +     +KA++   K+L +D
Sbjct: 314 SQNDRHAKVLQQLGCLYGMNNVSFYDPQKALNLLLKSLEID 354

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 86/206 (41%), Gaps = 13/206 (6%)

Query: 434 TWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAA 493
           TW ++A+    +G    A   +  +   +PS   +    AH Y +    ++A   Y  A 
Sbjct: 110 TWLSIASLAETLGDADLAAMAYDATLQHNPSSTNALTSLAHLYRSRDMFQRAAELYQRAL 169

Query: 494 RFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMA-YDMC-PTDPLLLNELGVIYFKRQNYI 551
              P        LG  Y  +D+L  A   +  A Y +  P  P L + +G++Y +     
Sbjct: 170 SANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIGILYDR----Y 225

Query: 552 KAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATL 611
            +  Y + A   +  +  + +    I   LG  Y+  G+  +A++CF+ +L   +P A L
Sbjct: 226 GSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYIL--PQPPAPL 283

Query: 612 -----WCSLGFLYLRMKKIEKAIDSF 632
                W  LG +   M + + A D++
Sbjct: 284 QEWDVWFQLGSVLESMGEWQGARDAY 309

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/223 (20%), Positives = 86/223 (38%), Gaps = 21/223 (9%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFG-----YSWLGFAHTYVAEGEHE 483
           P  P  W  +   Y   G +  A + F++   +DP F      Y  LG    Y  +G+  
Sbjct: 209 PNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGI--IYKHQGKWN 266

Query: 484 QALSAYSTAARFFPGTHLP------HLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLL 537
           QAL  +       P    P         LG     M +   A + +            +L
Sbjct: 267 QALECFR---YILPQPPAPLQEWDVWFQLGSVLESMGEWQGARDAYEHIISQNDRHAKVL 323

Query: 538 NELGVIY-FKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIK 596
            +LG +Y     ++   +K +     +++   +++ +W     +LG  +    +   A  
Sbjct: 324 QQLGCLYGMNNVSFYDPQKALNLLLKSLEIDSTDATSWY----HLGRIHMIRNDYTSAYD 379

Query: 597 CFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
            F+  +       T WCS+G LY ++ +   A+D++ +A+ L+
Sbjct: 380 AFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLN 422

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 13/130 (10%)

Query: 525 MAYDMC----PTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVIN 580
           MAYD      P+    L  L  +Y  R  + +A +  +RA  A   +         I   
Sbjct: 129 MAYDATLQHNPSSTNALTSLAHLYRSRDMFQRAAELYQRALSANPELGD-------IWAT 181

Query: 581 LGHTYRKLGEDERAIKCFKTVLE--SSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           LGH Y  L E + A   ++  L   S+     LW  +G LY R   ++ A ++F K L L
Sbjct: 182 LGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLEL 241

Query: 639 DQGNQASNKL 648
           D   + +N++
Sbjct: 242 DPQFEKANEI 251

>Scas_680.35
          Length = 631

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 82/205 (40%), Gaps = 4/205 (1%)

Query: 386 LCEQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCM 445
           L EQV+++D Y L+ L  Y   L+     +KL  L+  +A+       T   +A YY   
Sbjct: 356 LFEQVVKMDPYRLDDLDTYSNILYVMQKHSKLAYLAQFVAQIDKFRSETCCIMANYYSAR 415

Query: 446 GKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLY 505
            +  ++  YF R+  ++     +W    H +V       A+  Y  A             
Sbjct: 416 QEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYG 475

Query: 506 LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIK 565
           LG  Y  +D    +  YF  A  + P D  +   LG  Y K  N  +A K  +RA     
Sbjct: 476 LGQAYEVLDMHLYSLYYFQKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCFERAIQLSG 535

Query: 566 NMKSESKAWISIVINLGHTYRKLGE 590
           N   ++    +++ NL   Y +L +
Sbjct: 536 NADQDT----TLMYNLAKLYDQLND 556

>Kwal_23.3670
          Length = 802

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 83/215 (38%), Gaps = 47/215 (21%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSA 488
           P S     ++A  Y        A + + R+  ++P  G  W    H Y+   + ++A +A
Sbjct: 97  PSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAA 156

Query: 489 YSTAARFFPGTHLPHLY--LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFK 546
           Y  A       ++P L+  +G+ Y+R   L  AEE F    ++ P       +   IYF+
Sbjct: 157 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ----FEKANEIYFR 212

Query: 547 RQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSK 606
                                             LG  Y+  G+  +A++CF+ +L  ++
Sbjct: 213 ----------------------------------LGIIYKHQGKWNQALECFRYIL--TQ 236

Query: 607 PTATL-----WCSLGFLYLRMKKIEKAIDSFHKAL 636
           P A L     W  LG +   M + + A +++   L
Sbjct: 237 PPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVL 271

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 13/130 (10%)

Query: 525 MAYDMC----PTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVIN 580
           MAYD      P+    L  L  +Y  R  + +A +  +RA      +         I   
Sbjct: 87  MAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNPELGD-------IWAT 139

Query: 581 LGHTYRKLGEDERAIKCFKTVLE--SSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           LGH Y  L + +RA   ++  L   S+     LW  +G LY R   ++ A ++F K L L
Sbjct: 140 LGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLEL 199

Query: 639 DQGNQASNKL 648
           D   + +N++
Sbjct: 200 DPQFEKANEI 209

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 86/224 (38%), Gaps = 23/224 (10%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFG-----YSWLGFAHTYVAEGEHE 483
           P  P  W  +   Y   G +  A + F++   +DP F      Y  LG    Y  +G+  
Sbjct: 167 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGI--IYKHQGKWN 224

Query: 484 QALSAYSTAARFF---PGTHLPH----LYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL 536
           QAL  +    R+    P   L        LG     M +   A E +            +
Sbjct: 225 QALECF----RYILTQPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVLLQNERHAKV 280

Query: 537 LNELGVIY-FKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAI 595
           L +LG +Y  +   +   +  +     +++   +++  W     +LG  +    +   A 
Sbjct: 281 LQQLGCLYGMQNVQFYNTQTALNLLLKSLEVDSTDATTWY----HLGRIHMVRNDYTAAY 336

Query: 596 KCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
             F+  +       T WCS+G LY ++ +   A+D++ +A+ L+
Sbjct: 337 DAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLN 380

>Scas_705.55
          Length = 907

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 87/210 (41%), Gaps = 13/210 (6%)

Query: 434 TWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAA 493
           TW ++A+    +G    A   +  +   +P    +    AH Y +    ++A   Y  A 
Sbjct: 58  TWLSIASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYERAL 117

Query: 494 RFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMA-YDMC-PTDPLLLNELGVIYFKRQNYI 551
              P        LG  Y  +DDL  A   +  A Y +  P  P L + +G++Y +     
Sbjct: 118 SINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDR----Y 173

Query: 552 KAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATL 611
            +  Y + A   +  +  + +    I   LG  Y+  G+  +A++CF+ +L  ++P A L
Sbjct: 174 GSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYIL--NQPPAPL 231

Query: 612 -----WCSLGFLYLRMKKIEKAIDSFHKAL 636
                W  LG +   M + + A +++   L
Sbjct: 232 QEWDIWFQLGSVLESMNEWQGAREAYEHVL 261

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 87/224 (38%), Gaps = 23/224 (10%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFG-----YSWLGFAHTYVAEGEHE 483
           P  P  W  +   Y   G +  A + F++   +DP F      Y  LG    Y  +G+  
Sbjct: 157 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGI--IYKHQGKWT 214

Query: 484 QALSAYSTAARFF---PGTHLPH----LYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL 536
           QAL  +    R+    P   L        LG     M++   A E +            +
Sbjct: 215 QALECF----RYILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQNENHAKV 270

Query: 537 LNELGVIY-FKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAI 595
           L +LG +Y     ++   +K +     +++   ++S  W     +LG  +    +   A 
Sbjct: 271 LQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDSTTWY----HLGRVHMIRNDYTAAY 326

Query: 596 KCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
             F+  +         WCS+G LY ++ +   A+D++ +A+ L+
Sbjct: 327 DAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN 370

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 13/130 (10%)

Query: 525 MAYDMC----PTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVIN 580
           MAYD      P     L  L  +Y  R  + +A +  +RA      +   S  W +    
Sbjct: 77  MAYDATLQFNPQSTKALTSLAHLYRSRDMFQRAAELYERALSINPEL---SDVWAT---- 129

Query: 581 LGHTYRKLGEDERAIKCFKTVLE--SSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           LGH Y  L + +RA   ++  L   S+     LW  +G LY R   ++ A ++F K L L
Sbjct: 130 LGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLEL 189

Query: 639 DQGNQASNKL 648
           D   + +N++
Sbjct: 190 DPQFEKANEI 199

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/256 (19%), Positives = 99/256 (38%), Gaps = 45/256 (17%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSA 488
           P+S     ++A  Y        A + + R+  ++P     W    H Y+   + ++A ++
Sbjct: 87  PQSTKALTSLAHLYRSRDMFQRAAELYERALSINPELSDVWATLGHCYLMLDDLQRAYNS 146

Query: 489 YSTAARFFPGTHLPHLY--LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL--LNE----L 540
           Y  A       ++P L+  +G+ Y+R   L  AEE F    ++   DP     NE    L
Sbjct: 147 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLEL---DPQFEKANEIYFRL 203

Query: 541 GVIY------------------------------FKRQNYIKAKKYMKRAHDAIKNMKSE 570
           G+IY                              F+  + +++    + A +A +++  +
Sbjct: 204 GIIYKHQGKWTQALECFRYILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLLQ 263

Query: 571 SKAWISIVINLGHTYR----KLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIE 626
           ++    ++  LG  Y        + ++A+      LE     +T W  LG +++      
Sbjct: 264 NENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYT 323

Query: 627 KAIDSFHKALALDQGN 642
            A D+F +A+  D  N
Sbjct: 324 AAYDAFQQAVNRDSRN 339

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 107/272 (39%), Gaps = 22/272 (8%)

Query: 389 QVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKV 448
           Q+ E+  Y +    I+   L       +L  L   L   +P  P TW  V  Y       
Sbjct: 508 QLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDH 567

Query: 449 SEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGM 508
            +A + F +++ +DP F Y++    H   +    + A   +  A    P  +  +  +G+
Sbjct: 568 EDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGI 627

Query: 509 QYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMK 568
              ++     A  YF  A  + P + +L+   GV   K +   KA +Y + A     N  
Sbjct: 628 YSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEYYELACTLQPNS- 686

Query: 569 SESKAWISIVINLGHTYR-----KLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMK 623
                      NL    R      +G    A++ F+ + + +    T+   LG LY  M 
Sbjct: 687 -----------NLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMG 735

Query: 624 KIEKAIDSFHKALALD-QGNQASNKLLKTALE 654
           +  +AI  F  A+ LD +GNQ    L+  ALE
Sbjct: 736 RKNEAIREFTVAMNLDPKGNQ----LILDALE 763

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 82/196 (41%), Gaps = 9/196 (4%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSA 488
           P S     ++A  Y        A + + R+  ++P  G  W    H Y+   + ++A +A
Sbjct: 93  PSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAA 152

Query: 489 YSTAARFFPGTHLPHLY--LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFK 546
           Y  A       ++P L+  +G+ Y+R   L  AEE F    ++ P       ++  IYF+
Sbjct: 153 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKVNEIYFR 208

Query: 547 RQNYIKAKKYMKRAHDAIKNMKSESKAWIS---IVINLGHTYRKLGEDERAIKCFKTVLE 603
                K +    +A +  + +  +  A +    +   LG     +GE + A + ++ VL 
Sbjct: 209 LGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLS 268

Query: 604 SSKPTATLWCSLGFLY 619
            +   A +   LG LY
Sbjct: 269 QNDRHAKVLQQLGCLY 284

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 87/211 (41%), Gaps = 13/211 (6%)

Query: 434 TWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAA 493
           TW ++A+    +G    A   +  +   +PS   +    AH Y +    ++A   Y  A 
Sbjct: 64  TWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRAL 123

Query: 494 RFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMA-YDMC-PTDPLLLNELGVIYFKRQNYI 551
              P        LG  Y  +DDL  A   +  A Y +  P  P L + +G++Y +     
Sbjct: 124 AVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDR----Y 179

Query: 552 KAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATL 611
            +  Y + A   +  +    +    I   LG  Y+  G+  +A++CF+ +L   +P A L
Sbjct: 180 GSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQALECFRYIL--PQPPAPL 237

Query: 612 -----WCSLGFLYLRMKKIEKAIDSFHKALA 637
                W  LG +   M + + A +++   L+
Sbjct: 238 QEWDVWFQLGSVLESMGEWQGAREAYEHVLS 268

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/223 (20%), Positives = 83/223 (37%), Gaps = 21/223 (9%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFG-----YSWLGFAHTYVAEGEHE 483
           P  P  W  +   Y   G +  A + F++   +DP F      Y  LG    Y  +G+  
Sbjct: 163 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGI--IYKHQGKWN 220

Query: 484 QALSAYSTAARFFPGTHLP------HLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLL 537
           QAL  +       P    P         LG     M +   A E +            +L
Sbjct: 221 QALECFR---YILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLSQNDRHAKVL 277

Query: 538 NELGVIY-FKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIK 596
            +LG +Y      +   +  +     +++   +++  W     +LG  +    +   A  
Sbjct: 278 QQLGCLYGMNNVQFYDPQTALNLLLKSLEADSTDATTWY----HLGRIHMVRNDYTAAYD 333

Query: 597 CFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
            F+  +       T WCS+G LY ++ +   A+D++ +A+ L+
Sbjct: 334 AFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLN 376

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 13/121 (10%)

Query: 525 MAYDMC----PTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVIN 580
           MAYD      P+    L  L  +Y  R  + +A +  +RA      +      W +    
Sbjct: 83  MAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPEL---GDVWAT---- 135

Query: 581 LGHTYRKLGEDERAIKCFKTVLE--SSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           LGH Y  L + +RA   ++  L   S+     LW  +G LY R   ++ A ++F K L L
Sbjct: 136 LGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLEL 195

Query: 639 D 639
           D
Sbjct: 196 D 196

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 568 KSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEK 627
           +S ++ W+SI  +L  T   LG+ +RA   +   L+ +  +     SL  LY      ++
Sbjct: 59  QSAAETWLSIA-SLAET---LGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQR 114

Query: 628 AIDSFHKALALD 639
           A + + +ALA++
Sbjct: 115 AAELYQRALAVN 126

>Kwal_27.10740
          Length = 628

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 113/267 (42%), Gaps = 18/267 (6%)

Query: 392 EVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEA 451
           E   + L  + I+   L        L  L H+L E    +P TW  +   +       E+
Sbjct: 370 EAQPFRLPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEES 429

Query: 452 RKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYN 511
            K F RS+ +DPSF Y++    H Y +    + A++ Y  A       +  +  LGM   
Sbjct: 430 IKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSL 489

Query: 512 RMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKN--MKS 569
           ++        +F  A  + P + +L+   GV          A + +     A++N  +  
Sbjct: 490 KLGQYEECLLHFEKARSINPVNVILICCCGV----------ALEKLSHQERALQNYDLAC 539

Query: 570 ESKAWISIVI-NLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKA 628
           E +   S+ +         +G+   A++ F+ +++ +   AT+   LG LY  + + + A
Sbjct: 540 ELQPMSSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDA 599

Query: 629 IDSFHKALALD-QGNQASNKLLKTALE 654
           +     A+ LD +G+Q    L+K+ALE
Sbjct: 600 VKELTIAMNLDPKGSQ----LIKSALE 622

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 77/168 (45%), Gaps = 20/168 (11%)

Query: 146 SVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTK--------DPNDAFWLAQVYYNQGSYV 197
           S E+L+ +   ++ Q++ +TAE + +L+ S T+            ++    V Y +G Y 
Sbjct: 16  SCERLKGYIERSVEQNNLETAEFLAELLCSETRRLEGGEREKMEASYQYGLVLYLRGDYK 75

Query: 198 RAVELIFTDQLDSESIMCRYLAALCLFKLNKL-----EEALDIIGDTNPFQSEPSSPGNA 252
            A   +   + D  S++C Y+ A C  KL+         AL  +  T   Q+       A
Sbjct: 76  SAQAAVRAYKAD--SMLCAYVLARCALKLDAAAWDEGSRALAALVGTYSLQN-----AEA 128

Query: 253 DGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFDYL 300
             G+  E+++  + G++Y  +  ++++      A+++D   +E+F  L
Sbjct: 129 HFGMPEEATVYSILGQLYFKMGRLKESCVAHSRALELDCYLWESFRAL 176

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 7/106 (6%)

Query: 534 PLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDER 593
           P +L+ LG ++F+  NY  +KKY     +A      + + + +++ +L  T         
Sbjct: 342 PWVLSSLGKLHFEIVNYEMSKKYFMALREAQPFRLPDMEIFSTLLWHLNDT------TGL 395

Query: 594 AIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
           +  C + +LE ++     WC +G L+   K  E++I +F ++  LD
Sbjct: 396 SHLCHE-LLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLD 440

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 103/257 (40%), Gaps = 10/257 (3%)

Query: 398 LEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSR 457
           L+ + +Y   L     K +L  L H+L     K+ +TW  +   +       EA K   +
Sbjct: 404 LKDMDVYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNLFSLNRDHDEAIKALKK 463

Query: 458 SSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLS 517
           ++ ++P F Y++    H Y      + A   Y  A    P  +  H  LGM   ++    
Sbjct: 464 ATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYD 523

Query: 518 LAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISI 577
            A  +F  A  + P + +L    GV   +     KA  + + A +   N          +
Sbjct: 524 EALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQL 583

Query: 578 VINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALA 637
           + N       LG+   A++ F+ + + +   A +   LG LY  + + + AI  F  A+ 
Sbjct: 584 LFN-------LGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMN 636

Query: 638 LDQGNQASNKLLKTALE 654
           LD       +L+K ALE
Sbjct: 637 LDPNGI---QLVKEALE 650

>KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, start by similarity
          Length = 566

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 78/197 (39%), Gaps = 13/197 (6%)

Query: 446 GKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLY 505
            K+SEA   F  +   DP+   +WL          +    +SA        P      + 
Sbjct: 292 AKLSEAALAFEAAVQEDPAHVDAWLKLGLVQTQNEKEMNGISALEQCLSLDPTNQQALMT 351

Query: 506 LGMQY-NRMDDL---SLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAH 561
           + + Y N   DL   S+   +    Y      P + +E  +  F     +   KY++ A 
Sbjct: 352 ISISYINEGYDLTAFSMLNRWLDSKYPELTRSPTI-DEANIDRFNLSKQV-ITKYLQVA- 408

Query: 562 DAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLR 621
           +A+  +  E      + + LG  +    E  + I CF+T LE +     +W  LG     
Sbjct: 409 NALPQVDPE------VQLGLGTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLAN 462

Query: 622 MKKIEKAIDSFHKALAL 638
             + E+AI ++HKALAL
Sbjct: 463 SNRSEEAIQAYHKALAL 479

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 85/209 (40%), Gaps = 11/209 (5%)

Query: 434 TWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAA 493
           TW ++A+    +G    A   +  +   + S        AH Y +    ++A   Y  A 
Sbjct: 50  TWLSIASLAETLGDADRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQKAAELYECAL 109

Query: 494 RFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMA-YDMC-PTDPLLLNELGVIYFKRQNYI 551
           +  P        LG  Y  +DDL  A   +  A Y +  P  P L + +G++Y +     
Sbjct: 110 QVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDR----Y 165

Query: 552 KAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTA-- 609
            +  Y + A   +  +    +    I   LG  Y+  G+  +A++CF+ +L +  PT   
Sbjct: 166 GSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYIL-AQPPTPLQ 224

Query: 610 --TLWCSLGFLYLRMKKIEKAIDSFHKAL 636
              +W  LG +   M + + A +++   L
Sbjct: 225 EWDIWFQLGSVLESMGEWQGAREAYEHVL 253

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 85/224 (37%), Gaps = 23/224 (10%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFG-----YSWLGFAHTYVAEGEHE 483
           P  P  W  +   Y   G +  A + F++   +DP F      Y  LG    Y  +G+  
Sbjct: 149 PNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGI--IYKHQGKWS 206

Query: 484 QALSAYSTAARFF---PGTHLPH----LYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL 536
           QAL  +    R+    P T L        LG     M +   A E +            +
Sbjct: 207 QALECF----RYILAQPPTPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKV 262

Query: 537 LNELGVIY-FKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAI 595
             +LG +Y      +   +K +     +++   S++  W     +LG  +    +   A 
Sbjct: 263 FQQLGCLYGMNNVQFYDPQKALSYLLKSLEVDPSDATTWY----HLGRVHMIRSDYTAAY 318

Query: 596 KCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
             F+  +         WCS+G LY ++ +   A+D++ +A+ L+
Sbjct: 319 DAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLN 362

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 89/225 (39%), Gaps = 47/225 (20%)

Query: 461 MDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLY--LGMQYNRMDDLSL 518
           ++P     W    H Y+   + ++A +AY  A       ++P L+  +G+ Y+R   L  
Sbjct: 111 VNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDY 170

Query: 519 AEEYFMMAYDMCPTDPLL--LNE----LGVIYFKRQN----------YIKAKK------- 555
           AEE F    ++   DP     NE    LG+IY K Q           YI A+        
Sbjct: 171 AEEAFAKVLEL---DPHFEKANEIYFRLGIIY-KHQGKWSQALECFRYILAQPPTPLQEW 226

Query: 556 ----YMKRAHDAIKNMKSESKAWISIVINLGH---TYRKLG-----------EDERAIKC 597
                +    +++   +   +A+  +++   H    +++LG           + ++A+  
Sbjct: 227 DIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKVFQQLGCLYGMNNVQFYDPQKALSY 286

Query: 598 FKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGN 642
               LE     AT W  LG +++       A D+F +A+  D  N
Sbjct: 287 LLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRN 331

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 571 SKAWISIVINLGHTYRKLGEDERAIKCFKTVLE--SSKPTATLWCSLGFLYLRMKKIEKA 628
           S  W +    LGH Y  L + +RA   ++  L   S+     LW  +G LY R   ++ A
Sbjct: 116 SDVWAT----LGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYA 171

Query: 629 IDSFHKALALDQGNQASNKL 648
            ++F K L LD   + +N++
Sbjct: 172 EEAFAKVLELDPHFEKANEI 191

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 95/227 (41%), Gaps = 16/227 (7%)

Query: 431 SPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYS 490
           +P+ W ++   +       EA   F ++  +DP F Y++    H Y      + A S + 
Sbjct: 491 NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFR 550

Query: 491 TAARFFPGTHLPHLY-LGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQN 549
            A      TH   LY LGM   ++     A  +F  A  + P + +L    GV   + Q 
Sbjct: 551 KALT-IEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNVILNCCCGVALERLQQ 609

Query: 550 YIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKP-T 608
             +A  + + A +   N          +++N+G     L   ER        LES  P  
Sbjct: 610 PERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFER--------LESLTPDE 661

Query: 609 ATLWCSLGFLYLRMKKIEKAIDSFHKALALD-QGNQASNKLLKTALE 654
           A +   LG LY  + K + A++ +  A+ LD +G+Q    L+K A+E
Sbjct: 662 AHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGSQ----LIKEAME 704

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 22/125 (17%)

Query: 534 PLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDER 593
           P  L+ LG ++F+  NY  AK Y  +          +   + +++ +L        +D+ 
Sbjct: 424 PWCLSTLGKLHFELVNYEMAKSYFTKLRTLQPTRFQDMDTFSTVLWHL--------QDKT 475

Query: 594 AIKCFKT---VLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD---------QG 641
            +         L+   P A  WCS+G L+   K  ++AI +F KA+ LD         QG
Sbjct: 476 HLSALCAELLTLDKYNPIA--WCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQG 533

Query: 642 NQASN 646
           ++ SN
Sbjct: 534 HEYSN 538

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 91/226 (40%), Gaps = 8/226 (3%)

Query: 420 LSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAE 479
           L++ L +  P  P TW  +            A K F +++ +DP+F Y++    H + + 
Sbjct: 528 LANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSN 587

Query: 480 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNE 539
              + A + Y  A    P  +  +  LG    ++     A  YF  A  + P + +L+  
Sbjct: 588 DSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICC 647

Query: 540 LGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFK 599
            G    K     KA +Y + A   ++   S SK        +G     +     A++ F+
Sbjct: 648 CGGSLEKLGYKEKALQYYELACH-LQPTSSLSK------YKMGQLLYSMTRYNVALQTFE 700

Query: 600 TVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD-QGNQA 644
            +++     AT    LG  Y  + + + AI     A+ LD +GNQ 
Sbjct: 701 ELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQV 746

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 80/180 (44%), Gaps = 26/180 (14%)

Query: 139 FDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTK--DPNDAFWLAQVY------ 190
           FD   LS++ +L+     A+ Q +Y TAE + +L+Y+     D +  +W   VY      
Sbjct: 19  FDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSILDKSSVYWSDAVYLYALSL 78

Query: 191 YNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKL--EEALDIIGDTNPFQSEPSS 248
           +   SY  A ++  + +     +   Y+   C  +L++   E  L ++   N F S  S 
Sbjct: 79  FLNKSYHTAFQI--SKEFKEYHLGIAYIFGRCALQLSQGVNEAILTLLSIINVFSSNSS- 135

Query: 249 PGNADGGVKLESSM----------CLLRGRIYVSLSNMEQAKECFKEAVQVDVKNYEAFD 298
             N    + L S++          CLL G +Y+ L + ++      EA+ ++   +E+++
Sbjct: 136 --NTRINMVLNSNLVHIPDLATLNCLL-GNLYMKLDHSKEGAFYHSEALAINPYLWESYE 192

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 74/197 (37%), Gaps = 15/197 (7%)

Query: 447 KVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYL 506
           K+SEA   F  +   DP    +WL      +   +    +SA  T  +  P        L
Sbjct: 301 KLSEAALAFEAAIKQDPKHVDAWLKLGIVQIQNEKELNGMSALETCLKLDPNNLEAMKNL 360

Query: 507 GMQYNRMDDLSLAEEYFMMAYDMC-----PTDPLLLNELGVIYFKRQNYIKAKKYMKRAH 561
            + Y       + E Y M AY+M         P   N    +  KR  +      M R  
Sbjct: 361 AISY-------INEGYDMSAYNMLNRWADTKYPGFYNS-AELEGKRDEHENIHSKMTRRF 412

Query: 562 DAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLR 621
            ++ N  +     I +   LG  +    E +R I CF+  L+ +     +W  LG     
Sbjct: 413 LSLVNRINSVDPDIQLC--LGLLFYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLAN 470

Query: 622 MKKIEKAIDSFHKALAL 638
             + E+AI ++H+AL L
Sbjct: 471 SNRSEEAIQAYHRALQL 487

>Kwal_56.24750
          Length = 619

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 65/173 (37%)

Query: 388 EQVLEVDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGK 447
           E ++++D Y LE +  Y   L+     +KL  L+   +        T   +A YY    +
Sbjct: 345 ENIIKIDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIANYYSAKQE 404

Query: 448 VSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLG 507
             ++  YF R+  ++     +W    H +V       A+  Y  A    P        LG
Sbjct: 405 HEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLG 464

Query: 508 MQYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRA 560
             Y  +D    +  YF  +  + P D  +   L   Y K  N  ++ K   RA
Sbjct: 465 QAYEVLDMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVGNAAESIKCYTRA 517

>Scas_631.4
          Length = 1398

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 3/115 (2%)

Query: 526 AYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKS-ESKAWISIVINLGHT 584
           A+++   D +  N +  +Y K  N+  A +  +R   A K  +  ++  W   VI +G+ 
Sbjct: 617 AFELDAGDHIAANYMTEVYAKSNNWSSAVQIAERLVKAEKAKRVLQTMNWPYRVIGIGNL 676

Query: 585 YRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
            R+   D  +I+ F++ +         W  LG  YL   +IE +I  F KA+ LD
Sbjct: 677 ERQQESD--SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELD 729

>Sklu_2239.3 YJR088C, Contig c2239 5120-5974
          Length = 284

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 79/164 (48%), Gaps = 30/164 (18%)

Query: 497 PGTHLPHLYLGMQYNRMDDLSLAEEYF------MMAYDMCPTDPLLLNELGVIYFKRQNY 550
           P  HL    L +Q N  DD+   EEY       ++ ++    D LL+++  ++  KR N 
Sbjct: 84  PRLHLMQATL-LQINENDDI--VEEYISGLLRKVLKFETDSQDYLLMSK-KLLSIKR-NK 138

Query: 551 IKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTAT 610
           +  + ++++  D ++   S+++ W       G  Y  LG+ +R+  CF+ VL        
Sbjct: 139 LPQETWLRQLLDLVEKFPSDAELWWMC----GTEYYSLGQFDRSAYCFEEVL-------- 186

Query: 611 LWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTALE 654
             C   F Y+   ++ + +  ++KAL   +GN+AS   LK +L+
Sbjct: 187 --CITPFNYVAFAQLGEVL--YYKAL---RGNRASKDTLKNSLD 223

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 30/153 (19%), Positives = 61/153 (39%), Gaps = 12/153 (7%)

Query: 437 AVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFF 496
            +  YYL + + +E+ ++F  +  +D S   +W+G    Y A G  E ++  +  A    
Sbjct: 665 VLGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELS 724

Query: 497 PGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL-------LNELGVIYFKRQN 549
           P      L+L +   ++ +   + E      +  P + +        L E  + +F +  
Sbjct: 725 PEHKYAGLFLAISLCQLSEFEKSLEALRKLVNKYPQEAIFKERLSATLVEHALQFFDQGY 784

Query: 550 YIKAKKYMKRAHDAIKNMKSE-----SKAWISI 577
            IKA          I+ + SE     +  WI++
Sbjct: 785 LIKAATCAAEVISIIEGIVSEQVEYTTNMWITL 817

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 78/203 (38%), Gaps = 19/203 (9%)

Query: 418  FLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYV 477
            F+ ++ LA   PK P  WF ++   L    V  A+   ++   + P   +SW   A T  
Sbjct: 966  FIKANALA---PKEPTIWFNMSLLALKCHDVEFAKLVLNQLHGLAPQMPHSWFAKALTLE 1022

Query: 478  AEGEHEQALSAYSTAARFFPGTHLP--HLYLGMQYNRM-------DDLSLAEEYFMMAYD 528
             EG+  ++   ++ A     G + P   LY     NR         D+    E   +AY 
Sbjct: 1023 KEGDINESTRMFAYAFLISNGRYKPVQLLYAKAALNRHIANNEDERDIEPNLELSTIAYG 1082

Query: 529  M------CPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLG 582
            +      CP D L L +  ++ ++R     A  ++      I   + E       +IN G
Sbjct: 1083 LGQYLKKCPDDLLAL-QCAILTYERLCKFTAASHLINDVALILENRFEKSQDERELINYG 1141

Query: 583  HTYRKLGEDERAIKCFKTVLESS 605
                +L   +  +  F+  +E +
Sbjct: 1142 IIKTQLARTQLGLAKFENAIEDA 1164

>Kwal_23.5408
          Length = 1410

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 449 SEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGM 508
           SE+ ++F  +  +DPS   SW+G    Y A G  E ++  +  A    P +   H +  +
Sbjct: 697 SESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKAL 756

Query: 509 QYNRM 513
             +RM
Sbjct: 757 SLSRM 761

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 434 TWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTA 492
           TW+      L   K+  A + F+R + +DP+   SW   +  YV +G+ ++A S    A
Sbjct: 635 TWYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQA 693

>CAGL0G10087g 962823..967058 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein, start by
           similarity
          Length = 1411

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 73/181 (40%), Gaps = 14/181 (7%)

Query: 472 FAHTY--VAEGEH-----EQALSAYST---AARFFPGTHLPHLYLGMQY-NRMDDLSLAE 520
            A TY  + E EH     E    AY     + +   G    +  LG  Y N   D S A 
Sbjct: 566 LAETYLNIQESEHVSEGFENVKLAYKILIQSIKALDGYAPSYCSLGKIYSNYYGDFSRAF 625

Query: 521 EYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESK-AWISIVI 579
                A+++   D +    L   Y    N+  A +  +R   + K+ K+  K +W   + 
Sbjct: 626 RCHYRAFELDAGDIISAEYLARTYADATNWTLALEVSERLVKSEKSKKALRKVSWPYRI- 684

Query: 580 NLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
            LG  Y +  +D  +I+ F+  L         W  LG  YL   ++E ++  F +AL LD
Sbjct: 685 -LGVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLD 743

Query: 640 Q 640
           +
Sbjct: 744 E 744

>Scas_721.64
          Length = 578

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 592 ERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           ++ I+CFK  L+ +     +W  LG       K E AI ++H+AL L
Sbjct: 448 DKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 22/106 (20%)

Query: 185 WLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTNPFQS 244
           W+   Y N   Y    E     + D E  +     A+ + K N+L E+L           
Sbjct: 378 WVKNKYPNFEHYEATTEESKRIESDLEDDLSHNFNAVMIKKFNRLAESL----------- 426

Query: 245 EPSSPGNADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVD 290
                   +   KLE    L+RG +Y +  + ++  ECFKE+++++
Sbjct: 427 -------PEHDAKLE----LIRGLLYYAEDDFDKTIECFKESLKIN 461

>Kwal_55.22152
          Length = 1101

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 68/152 (44%), Gaps = 20/152 (13%)

Query: 519 AEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIV 578
           A + F     + P +      L +I+ + + Y  A + +++  D++ N         S+ 
Sbjct: 700 AIQLFQKVLQVDPYNVFAAQGLSIIFAENKRYGPALEILRKVRDSLDNE--------SVH 751

Query: 579 INLGHTYRKLGEDERAIKCFKTVL-----ESSKP-----TATLWCSLGFLYLRMKKIEKA 628
           INLGH   ++ E  +AI+ ++  L     E+S+P         W S G     ++  EK+
Sbjct: 752 INLGHCLLEMQEFAKAIENYEIALKKFTNEASRPLLLNLLGRAWYSRGVKERSLECFEKS 811

Query: 629 IDSFHKALALDQGNQASNKLLKTALEINAHMI 660
           ++    ALA +   + SN  +  +++ N  ++
Sbjct: 812 LEYAQDALAAEM--ERSNSKMVQSIKFNVALL 841

>ADL177C [1564] [Homologous to ScYNL313C - SH] (383369..386086)
           [2718 bp, 905 aa]
          Length = 905

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%)

Query: 428 FPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALS 487
           +P S  TW+      L  GKV  A + FSR   +D +   SW   +  Y  +G+ ++A S
Sbjct: 634 YPLSFDTWYFYGCIGLECGKVDLAAEAFSRCVALDDTHALSWSNLSAAYTEQGKIKEAHS 693

Query: 488 AYSTA 492
               A
Sbjct: 694 CLKRA 698

>Scas_718.37d
          Length = 601

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 598 FKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASN 646
           ++  + S    + +W S+  LYLR+ +IE AI S+ +A+ L   + ++N
Sbjct: 318 YQRAISSDPALSFIWVSIASLYLRLGQIEDAIASYWEAINLSTKSDSTN 366

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 17/84 (20%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYF------------SRSSIMDPSF-----GYSWLG 471
           P     W ++A+ YL +G++ +A   +            + SS    SF      ++W G
Sbjct: 326 PALSFIWVSIASLYLRLGQIEDAIASYWEAINLSTKSDSTNSSSRMRSFNNIFTAFAWYG 385

Query: 472 FAHTYVAEGEHEQALSAYSTAARF 495
            +  YVA GE  +A+ +   A + 
Sbjct: 386 LSQVYVATGEINKAIESADKALKL 409

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 454 YFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTA 492
           Y+ R+   DP+  + W+  A  Y+  G+ E A+++Y  A
Sbjct: 317 YYQRAISSDPALSFIWVSIASLYLRLGQIEDAIASYWEA 355

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 21/93 (22%)

Query: 563 AIKNMKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKP--------------- 607
           AI +  + S  W+SI       Y +LG+ E AI  +   +  S                 
Sbjct: 321 AISSDPALSFIWVSI----ASLYLRLGQIEDAIASYWEAINLSTKSDSTNSSSRMRSFNN 376

Query: 608 --TATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
             TA  W  L  +Y+   +I KAI+S  KAL L
Sbjct: 377 IFTAFAWYGLSQVYVATGEINKAIESADKALKL 409

>KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein singleton,
           start by similarity
          Length = 1401

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 570 ESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAI 629
           +S +W   V+ +    R+L  +  +I+ F++ +  S      W  LG  YL   ++E +I
Sbjct: 666 QSISWPYRVLGMSCLERQLYAE--SIEWFQSSIRVSSSDVESWVGLGQAYLNCGRVEASI 723

Query: 630 DSFHKALALDQGNQASNKLLKTAL 653
             F K L LD+ +  +   L  AL
Sbjct: 724 KVFKKVLELDENHHFAWYFLAIAL 747

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 577 IVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKAL 636
           I + LG  +    + ++ I CF++ L  +     +W  LG       + E+AI ++H+AL
Sbjct: 459 IQLCLGLLFYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRAL 518

Query: 637 AL 638
            L
Sbjct: 519 QL 520

>Kwal_55.22039
          Length = 904

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%)

Query: 428 FPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALS 487
           +P +  TW+      L  GK+  A + F+R   +D +   SW   +  Y+ +G+ ++A S
Sbjct: 632 YPLAFDTWYFYGCVGLECGKMELAAEAFTRCVSLDSTHSLSWSNLSAAYIEQGKLKEAHS 691

Query: 488 AYSTA 492
             S A
Sbjct: 692 CLSKA 696

>ABR131W [723] [Homologous to ScYNL121C (TOM70) - SH; ScYHR117W
           (TOM71) - SH] complement(641630..643414) [1785 bp, 594
           aa]
          Length = 594

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 8/106 (7%)

Query: 425 AENF-------PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYV 477
           A+NF       PKS   ++  A     + +  +A K F ++   DPS  Y ++  A    
Sbjct: 359 AQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418

Query: 478 AEGEHEQALSAYSTAARFFP-GTHLPHLYLGMQYNRMDDLSLAEEY 522
            E + +   + +S A R FP    +P+ Y  +  ++ D  +  +EY
Sbjct: 419 REKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEY 464

>CAGL0H10098g complement(984334..986919) similar to sp|P19735
           Saccharomyces cerevisiae YBR055c PRP6
           snRNP(U4/U6)-associated splicing factor, hypothetical
           start
          Length = 861

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 414 KNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFA 473
           K +L L S++ AE  PK P +W A A      G    AR+   +  +  P     WL   
Sbjct: 193 KQRLVLKSYRRAE--PKDPTSWIASAKLEENCGNYELARELIQQGCLQCPLDEIIWLENL 250

Query: 474 HTYVAEGEHEQALSAYSTAARFFPGT 499
              V+  E ++ + A   A RF P +
Sbjct: 251 RLNVSNNEKKKIIVA--NAIRFQPKS 274

>Sklu_2077.4 YOR007C, Contig c2077 4462-5433 reverse complement
          Length = 323

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 426 ENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSF--GYSWLGFAHTYVAEGEHE 483
           E  P + V +   A  Y  + K  E+ +    +  ++PS+  GYS LGFA    A G+ E
Sbjct: 125 EVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK--YALGKPE 182

Query: 484 QALSAYST 491
           +AL AY T
Sbjct: 183 EALEAYKT 190

>YOR007C (SGT2) [4822] chr15 complement(338938..339978) Protein
           containing three TPR (tetratrico peptide repeat)
           domains, which may mediate protein-protein interactions,
           has low similarity to small glutamine-rich
           tetratricopeptide repeat-containing protein (human SGT)
           [1041 bp, 346 aa]
          Length = 346

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 428 FPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSF--GYSWLGFAHTYVAEGEHEQA 485
            P + + +   A  +  + +  +A K    +  +DPS+  GYS LGFA    A+G+ E+A
Sbjct: 132 LPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK--YAQGKPEEA 189

Query: 486 LSAY 489
           L AY
Sbjct: 190 LEAY 193

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 588 LGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           LG  + AIKCF+ +LE        W  LG      K+ + AI  +   + L
Sbjct: 404 LGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIEL 454

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 612 WCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKTA 652
           W  LG + L+ ++ E A+D+F  AL L+ G+  + KLL  +
Sbjct: 292 WYRLGIVQLQNEQEESAMDAFQHALELEPGHLEALKLLAVS 332

>CAGL0M01914g 232780..234810 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8, general repressor
           of transcription, hypothetical start
          Length = 676

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 451 ARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTA 492
           A +YF  S  + P+  + W+  A  Y+  G+ E +L+ YS A
Sbjct: 320 AYEYFQNSLSLTPNLPFIWISVASLYLTLGQLEDSLATYSQA 361

>Sklu_1876.2 YOL145C, Contig c1876 732-4004
          Length = 1090

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 58/126 (46%), Gaps = 11/126 (8%)

Query: 519 AEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIV 578
           A + F     + P +      L +++ + + Y +A   +++  D++ N         ++ 
Sbjct: 685 AIQLFQKVLQLDPLNIFAAQGLAIVFAENKRYGQALDILRKVRDSLDNE--------AVH 736

Query: 579 INLGHTYRKLGEDERAIKCFKTVLE---SSKPTATLWCSLGFLYLRMKKIEKAIDSFHKA 635
           INLGH   ++ E  +AI+ ++  L+   S +  ++L   LG  +      EK++  F ++
Sbjct: 737 INLGHCLLEMKEYAKAIENYEIALKRFGSERNKSSLLNLLGRAWYSRGVKEKSLHCFKRS 796

Query: 636 LALDQG 641
           L   +G
Sbjct: 797 LEYAKG 802

>KLLA0E01914g complement(180022..183243) similar to sp|P89105
           Saccharomyces cerevisiae YOL145c CTR9 required for G1
           cyclin expression singleton, start by similarity
          Length = 1073

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 13/123 (10%)

Query: 519 AEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIV 578
           A + +     + P +      L +I+ + + Y ++ + +++  D++ N         S+ 
Sbjct: 675 ATQLYQKVLQVDPMNIFAAQGLAIIFAENKRYGQSLEVLRKIRDSLDNQ--------SVH 726

Query: 579 INLGHTYRKLGEDERAIKCFKTVL---ESSKPTATLWCSLG-FLYLRMKKIEKAIDSFHK 634
           INLGH   ++ E  +AI+ ++  L   ++ K    L   LG   YLR  K E+++++  K
Sbjct: 727 INLGHCLSEMREYAKAIENYEIALNRFDNPKSKPLLLNLLGRCWYLRALK-ERSLEAVQK 785

Query: 635 ALA 637
           AL 
Sbjct: 786 ALG 788

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 44/108 (40%), Gaps = 15/108 (13%)

Query: 38  GNSQGRNVEGGRSNIPQIAQTPHQDRSPLVQKIRDVSHLATPAV-MRHNG--TAGSSLLA 94
            NS   NVE GR+ +     + H  +  +   IR       P V M HNG  T    L  
Sbjct: 492 SNSINDNVENGRNTVDPCLTSNHIQKDVISNTIR-------PNVTMTHNGIPTESPPLRN 544

Query: 95  SMTKNGLFGPALPSTLRKTSTSTDT----VELNNS-TNDEDIDHASDN 137
                  F   LPS    ++   DT    ++ NNS  ND +I HA DN
Sbjct: 545 DSNLGNDFKFMLPSAFTPSNDPLDTTNSAIKTNNSINNDHNIAHAHDN 592

>AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH]
           complement(1251018..1252727) [1710 bp, 569 aa]
          Length = 569

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 29/62 (46%)

Query: 577 IVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKAL 636
           + + LG  +    + ++ I CF+  L        +W  LG       + E+AI ++H+A+
Sbjct: 419 VQLGLGILFYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAI 478

Query: 637 AL 638
            L
Sbjct: 479 QL 480

>Kwal_47.18684
          Length = 809

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 88/214 (41%), Gaps = 64/214 (29%)

Query: 521 EYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVIN 580
           EY M +++      LLLN+L +    RQN    + ++ RA     + + ++  +   ++ 
Sbjct: 359 EYLMNSHE------LLLNDLTL----RQNVNNVEAWIARA-GLFSSPQKKADVYTDAILK 407

Query: 581 LGHTYRKLGEDERAIKCFKTVLESSKPT--ATLWCSLGFLYLRMKKIEKAIDSFHKAL-- 636
           + H +                   ++P   A LWC    LY+  K  + A ++F +AL  
Sbjct: 408 VDHAF------------------VTQPGIFAQLWCHFAQLYIESKDYDTARETFDRALRV 449

Query: 637 ------------------ALDQGN-QASNKLLKTALEINAHM-IIDENHPMVISSNIQNI 676
                              L+ G  + S KLLK AL++  +  I+ EN+    SS    I
Sbjct: 450 PFRFLKDIEIIWTHWAEMELECGQIKTSIKLLKNALKVPKNADIVRENY----SSKNSQI 505

Query: 677 PTSHVSKNDKKRTSLGI-------TSFDPVTEAK 703
           P   V+ + +K  SL I       ++ D V+E K
Sbjct: 506 PAKAVTFSSQKLWSLYIDLLESSCSTKDDVSETK 539

>Kwal_33.15281
          Length = 287

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 539 ELGVIYFKRQNYIKAKKYMK-RAHDAIKN-MKSESKAWISIV-----INLGHTYRKLGED 591
           EL  +YFK+ +++  ++Y K R  D +++ + S SK+  +IV     I +   +R LG  
Sbjct: 107 ELEELYFKKSDFLSTERYAKDRVLDNLQDFVNSFSKSPRAIVLSTSNIRVADVFRGLGGS 166

Query: 592 ERAIKCF 598
           + A+K F
Sbjct: 167 KHAVKLF 173

>Kwal_27.11737
          Length = 575

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%)

Query: 576 SIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKA 635
           S+ + LG  +    + ++ + CF+  L        +W  LG       + E+AI ++ KA
Sbjct: 427 SLQLGLGILFYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKA 486

Query: 636 LAL 638
           L L
Sbjct: 487 LQL 489

>KLLA0D01155g complement(104847..105854) similar to sgd|S0005533
           Saccharomyces cerevisiae YOR007c SGT2, start by
           similarity
          Length = 335

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 580 NLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
           N    Y  L + E+A+K  +  +E     +  +  LGF    + K E+A+D++ K L + 
Sbjct: 134 NRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDI- 192

Query: 640 QGNQASN 646
           +G +A++
Sbjct: 193 EGEKATD 199

>ACR005W [1053] [Homologous to ScYOR007C (SGT2) - SH]
           complement(363355..364338) [984 bp, 327 aa]
          Length = 327

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 515 DLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAW 574
           D   A + +  A ++ PTD +        Y   Q Y KA   ++ A  A K   S SK +
Sbjct: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKA---VEDAEKATKVDSSYSKGF 161

Query: 575 ISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAID 630
                 LG+    LG  E A++ +K VL+     AT      +   + +K+E++I+
Sbjct: 162 ----SRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAK-RKVEESIN 212

>Scas_585.4
          Length = 918

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%)

Query: 428 FPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALS 487
           +P +  TW+      L   K+  A + FSR   +DP+   +W   +  YV   + ++A S
Sbjct: 640 YPLNFETWYFYGCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFS 699

Query: 488 A 488
            
Sbjct: 700 C 700

>CAGL0A03630g complement(364712..367900) similar to sp|P33339
           Saccharomyces cerevisiae YGR047c TFC4, hypothetical
           start
          Length = 1062

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 585 YRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAI----DSFHKALALDQ 640
           Y++ G+  RA+  F+ +   S   A +   L  LY+   K+EKAI    +SF K +   Q
Sbjct: 245 YKQTGQIARALDGFQKMYTKSPSDANILRELAILYVDYNKVEKAIELYLESFEKNIKRRQ 304

Query: 641 G 641
            
Sbjct: 305 A 305

>KLLA0F04191g 397611..400268 weakly similar to sp|P19735
           Saccharomyces cerevisiae YBR055c PRP6
           snRNP(U4/U6)-associated splicing factor singleton, start
           by similarity
          Length = 885

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

Query: 517 SLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMK-SESKAWI 575
           SL +  F  A +     P+++ E+G ++ K   Y KA K+  RA +   N++  +   W+
Sbjct: 767 SLRKTTFQDALEATKEHPMVITEIGKVFQKEHQYAKAYKWFIRASE--NNLQFGDPWVWL 824

Query: 576 SIV----------INLGHTYRKLGEDE 592
            I           IN   T +KL E+E
Sbjct: 825 YICESCMNPVDLQINEEKTLKKLKENE 851

>KLLA0E07227g complement(655635..658325) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c singleton, start by
           similarity
          Length = 896

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALS- 487
           P S  TW+      L  GK++ A + FSR   +D +   SW   +  YV   + ++A S 
Sbjct: 625 PLSFDTWYFYGCIGLECGKMNLAAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAHSC 684

Query: 488 ---AYSTAARFFPGTHLPHLYLGMQYNRMDDLSLA 519
              A S+ AR        ++ + M+    +D+ LA
Sbjct: 685 LKRAISSDARKNWRIWDNYMIVSMKLGEWEDVLLA 719

>AGR398W [4709] [Homologous to ScYOL145C (CTR9) - SH]
           complement(1459105..1462278) [3174 bp, 1057 aa]
          Length = 1057

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 56/121 (46%), Gaps = 11/121 (9%)

Query: 519 AEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIV 578
           A + F     + P +      L +I+ + + + ++   +++  D++ N          + 
Sbjct: 682 AVQLFQKVLQIDPLNIFAAQGLAIIFAESKRFGQSLDILRKVRDSLDNE--------DVH 733

Query: 579 INLGHTYRKLGEDERAIKCFK---TVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKA 635
           +NL H   ++ +  +AI+ ++   T  E+ +  +TL   LGF +      EK++D F KA
Sbjct: 734 MNLAHCLLEMKDFVKAIENYEITITRFENIENKSTLLNLLGFAWYSRGLKEKSLDCFLKA 793

Query: 636 L 636
           L
Sbjct: 794 L 794

>YNL313C (YNL313C) [4300] chr14 complement(45307..48021) Protein
           containing three TPR (tetratrico peptide repeat)
           domains, which may mediate protein-protein interactions,
           has high similarity to uncharacterized C. albicans
           Orf6.8345p [2715 bp, 904 aa]
          Length = 904

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 28/66 (42%)

Query: 427 NFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQAL 486
            +P S  TW+      L  GK+  A + F+R   +DP    SW   +  Y    + ++A 
Sbjct: 632 QYPLSFETWYFYGCVGLQCGKMQIAAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAY 691

Query: 487 SAYSTA 492
           S    A
Sbjct: 692 SCLKRA 697

>Scas_706.47
          Length = 620

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 10/47 (21%), Positives = 28/47 (59%)

Query: 593 RAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALD 639
           +A+KC+  +++++  +   WC+   ++ ++    + ID   KA+++D
Sbjct: 447 KAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVD 493

>KLLA0D06402g 547385..549280 weakly similar to sp|P40358
           Saccharomyces cerevisiae YJL073w JEM1 singleton,
           hypothetical start
          Length = 631

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 570 ESKAWISIV----INLGHTYRKLGEDERAIKCFKTVLESSKPT 608
           + K W  I+     NLG TY  LG++ +A+K F  V++S + +
Sbjct: 67  DGKQWDRIINQINYNLGITYLSLGQEPQALKSFNAVIDSDESS 109

>Kwal_56.23065
          Length = 907

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 16/115 (13%)

Query: 480 GEHEQALSAYSTAARFFPGTHL---PHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL 536
           G  +QA    + A + FP + L    HL L      +   SL    +  A     +DP +
Sbjct: 761 GNTDQARLLVTRALKQFPSSALLWVEHLKL------ITKKSLKRTAYQDALKNANSDPNV 814

Query: 537 LNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGED 591
           L E+G   +   NY KA K+ +RA +A   +  ++  W+S         +K+G D
Sbjct: 815 LLEIGSSLYSDANYEKALKWFERATNA-NPLYGDAWIWLS------RCNKKMGRD 862

>YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein with
           tetratricopeptide (TPR) repeats, part of a system to
           protect cells from double-stranded RNA (dsRNA) viruses
           [4299 bp, 1432 aa]
          Length = 1432

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 49/120 (40%), Gaps = 9/120 (7%)

Query: 523 FMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSE----SKAWISIV 578
           +  A+D+   D      +   Y  + N+  A     R    IK  K++    S  W   V
Sbjct: 651 YFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRL---IKGEKAKAELRSNNWPFRV 707

Query: 579 INLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
           + + H  ++  E+  +I+ F++ L         W  LG  Y    +IE +I  F KA+ L
Sbjct: 708 VGIAHLEKQ--EESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQL 765

>Scas_718.84
          Length = 2374

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 158  LMQHHYKTAEHIGDLIYSMTKD-PNDAFWLAQVYYNQGSYVRAV 200
            L+ +H KTA+ IG ++ ++TK  P+   W   V  N  S  R +
Sbjct: 1914 LLHNHSKTAKLIGSILLALTKKYPSHILWYISVLLNSSSKERTI 1957

>Kwal_33.14767
          Length = 594

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 85/226 (37%), Gaps = 19/226 (8%)

Query: 423 KLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEH 482
           K  E FP+ P T+  +A      G+ +E    F ++  +DP+    +      +    + 
Sbjct: 332 KAVEYFPR-PNTYIYMALIMADKGQATEYFDNFEKALELDPNCAAVYYHRGQMHFITQQF 390

Query: 483 EQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCPTDPLL------ 536
           EQA   +  A         P++ L     R    S +E  F  A    PT P +      
Sbjct: 391 EQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETLFSEARRKFPTSPEVPNFYAE 450

Query: 537 -LNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGEDE--- 592
            L++ G I   ++ Y  A K ++ A D I          +S +I       +    E   
Sbjct: 451 TLSDKGDIAGAKKEYDIAAK-LESALDGI-------HVGVSPLIGKATLLSREPSVENFI 502

Query: 593 RAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALAL 638
            A + F+   E+   +      L  L L+ + I++AI  F +A  L
Sbjct: 503 EATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 548

>CAGL0L03608g complement(412378..414846) some similarities with
           sp|P40955 Saccharomyces cerevisiae YJL099w CHS6 or
           sp|P36122 Saccharomyces cerevisiae YKR027w, hypothetical
           start
          Length = 822

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 64/149 (42%), Gaps = 19/149 (12%)

Query: 66  LVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLFGPALPSTLRKTSTSTD------- 118
           L Q I +   +A+P ++ +       L+    KN +    + +T+   S   D       
Sbjct: 303 LTQSILEFLSIASPLLIEYTIGILKELMEVDNKNSILYEVVLATVLHQSDEMDHDLVLIL 362

Query: 119 --TVELNNSTNDEDIDHASDNVFDVSDLSSVEKLR----LWRHDALMQHHYKTAEHIGDL 172
             T++  N    ++ +H  DN+F V+ LS +  ++    ++R + L     K AE +   
Sbjct: 363 HKTIDKLNKMLSDNTEHDFDNLFLVNCLSELLIIQTQYLIYRAEDL-----KLAEKVITH 417

Query: 173 IYSMTKDP-NDAFWLAQVYYNQGSYVRAV 200
              +T D     +WLA+ Y   G Y +A+
Sbjct: 418 STELTVDSFKSWYWLAKTYIYLGQYDKAL 446

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,434,694
Number of extensions: 1022137
Number of successful extensions: 4224
Number of sequences better than 10.0: 90
Number of HSP's gapped: 4268
Number of HSP's successfully gapped: 154
Length of query: 710
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 601
Effective length of database: 12,822,747
Effective search space: 7706470947
Effective search space used: 7706470947
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)